data_6TY2 # _entry.id 6TY2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.360 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6TY2 pdb_00006ty2 10.2210/pdb6ty2/pdb WWPDB D_1292106259 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6TY2 _pdbx_database_status.recvd_initial_deposition_date 2020-01-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Vignols, F.' 1 0000-0002-2031-0407 'Hoh, F.' 2 0000-0002-2905-7081 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? UK ? ? primary J.Mol.Biol. JMOBAK 0070 1089-8638 ? ? 434 ? 167715 167715 'A Flexible and Original Architecture of Two Unrelated Zinc Fingers Underlies the Role of the Multitask P1 in RYMV Spread.' 2022 ? 10.1016/j.jmb.2022.167715 35798161 ? ? ? ? ? ? ? ? UK ? ? 1 'J. Mol. Biol.' JMOBAK 0070 1089-8638 ? ? 425 ? 2423 2435 'The RYMV-encoded viral suppressor of RNA silencing P1 is a zinc-binding protein with redox-dependent flexibility.' 2013 ? 10.1016/j.jmb.2013.03.028 ? ? ? ? ? ? ? ? ? NE ? ? 2 'Biomol NMR Assign' ? ? 1874-270X ? ? 13 ? 345 348 'NMR chemical shift backbone assignment of the viral protein P1 encoded by the African Rice Yellow Mottle Virus.' 2019 ? 10.1007/s12104-019-09903-z ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Poignavent, V.' 1 ? primary 'Hoh, F.' 2 ? primary 'Terral, G.' 3 ? primary 'Yang, Y.' 4 ? primary 'Gillet, F.X.' 5 ? primary 'Kim, J.H.' 6 ? primary 'Allemand, F.' 7 ? primary 'Lacombe, E.' 8 ? primary 'Brugidou, C.' 9 ? primary 'Cianferani, S.' 10 ? primary 'Demene, H.' 11 ? primary 'Vignols, F.' 12 ? 1 'Gillet, F.X.' 13 ? 1 'Cattoni, D.I.' 14 ? 1 'Petiot-Becard, S.' 15 ? 1 'Delalande, F.' 16 ? 1 'Poignavent, V.' 17 ? 1 'Brizard, J.P.' 18 ? 1 'Bessin, Y.' 19 ? 1 'Dorsselaer, A.V.' 20 ? 1 'Declerck, N.' 21 ? 1 'Sanglier-Cianferani, S.' 22 ? 1 'Brugidou, C.' 23 ? 1 'Vignols, F.' 24 ? 2 'Yang, Y.' 25 ? 2 'Poignavent, V.' 26 ? 2 'Gillet, F.X.' 27 ? 2 'Vignols, F.' 28 ? 2 'Demene, H.' 29 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 101.10 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6TY2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 38.081 _cell.length_a_esd ? _cell.length_b 31.188 _cell.length_b_esd ? _cell.length_c 41.980 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6TY2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man p1 6435.082 2 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 water nat water 18.015 48 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DDEIDREHQERNAEISACNARALSEGRPASLVYLSRDACDIPEHSGRCRFVKYLNF _entity_poly.pdbx_seq_one_letter_code_can DDEIDREHQERNAEISACNARALSEGRPASLVYLSRDACDIPEHSGRCRFVKYLNF _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 ASP n 1 3 GLU n 1 4 ILE n 1 5 ASP n 1 6 ARG n 1 7 GLU n 1 8 HIS n 1 9 GLN n 1 10 GLU n 1 11 ARG n 1 12 ASN n 1 13 ALA n 1 14 GLU n 1 15 ILE n 1 16 SER n 1 17 ALA n 1 18 CYS n 1 19 ASN n 1 20 ALA n 1 21 ARG n 1 22 ALA n 1 23 LEU n 1 24 SER n 1 25 GLU n 1 26 GLY n 1 27 ARG n 1 28 PRO n 1 29 ALA n 1 30 SER n 1 31 LEU n 1 32 VAL n 1 33 TYR n 1 34 LEU n 1 35 SER n 1 36 ARG n 1 37 ASP n 1 38 ALA n 1 39 CYS n 1 40 ASP n 1 41 ILE n 1 42 PRO n 1 43 GLU n 1 44 HIS n 1 45 SER n 1 46 GLY n 1 47 ARG n 1 48 CYS n 1 49 ARG n 1 50 PHE n 1 51 VAL n 1 52 LYS n 1 53 TYR n 1 54 LEU n 1 55 ASN n 1 56 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 56 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rice yellow mottle virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 31744 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q709H6_9VIRU _struct_ref.pdbx_db_accession Q709H6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DDEIDREHQERNAEISACNARALSEGRPASLVYLSRDACDIPEHSGRCRFVKYLNF _struct_ref.pdbx_align_begin 102 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6TY2 A 1 ? 56 ? Q709H6 102 ? 157 ? 1 56 2 1 6TY2 B 1 ? 56 ? Q709H6 102 ? 157 ? 1 56 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6TY2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.01 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.87 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M tri-Sodium citrate pH 5.6, 20 %(v/v) Isopropanol and 20 %(w/v) PEG 4000.' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-07-01 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.253 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.253 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6TY2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.68 _reflns.d_resolution_low 41.29 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11192 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7 _reflns.pdbx_Rmerge_I_obs 0.01 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.015 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.0 _reflns.pdbx_CC_star 0.08 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.68 _reflns_shell.d_res_low 1.77 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1535 _reflns_shell.percent_possible_all 95 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.9 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.6 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6TY2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.980 _refine.ls_d_res_low 37.368 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6835 _refine.ls_number_reflns_R_free 344 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.91 _refine.ls_percent_reflns_R_free 5.03 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1953 _refine.ls_R_factor_R_free 0.2267 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1935 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.26 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.21 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.980 _refine_hist.d_res_low 37.368 _refine_hist.number_atoms_solvent 48 _refine_hist.number_atoms_total 897 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 847 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 859 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.069 ? 1154 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 13.400 ? 332 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.041 ? 120 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 159 ? f_plane_restr ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.9805 _refine_ls_shell.d_res_low 2.4951 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 167 _refine_ls_shell.number_reflns_R_work 3225 _refine_ls_shell.percent_reflns_obs 99.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2782 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2148 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6TY2 _struct.title 'CT PART CRYSTAL STRUCTURE OF THE RYMV-ENCODED VIRAL RNA SILENCING SUPPRESSOR P1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6TY2 _struct_keywords.text 'ZINC FINGERS, RNA SILENCING SUPPRESSOR, RNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 2 ? GLU A 25 ? ASP A 2 GLU A 25 1 ? 24 HELX_P HELX_P2 AA2 ILE A 41 ? SER A 45 ? ILE A 41 SER A 45 5 ? 5 HELX_P HELX_P3 AA3 ASP B 5 ? GLU B 25 ? ASP B 5 GLU B 25 1 ? 21 HELX_P HELX_P4 AA4 ILE B 41 ? SER B 45 ? ILE B 41 SER B 45 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 8 NE2 ? ? ? 1_555 C ZN . ZN L ? A HIS 8 A ZN 101 1_555 ? ? ? ? ? ? ? 2.050 ? ? metalc2 metalc ? ? A CYS 39 SG ? ? ? 1_555 C ZN . ZN L ? A CYS 39 A ZN 101 1_555 ? ? ? ? ? ? ? 2.302 ? ? metalc3 metalc ? ? A HIS 44 ND1 ? ? ? 1_555 C ZN . ZN L ? A HIS 44 A ZN 101 1_555 ? ? ? ? ? ? ? 2.204 ? ? metalc4 metalc ? ? A CYS 48 SG ? ? ? 1_555 C ZN . ZN L ? A CYS 48 A ZN 101 1_555 ? ? ? ? ? ? ? 2.296 ? ? metalc5 metalc ? ? B HIS 8 NE2 ? ? ? 1_555 D ZN . ZN L ? B HIS 8 B ZN 101 1_555 ? ? ? ? ? ? ? 2.041 ? ? metalc6 metalc ? ? B CYS 39 SG ? ? ? 1_555 D ZN . ZN L ? B CYS 39 B ZN 101 1_555 ? ? ? ? ? ? ? 2.289 ? ? metalc7 metalc ? ? B HIS 44 ND1 ? ? ? 1_555 D ZN . ZN L ? B HIS 44 B ZN 101 1_555 ? ? ? ? ? ? ? 2.317 ? ? metalc8 metalc ? ? B CYS 48 SG ? ? ? 1_555 D ZN . ZN L ? B CYS 48 B ZN 101 1_555 ? ? ? ? ? ? ? 2.359 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 101 ? 4 'binding site for residue ZN A 101' AC2 Software B ZN 101 ? 4 'binding site for residue ZN B 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 8 ? HIS A 8 . ? 1_555 ? 2 AC1 4 CYS A 39 ? CYS A 39 . ? 1_555 ? 3 AC1 4 HIS A 44 ? HIS A 44 . ? 1_555 ? 4 AC1 4 CYS A 48 ? CYS A 48 . ? 1_555 ? 5 AC2 4 HIS B 8 ? HIS B 8 . ? 1_555 ? 6 AC2 4 CYS B 39 ? CYS B 39 . ? 1_555 ? 7 AC2 4 HIS B 44 ? HIS B 44 . ? 1_555 ? 8 AC2 4 CYS B 48 ? CYS B 48 . ? 1_555 ? # _atom_sites.entry_id 6TY2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.026260 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.005153 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.032064 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024275 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 ? ? ? A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 PHE 56 56 ? ? ? A . n B 1 1 ASP 1 1 ? ? ? B . n B 1 2 ASP 2 2 ? ? ? B . n B 1 3 GLU 3 3 ? ? ? B . n B 1 4 ILE 4 4 4 ILE ILE B . n B 1 5 ASP 5 5 5 ASP ASP B . n B 1 6 ARG 6 6 6 ARG ARG B . n B 1 7 GLU 7 7 7 GLU GLU B . n B 1 8 HIS 8 8 8 HIS HIS B . n B 1 9 GLN 9 9 9 GLN GLN B . n B 1 10 GLU 10 10 10 GLU GLU B . n B 1 11 ARG 11 11 11 ARG ARG B . n B 1 12 ASN 12 12 12 ASN ASN B . n B 1 13 ALA 13 13 13 ALA ALA B . n B 1 14 GLU 14 14 14 GLU GLU B . n B 1 15 ILE 15 15 15 ILE ILE B . n B 1 16 SER 16 16 16 SER SER B . n B 1 17 ALA 17 17 17 ALA ALA B . n B 1 18 CYS 18 18 18 CYS CYS B . n B 1 19 ASN 19 19 19 ASN ASN B . n B 1 20 ALA 20 20 20 ALA ALA B . n B 1 21 ARG 21 21 21 ARG ARG B . n B 1 22 ALA 22 22 22 ALA ALA B . n B 1 23 LEU 23 23 23 LEU LEU B . n B 1 24 SER 24 24 24 SER SER B . n B 1 25 GLU 25 25 25 GLU GLU B . n B 1 26 GLY 26 26 26 GLY GLY B . n B 1 27 ARG 27 27 27 ARG ARG B . n B 1 28 PRO 28 28 28 PRO PRO B . n B 1 29 ALA 29 29 29 ALA ALA B . n B 1 30 SER 30 30 30 SER SER B . n B 1 31 LEU 31 31 31 LEU LEU B . n B 1 32 VAL 32 32 32 VAL VAL B . n B 1 33 TYR 33 33 33 TYR TYR B . n B 1 34 LEU 34 34 34 LEU LEU B . n B 1 35 SER 35 35 35 SER SER B . n B 1 36 ARG 36 36 36 ARG ARG B . n B 1 37 ASP 37 37 37 ASP ASP B . n B 1 38 ALA 38 38 38 ALA ALA B . n B 1 39 CYS 39 39 39 CYS CYS B . n B 1 40 ASP 40 40 40 ASP ASP B . n B 1 41 ILE 41 41 41 ILE ILE B . n B 1 42 PRO 42 42 42 PRO PRO B . n B 1 43 GLU 43 43 43 GLU GLU B . n B 1 44 HIS 44 44 44 HIS HIS B . n B 1 45 SER 45 45 45 SER SER B . n B 1 46 GLY 46 46 46 GLY GLY B . n B 1 47 ARG 47 47 47 ARG ARG B . n B 1 48 CYS 48 48 48 CYS CYS B . n B 1 49 ARG 49 49 49 ARG ARG B . n B 1 50 PHE 50 50 50 PHE PHE B . n B 1 51 VAL 51 51 51 VAL VAL B . n B 1 52 LYS 52 52 52 LYS LYS B . n B 1 53 TYR 53 53 53 TYR TYR B . n B 1 54 LEU 54 54 54 LEU LEU B . n B 1 55 ASN 55 55 55 ASN ASN B . n B 1 56 PHE 56 56 56 PHE GLY B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 ZN 1 101 1 ZN ZN A . D 2 ZN 1 101 2 ZN ZN B . E 3 HOH 1 201 29 HOH HOH A . E 3 HOH 2 202 26 HOH HOH A . E 3 HOH 3 203 17 HOH HOH A . E 3 HOH 4 204 19 HOH HOH A . E 3 HOH 5 205 9 HOH HOH A . E 3 HOH 6 206 42 HOH HOH A . E 3 HOH 7 207 2 HOH HOH A . E 3 HOH 8 208 8 HOH HOH A . E 3 HOH 9 209 33 HOH HOH A . E 3 HOH 10 210 34 HOH HOH A . E 3 HOH 11 211 39 HOH HOH A . E 3 HOH 12 212 11 HOH HOH A . E 3 HOH 13 213 27 HOH HOH A . E 3 HOH 14 214 22 HOH HOH A . E 3 HOH 15 215 51 HOH HOH A . E 3 HOH 16 216 10 HOH HOH A . E 3 HOH 17 217 30 HOH HOH A . E 3 HOH 18 218 41 HOH HOH A . E 3 HOH 19 219 15 HOH HOH A . E 3 HOH 20 220 1 HOH HOH A . E 3 HOH 21 221 45 HOH HOH A . E 3 HOH 22 222 32 HOH HOH A . E 3 HOH 23 223 31 HOH HOH A . E 3 HOH 24 224 18 HOH HOH A . E 3 HOH 25 225 47 HOH HOH A . E 3 HOH 26 226 56 HOH HOH A . F 3 HOH 1 201 21 HOH HOH B . F 3 HOH 2 202 16 HOH HOH B . F 3 HOH 3 203 13 HOH HOH B . F 3 HOH 4 204 24 HOH HOH B . F 3 HOH 5 205 3 HOH HOH B . F 3 HOH 6 206 40 HOH HOH B . F 3 HOH 7 207 20 HOH HOH B . F 3 HOH 8 208 7 HOH HOH B . F 3 HOH 9 209 23 HOH HOH B . F 3 HOH 10 210 28 HOH HOH B . F 3 HOH 11 211 53 HOH HOH B . F 3 HOH 12 212 12 HOH HOH B . F 3 HOH 13 213 14 HOH HOH B . F 3 HOH 14 214 52 HOH HOH B . F 3 HOH 15 215 46 HOH HOH B . F 3 HOH 16 216 50 HOH HOH B . F 3 HOH 17 217 36 HOH HOH B . F 3 HOH 18 218 44 HOH HOH B . F 3 HOH 19 219 25 HOH HOH B . F 3 HOH 20 220 49 HOH HOH B . F 3 HOH 21 221 48 HOH HOH B . F 3 HOH 22 222 54 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 360 ? 1 MORE -2 ? 1 'SSA (A^2)' 7620 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 8 ? A HIS 8 ? 1_555 ZN L C ZN . ? A ZN 101 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 104.8 ? 2 NE2 ? A HIS 8 ? A HIS 8 ? 1_555 ZN L C ZN . ? A ZN 101 ? 1_555 ND1 ? A HIS 44 ? A HIS 44 ? 1_555 99.5 ? 3 SG ? A CYS 39 ? A CYS 39 ? 1_555 ZN L C ZN . ? A ZN 101 ? 1_555 ND1 ? A HIS 44 ? A HIS 44 ? 1_555 105.5 ? 4 NE2 ? A HIS 8 ? A HIS 8 ? 1_555 ZN L C ZN . ? A ZN 101 ? 1_555 SG ? A CYS 48 ? A CYS 48 ? 1_555 107.7 ? 5 SG ? A CYS 39 ? A CYS 39 ? 1_555 ZN L C ZN . ? A ZN 101 ? 1_555 SG ? A CYS 48 ? A CYS 48 ? 1_555 123.0 ? 6 ND1 ? A HIS 44 ? A HIS 44 ? 1_555 ZN L C ZN . ? A ZN 101 ? 1_555 SG ? A CYS 48 ? A CYS 48 ? 1_555 113.5 ? 7 NE2 ? B HIS 8 ? B HIS 8 ? 1_555 ZN L D ZN . ? B ZN 101 ? 1_555 SG ? B CYS 39 ? B CYS 39 ? 1_555 103.5 ? 8 NE2 ? B HIS 8 ? B HIS 8 ? 1_555 ZN L D ZN . ? B ZN 101 ? 1_555 ND1 ? B HIS 44 ? B HIS 44 ? 1_555 103.0 ? 9 SG ? B CYS 39 ? B CYS 39 ? 1_555 ZN L D ZN . ? B ZN 101 ? 1_555 ND1 ? B HIS 44 ? B HIS 44 ? 1_555 107.7 ? 10 NE2 ? B HIS 8 ? B HIS 8 ? 1_555 ZN L D ZN . ? B ZN 101 ? 1_555 SG ? B CYS 48 ? B CYS 48 ? 1_555 111.1 ? 11 SG ? B CYS 39 ? B CYS 39 ? 1_555 ZN L D ZN . ? B ZN 101 ? 1_555 SG ? B CYS 48 ? B CYS 48 ? 1_555 119.9 ? 12 ND1 ? B HIS 44 ? B HIS 44 ? 1_555 ZN L D ZN . ? B ZN 101 ? 1_555 SG ? B CYS 48 ? B CYS 48 ? 1_555 110.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-01-27 2 'Structure model' 1 1 2022-08-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.id' 3 2 'Structure model' '_citation.journal_abbrev' 4 2 'Structure model' '_citation.journal_id_ASTM' 5 2 'Structure model' '_citation.journal_id_CSD' 6 2 'Structure model' '_citation.journal_id_ISSN' 7 2 'Structure model' '_citation.journal_volume' 8 2 'Structure model' '_citation.page_first' 9 2 'Structure model' '_citation.page_last' 10 2 'Structure model' '_citation.pdbx_database_id_DOI' 11 2 'Structure model' '_citation.pdbx_database_id_PubMed' 12 2 'Structure model' '_citation.title' 13 2 'Structure model' '_citation.year' 14 2 'Structure model' '_database_2.pdbx_DOI' 15 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.8.4_1496 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.21 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_entry_details.entry_id 6TY2 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 38 ? ? -163.65 104.36 2 1 ALA B 38 ? ? -161.99 104.20 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 B PHE 56 ? CB ? B PHE 56 CB 2 1 Y 1 B PHE 56 ? CG ? B PHE 56 CG 3 1 Y 1 B PHE 56 ? CD1 ? B PHE 56 CD1 4 1 Y 1 B PHE 56 ? CD2 ? B PHE 56 CD2 5 1 Y 1 B PHE 56 ? CE1 ? B PHE 56 CE1 6 1 Y 1 B PHE 56 ? CE2 ? B PHE 56 CE2 7 1 Y 1 B PHE 56 ? CZ ? B PHE 56 CZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 1 ? A ASP 1 2 1 Y 1 A PHE 56 ? A PHE 56 3 1 Y 1 B ASP 1 ? B ASP 1 4 1 Y 1 B ASP 2 ? B ASP 2 5 1 Y 1 B GLU 3 ? B GLU 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details dimer #