data_6UCG # _entry.id 6UCG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6UCG pdb_00006ucg 10.2210/pdb6ucg/pdb WWPDB D_1000244324 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-03-04 2 'Structure model' 1 1 2024-03-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6UCG _pdbx_database_status.recvd_initial_deposition_date 2019-09-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 5C4T _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Palte, R.L.' 1 ? 'Parthasarathy, G.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Med.Chem.Lett.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1948-5875 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 114 _citation.page_last 119 _citation.title 'Discovery ofN-(Indazol-3-yl)piperidine-4-carboxylic Acids as ROR gamma t Allosteric Inhibitors for Autoimmune Diseases.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsmedchemlett.9b00431 _citation.pdbx_database_id_PubMed 32071676 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, H.' 1 ? primary 'Lapointe, B.T.' 2 ? primary 'Anthony, N.' 3 ? primary 'Azevedo, R.' 4 ? primary 'Cals, J.' 5 ? primary 'Correll, C.C.' 6 ? primary 'Daniels, M.' 7 ? primary 'Deshmukh, S.' 8 ? primary 'van Eenenaam, H.' 9 ? primary 'Ferguson, H.' 10 ? primary 'Hegde, L.G.' 11 ? primary 'Karstens, W.J.' 12 ? primary 'Maclean, J.' 13 ? primary 'Miller, J.R.' 14 ? primary 'Moy, L.Y.' 15 ? primary 'Simov, V.' 16 ? primary 'Nagpal, S.' 17 ? primary 'Oubrie, A.' 18 ? primary 'Palte, R.L.' 19 ? primary 'Parthasarathy, G.' 20 ? primary 'Sciammetta, N.' 21 ? primary 'van der Stelt, M.' 22 ? primary 'Woodhouse, J.D.' 23 ? primary 'Trotter, B.W.' 24 ? primary 'Barr, K.' 25 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nuclear receptor ROR-gamma' 28184.672 1 ? ? ? ? 2 non-polymer syn '(3S,4R)-1-[1-(2-chloro-6-cyclopropylbenzene-1-carbonyl)-4-fluoro-1H-indazol-3-yl]-3-hydroxypiperidine-4-carboxylic acid' 457.882 1 ? ? ? ? 3 water nat water 18.015 5 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Nuclear receptor RZR-gamma,Nuclear receptor subfamily 1 group F member 3,RAR-related orphan receptor C,Retinoid-related orphan receptor-gamma ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;LTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQ NDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLI NAHRPGLQEKRKVEQLQYNLELAFHHHLHKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELF S ; _entity_poly.pdbx_seq_one_letter_code_can ;LTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQ NDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLI NAHRPGLQEKRKVEQLQYNLELAFHHHLHKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELF S ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(3S,4R)-1-[1-(2-chloro-6-cyclopropylbenzene-1-carbonyl)-4-fluoro-1H-indazol-3-yl]-3-hydroxypiperidine-4-carboxylic acid' Q3Y 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 THR n 1 3 GLU n 1 4 ILE n 1 5 GLU n 1 6 HIS n 1 7 LEU n 1 8 VAL n 1 9 GLN n 1 10 SER n 1 11 VAL n 1 12 CYS n 1 13 LYS n 1 14 SER n 1 15 TYR n 1 16 ARG n 1 17 GLU n 1 18 THR n 1 19 CYS n 1 20 GLN n 1 21 LEU n 1 22 ARG n 1 23 LEU n 1 24 GLU n 1 25 ASP n 1 26 LEU n 1 27 LEU n 1 28 ARG n 1 29 GLN n 1 30 ARG n 1 31 SER n 1 32 ASN n 1 33 ILE n 1 34 PHE n 1 35 SER n 1 36 ARG n 1 37 GLU n 1 38 GLU n 1 39 VAL n 1 40 THR n 1 41 GLY n 1 42 TYR n 1 43 GLN n 1 44 ARG n 1 45 LYS n 1 46 SER n 1 47 MET n 1 48 TRP n 1 49 GLU n 1 50 MET n 1 51 TRP n 1 52 GLU n 1 53 ARG n 1 54 CYS n 1 55 ALA n 1 56 HIS n 1 57 HIS n 1 58 LEU n 1 59 THR n 1 60 GLU n 1 61 ALA n 1 62 ILE n 1 63 GLN n 1 64 TYR n 1 65 VAL n 1 66 VAL n 1 67 GLU n 1 68 PHE n 1 69 ALA n 1 70 LYS n 1 71 ARG n 1 72 LEU n 1 73 SER n 1 74 GLY n 1 75 PHE n 1 76 MET n 1 77 GLU n 1 78 LEU n 1 79 CYS n 1 80 GLN n 1 81 ASN n 1 82 ASP n 1 83 GLN n 1 84 ILE n 1 85 VAL n 1 86 LEU n 1 87 LEU n 1 88 LYS n 1 89 ALA n 1 90 GLY n 1 91 ALA n 1 92 MET n 1 93 GLU n 1 94 VAL n 1 95 VAL n 1 96 LEU n 1 97 VAL n 1 98 ARG n 1 99 MET n 1 100 CYS n 1 101 ARG n 1 102 ALA n 1 103 TYR n 1 104 ASN n 1 105 ALA n 1 106 ASP n 1 107 ASN n 1 108 ARG n 1 109 THR n 1 110 VAL n 1 111 PHE n 1 112 PHE n 1 113 GLU n 1 114 GLY n 1 115 LYS n 1 116 TYR n 1 117 GLY n 1 118 GLY n 1 119 MET n 1 120 GLU n 1 121 LEU n 1 122 PHE n 1 123 ARG n 1 124 ALA n 1 125 LEU n 1 126 GLY n 1 127 CYS n 1 128 SER n 1 129 GLU n 1 130 LEU n 1 131 ILE n 1 132 SER n 1 133 SER n 1 134 ILE n 1 135 PHE n 1 136 ASP n 1 137 PHE n 1 138 SER n 1 139 HIS n 1 140 SER n 1 141 LEU n 1 142 SER n 1 143 ALA n 1 144 LEU n 1 145 HIS n 1 146 PHE n 1 147 SER n 1 148 GLU n 1 149 ASP n 1 150 GLU n 1 151 ILE n 1 152 ALA n 1 153 LEU n 1 154 TYR n 1 155 THR n 1 156 ALA n 1 157 LEU n 1 158 VAL n 1 159 LEU n 1 160 ILE n 1 161 ASN n 1 162 ALA n 1 163 HIS n 1 164 ARG n 1 165 PRO n 1 166 GLY n 1 167 LEU n 1 168 GLN n 1 169 GLU n 1 170 LYS n 1 171 ARG n 1 172 LYS n 1 173 VAL n 1 174 GLU n 1 175 GLN n 1 176 LEU n 1 177 GLN n 1 178 TYR n 1 179 ASN n 1 180 LEU n 1 181 GLU n 1 182 LEU n 1 183 ALA n 1 184 PHE n 1 185 HIS n 1 186 HIS n 1 187 HIS n 1 188 LEU n 1 189 HIS n 1 190 LYS n 1 191 THR n 1 192 HIS n 1 193 ARG n 1 194 GLN n 1 195 SER n 1 196 ILE n 1 197 LEU n 1 198 ALA n 1 199 LYS n 1 200 LEU n 1 201 PRO n 1 202 PRO n 1 203 LYS n 1 204 GLY n 1 205 LYS n 1 206 LEU n 1 207 ARG n 1 208 SER n 1 209 LEU n 1 210 CYS n 1 211 SER n 1 212 GLN n 1 213 HIS n 1 214 VAL n 1 215 GLU n 1 216 ARG n 1 217 LEU n 1 218 GLN n 1 219 ILE n 1 220 PHE n 1 221 GLN n 1 222 HIS n 1 223 LEU n 1 224 HIS n 1 225 PRO n 1 226 ILE n 1 227 VAL n 1 228 VAL n 1 229 GLN n 1 230 ALA n 1 231 ALA n 1 232 PHE n 1 233 PRO n 1 234 PRO n 1 235 LEU n 1 236 TYR n 1 237 LYS n 1 238 GLU n 1 239 LEU n 1 240 PHE n 1 241 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 241 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'RORC, NR1F3, RORG, RZRG' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 Q3Y non-polymer . '(3S,4R)-1-[1-(2-chloro-6-cyclopropylbenzene-1-carbonyl)-4-fluoro-1H-indazol-3-yl]-3-hydroxypiperidine-4-carboxylic acid' ? 'C23 H21 Cl F N3 O4' 457.882 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 267 267 LEU LEU A . n A 1 2 THR 2 268 268 THR THR A . n A 1 3 GLU 3 269 269 GLU GLU A . n A 1 4 ILE 4 270 270 ILE ILE A . n A 1 5 GLU 5 271 271 GLU GLU A . n A 1 6 HIS 6 272 272 HIS HIS A . n A 1 7 LEU 7 273 273 LEU LEU A . n A 1 8 VAL 8 274 274 VAL VAL A . n A 1 9 GLN 9 275 275 GLN GLN A . n A 1 10 SER 10 276 276 SER SER A . n A 1 11 VAL 11 277 277 VAL VAL A . n A 1 12 CYS 12 278 278 CYS CYS A . n A 1 13 LYS 13 279 279 LYS LYS A . n A 1 14 SER 14 280 280 SER SER A . n A 1 15 TYR 15 281 281 TYR TYR A . n A 1 16 ARG 16 282 282 ARG ARG A . n A 1 17 GLU 17 283 283 GLU GLU A . n A 1 18 THR 18 284 284 THR THR A . n A 1 19 CYS 19 285 285 CYS CYS A . n A 1 20 GLN 20 286 286 GLN GLN A . n A 1 21 LEU 21 287 287 LEU LEU A . n A 1 22 ARG 22 288 288 ARG ARG A . n A 1 23 LEU 23 289 289 LEU LEU A . n A 1 24 GLU 24 290 290 GLU GLU A . n A 1 25 ASP 25 291 291 ASP ASP A . n A 1 26 LEU 26 292 292 LEU LEU A . n A 1 27 LEU 27 293 293 LEU LEU A . n A 1 28 ARG 28 294 294 ARG ARG A . n A 1 29 GLN 29 295 295 GLN GLN A . n A 1 30 ARG 30 296 296 ARG ARG A . n A 1 31 SER 31 297 297 SER SER A . n A 1 32 ASN 32 298 298 ASN ASN A . n A 1 33 ILE 33 299 299 ILE ILE A . n A 1 34 PHE 34 300 300 PHE PHE A . n A 1 35 SER 35 301 301 SER SER A . n A 1 36 ARG 36 302 302 ARG ARG A . n A 1 37 GLU 37 303 303 GLU GLU A . n A 1 38 GLU 38 304 304 GLU GLU A . n A 1 39 VAL 39 305 305 VAL VAL A . n A 1 40 THR 40 306 306 THR THR A . n A 1 41 GLY 41 307 307 GLY GLY A . n A 1 42 TYR 42 308 308 TYR TYR A . n A 1 43 GLN 43 309 309 GLN GLN A . n A 1 44 ARG 44 310 310 ARG ARG A . n A 1 45 LYS 45 311 311 LYS LYS A . n A 1 46 SER 46 312 312 SER SER A . n A 1 47 MET 47 313 313 MET MET A . n A 1 48 TRP 48 314 314 TRP TRP A . n A 1 49 GLU 49 315 315 GLU GLU A . n A 1 50 MET 50 316 316 MET MET A . n A 1 51 TRP 51 317 317 TRP TRP A . n A 1 52 GLU 52 318 318 GLU GLU A . n A 1 53 ARG 53 319 319 ARG ARG A . n A 1 54 CYS 54 320 320 CYS CYS A . n A 1 55 ALA 55 321 321 ALA ALA A . n A 1 56 HIS 56 322 322 HIS HIS A . n A 1 57 HIS 57 323 323 HIS HIS A . n A 1 58 LEU 58 324 324 LEU LEU A . n A 1 59 THR 59 325 325 THR THR A . n A 1 60 GLU 60 326 326 GLU GLU A . n A 1 61 ALA 61 327 327 ALA ALA A . n A 1 62 ILE 62 328 328 ILE ILE A . n A 1 63 GLN 63 329 329 GLN GLN A . n A 1 64 TYR 64 330 330 TYR TYR A . n A 1 65 VAL 65 331 331 VAL VAL A . n A 1 66 VAL 66 332 332 VAL VAL A . n A 1 67 GLU 67 333 333 GLU GLU A . n A 1 68 PHE 68 334 334 PHE PHE A . n A 1 69 ALA 69 335 335 ALA ALA A . n A 1 70 LYS 70 336 336 LYS LYS A . n A 1 71 ARG 71 337 337 ARG ARG A . n A 1 72 LEU 72 338 338 LEU LEU A . n A 1 73 SER 73 339 339 SER SER A . n A 1 74 GLY 74 340 340 GLY GLY A . n A 1 75 PHE 75 341 341 PHE PHE A . n A 1 76 MET 76 342 342 MET MET A . n A 1 77 GLU 77 343 343 GLU GLU A . n A 1 78 LEU 78 344 344 LEU LEU A . n A 1 79 CYS 79 345 345 CYS CYS A . n A 1 80 GLN 80 346 346 GLN GLN A . n A 1 81 ASN 81 347 347 ASN ASN A . n A 1 82 ASP 82 348 348 ASP ASP A . n A 1 83 GLN 83 349 349 GLN GLN A . n A 1 84 ILE 84 350 350 ILE ILE A . n A 1 85 VAL 85 351 351 VAL VAL A . n A 1 86 LEU 86 352 352 LEU LEU A . n A 1 87 LEU 87 353 353 LEU LEU A . n A 1 88 LYS 88 354 354 LYS LYS A . n A 1 89 ALA 89 355 355 ALA ALA A . n A 1 90 GLY 90 356 356 GLY GLY A . n A 1 91 ALA 91 357 357 ALA ALA A . n A 1 92 MET 92 358 358 MET MET A . n A 1 93 GLU 93 359 359 GLU GLU A . n A 1 94 VAL 94 360 360 VAL VAL A . n A 1 95 VAL 95 361 361 VAL VAL A . n A 1 96 LEU 96 362 362 LEU LEU A . n A 1 97 VAL 97 363 363 VAL VAL A . n A 1 98 ARG 98 364 364 ARG ARG A . n A 1 99 MET 99 365 365 MET MET A . n A 1 100 CYS 100 366 366 CYS CYS A . n A 1 101 ARG 101 367 367 ARG ARG A . n A 1 102 ALA 102 368 368 ALA ALA A . n A 1 103 TYR 103 369 369 TYR TYR A . n A 1 104 ASN 104 370 370 ASN ASN A . n A 1 105 ALA 105 371 371 ALA ALA A . n A 1 106 ASP 106 372 372 ASP ASP A . n A 1 107 ASN 107 373 373 ASN ASN A . n A 1 108 ARG 108 374 374 ARG ARG A . n A 1 109 THR 109 375 375 THR THR A . n A 1 110 VAL 110 376 376 VAL VAL A . n A 1 111 PHE 111 377 377 PHE PHE A . n A 1 112 PHE 112 378 378 PHE PHE A . n A 1 113 GLU 113 379 379 GLU GLU A . n A 1 114 GLY 114 380 380 GLY GLY A . n A 1 115 LYS 115 381 381 LYS LYS A . n A 1 116 TYR 116 382 382 TYR TYR A . n A 1 117 GLY 117 383 383 GLY GLY A . n A 1 118 GLY 118 384 384 GLY GLY A . n A 1 119 MET 119 385 385 MET MET A . n A 1 120 GLU 120 386 386 GLU GLU A . n A 1 121 LEU 121 387 387 LEU LEU A . n A 1 122 PHE 122 388 388 PHE PHE A . n A 1 123 ARG 123 389 389 ARG ARG A . n A 1 124 ALA 124 390 390 ALA ALA A . n A 1 125 LEU 125 391 391 LEU LEU A . n A 1 126 GLY 126 392 392 GLY GLY A . n A 1 127 CYS 127 393 393 CYS CYS A . n A 1 128 SER 128 394 394 SER SER A . n A 1 129 GLU 129 395 395 GLU GLU A . n A 1 130 LEU 130 396 396 LEU LEU A . n A 1 131 ILE 131 397 397 ILE ILE A . n A 1 132 SER 132 398 398 SER SER A . n A 1 133 SER 133 399 399 SER SER A . n A 1 134 ILE 134 400 400 ILE ILE A . n A 1 135 PHE 135 401 401 PHE PHE A . n A 1 136 ASP 136 402 402 ASP ASP A . n A 1 137 PHE 137 403 403 PHE PHE A . n A 1 138 SER 138 404 404 SER SER A . n A 1 139 HIS 139 405 405 HIS HIS A . n A 1 140 SER 140 406 406 SER SER A . n A 1 141 LEU 141 407 407 LEU LEU A . n A 1 142 SER 142 408 408 SER SER A . n A 1 143 ALA 143 409 409 ALA ALA A . n A 1 144 LEU 144 410 410 LEU LEU A . n A 1 145 HIS 145 411 411 HIS HIS A . n A 1 146 PHE 146 412 412 PHE PHE A . n A 1 147 SER 147 413 413 SER SER A . n A 1 148 GLU 148 414 414 GLU GLU A . n A 1 149 ASP 149 415 415 ASP ASP A . n A 1 150 GLU 150 416 416 GLU GLU A . n A 1 151 ILE 151 417 417 ILE ILE A . n A 1 152 ALA 152 418 418 ALA ALA A . n A 1 153 LEU 153 419 419 LEU LEU A . n A 1 154 TYR 154 420 420 TYR TYR A . n A 1 155 THR 155 421 421 THR THR A . n A 1 156 ALA 156 422 422 ALA ALA A . n A 1 157 LEU 157 423 423 LEU LEU A . n A 1 158 VAL 158 424 424 VAL VAL A . n A 1 159 LEU 159 425 425 LEU LEU A . n A 1 160 ILE 160 426 426 ILE ILE A . n A 1 161 ASN 161 427 427 ASN ASN A . n A 1 162 ALA 162 428 428 ALA ALA A . n A 1 163 HIS 163 429 429 HIS HIS A . n A 1 164 ARG 164 430 430 ARG ARG A . n A 1 165 PRO 165 431 431 PRO PRO A . n A 1 166 GLY 166 432 432 GLY GLY A . n A 1 167 LEU 167 433 433 LEU LEU A . n A 1 168 GLN 168 434 434 GLN GLN A . n A 1 169 GLU 169 435 435 GLU GLU A . n A 1 170 LYS 170 436 436 LYS LYS A . n A 1 171 ARG 171 437 437 ARG ARG A . n A 1 172 LYS 172 438 438 LYS LYS A . n A 1 173 VAL 173 439 439 VAL VAL A . n A 1 174 GLU 174 440 440 GLU GLU A . n A 1 175 GLN 175 441 441 GLN GLN A . n A 1 176 LEU 176 442 442 LEU LEU A . n A 1 177 GLN 177 443 443 GLN GLN A . n A 1 178 TYR 178 444 444 TYR TYR A . n A 1 179 ASN 179 445 445 ASN ASN A . n A 1 180 LEU 180 446 446 LEU LEU A . n A 1 181 GLU 181 447 447 GLU GLU A . n A 1 182 LEU 182 448 448 LEU LEU A . n A 1 183 ALA 183 449 449 ALA ALA A . n A 1 184 PHE 184 450 450 PHE PHE A . n A 1 185 HIS 185 451 451 HIS HIS A . n A 1 186 HIS 186 452 452 HIS HIS A . n A 1 187 HIS 187 453 453 HIS HIS A . n A 1 188 LEU 188 454 454 LEU LEU A . n A 1 189 HIS 189 455 455 HIS HIS A . n A 1 190 LYS 190 456 456 LYS LYS A . n A 1 191 THR 191 457 457 THR THR A . n A 1 192 HIS 192 458 458 HIS HIS A . n A 1 193 ARG 193 459 459 ARG ARG A . n A 1 194 GLN 194 460 460 GLN GLN A . n A 1 195 SER 195 461 461 SER SER A . n A 1 196 ILE 196 462 462 ILE ILE A . n A 1 197 LEU 197 463 463 LEU LEU A . n A 1 198 ALA 198 464 464 ALA ALA A . n A 1 199 LYS 199 465 465 LYS LYS A . n A 1 200 LEU 200 466 466 LEU LEU A . n A 1 201 PRO 201 467 467 PRO PRO A . n A 1 202 PRO 202 468 468 PRO PRO A . n A 1 203 LYS 203 469 469 LYS LYS A . n A 1 204 GLY 204 470 470 GLY GLY A . n A 1 205 LYS 205 471 471 LYS LYS A . n A 1 206 LEU 206 472 472 LEU LEU A . n A 1 207 ARG 207 473 473 ARG ARG A . n A 1 208 SER 208 474 474 SER SER A . n A 1 209 LEU 209 475 475 LEU LEU A . n A 1 210 CYS 210 476 476 CYS CYS A . n A 1 211 SER 211 477 477 SER SER A . n A 1 212 GLN 212 478 478 GLN GLN A . n A 1 213 HIS 213 479 479 HIS HIS A . n A 1 214 VAL 214 480 480 VAL VAL A . n A 1 215 GLU 215 481 481 GLU GLU A . n A 1 216 ARG 216 482 482 ARG ARG A . n A 1 217 LEU 217 483 483 LEU LEU A . n A 1 218 GLN 218 484 484 GLN GLN A . n A 1 219 ILE 219 485 485 ILE ILE A . n A 1 220 PHE 220 486 486 PHE PHE A . n A 1 221 GLN 221 487 487 GLN GLN A . n A 1 222 HIS 222 488 488 HIS HIS A . n A 1 223 LEU 223 489 489 LEU LEU A . n A 1 224 HIS 224 490 490 HIS HIS A . n A 1 225 PRO 225 491 491 PRO PRO A . n A 1 226 ILE 226 492 492 ILE ILE A . n A 1 227 VAL 227 493 493 VAL VAL A . n A 1 228 VAL 228 494 494 VAL VAL A . n A 1 229 GLN 229 495 495 GLN GLN A . n A 1 230 ALA 230 496 496 ALA ALA A . n A 1 231 ALA 231 497 497 ALA ALA A . n A 1 232 PHE 232 498 498 PHE PHE A . n A 1 233 PRO 233 499 499 PRO PRO A . n A 1 234 PRO 234 500 500 PRO PRO A . n A 1 235 LEU 235 501 501 LEU LEU A . n A 1 236 TYR 236 502 502 TYR TYR A . n A 1 237 LYS 237 503 503 LYS LYS A . n A 1 238 GLU 238 504 504 GLU GLU A . n A 1 239 LEU 239 505 505 LEU LEU A . n A 1 240 PHE 240 506 506 PHE PHE A . n A 1 241 SER 241 507 507 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 Q3Y 1 601 1 Q3Y 138 A . C 3 HOH 1 701 1 HOH HOH A . C 3 HOH 2 702 4 HOH HOH A . C 3 HOH 3 703 5 HOH HOH A . C 3 HOH 4 704 3 HOH HOH A . C 3 HOH 5 705 2 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.5 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6UCG _cell.details ? _cell.formula_units_Z ? _cell.length_a 108.440 _cell.length_a_esd ? _cell.length_b 108.440 _cell.length_b_esd ? _cell.length_c 104.320 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6UCG _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6UCG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.14 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.84 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.2 to 1.8 M ammonium sulfate and 0.1 M Tris-HCl, pH 8.0 to 9.0' _exptl_crystal_grow.pdbx_pH_range 8.0-9.0 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-11-22 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6UCG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.87 _reflns.d_resolution_low 48.11 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8740 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.8 _reflns.pdbx_Rmerge_I_obs .065 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 33.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.87 _reflns_shell.d_res_low 3.03 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1235 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.88 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 19.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 12.6058 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 12.6058 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -25.2116 _refine.B_iso_max 167.500 _refine.B_iso_mean 86.4600 _refine.B_iso_min 51.310 _refine.correlation_coeff_Fo_to_Fc 0.9365 _refine.correlation_coeff_Fo_to_Fc_free 0.9285 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6UCG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8700 _refine.ls_d_res_low 48.1100 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8712 _refine.ls_number_reflns_R_free 413 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7700 _refine.ls_percent_reflns_R_free 4.7400 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2003 _refine.ls_R_factor_R_free 0.2604 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1971 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.3590 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.3600 _refine.pdbx_overall_SU_R_Blow_DPI 1.4820 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 1.0220 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 6UCG _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.403 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.8700 _refine_hist.d_res_low 48.1100 _refine_hist.number_atoms_solvent 5 _refine_hist.number_atoms_total 2016 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 241 _refine_hist.pdbx_B_iso_mean_ligand 78.60 _refine_hist.pdbx_B_iso_mean_solvent 71.35 _refine_hist.pdbx_number_atoms_protein 1979 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 32 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? ? ? 753 ? t_dihedral_angle_d 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 48 ? t_trig_c_planes 8.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 322 ? t_gen_planes 8.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 2068 ? t_it 20.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 250 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 2398 ? t_ideal_dist_contact 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 0.010 ? 2068 ? t_bond_d 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 1.140 ? 2792 ? t_angle_deg 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 1.880 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 22.950 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.8700 _refine_ls_shell.d_res_low 3.2100 _refine_ls_shell.number_reflns_all 2388 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 103 _refine_ls_shell.number_reflns_R_work 2285 _refine_ls_shell.percent_reflns_obs 99.7700 _refine_ls_shell.percent_reflns_R_free 4.3100 _refine_ls_shell.R_factor_all 0.2397 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3526 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2348 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6UCG _struct.title 'Retinoic acid receptor-related orphan receptor (ROR) gamma in complex with allosteric compound 28' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6UCG _struct_keywords.text 'ROR gamma T, allosteric, nuclear receptor, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RORG_HUMAN _struct_ref.pdbx_db_accession P51449 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQ NDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLI NAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELF S ; _struct_ref.pdbx_align_begin 267 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6UCG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 241 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P51449 _struct_ref_seq.db_align_beg 267 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 507 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 267 _struct_ref_seq.pdbx_auth_seq_align_end 507 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 6UCG _struct_ref_seq_dif.mon_id HIS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 189 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P51449 _struct_ref_seq_dif.db_mon_id CYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 455 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 455 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 3 ? THR A 18 ? GLU A 269 THR A 284 1 ? 16 HELX_P HELX_P2 AA2 ARG A 22 ? GLN A 29 ? ARG A 288 GLN A 295 1 ? 8 HELX_P HELX_P3 AA3 SER A 35 ? LYS A 45 ? SER A 301 LYS A 311 1 ? 11 HELX_P HELX_P4 AA4 SER A 46 ? LEU A 72 ? SER A 312 LEU A 338 1 ? 27 HELX_P HELX_P5 AA5 CYS A 79 ? MET A 99 ? CYS A 345 MET A 365 1 ? 21 HELX_P HELX_P6 AA6 GLY A 118 ? GLY A 126 ? GLY A 384 GLY A 392 5 ? 9 HELX_P HELX_P7 AA7 CYS A 127 ? ALA A 143 ? CYS A 393 ALA A 409 1 ? 17 HELX_P HELX_P8 AA8 SER A 147 ? ILE A 160 ? SER A 413 ILE A 426 1 ? 14 HELX_P HELX_P9 AA9 GLU A 169 ? THR A 191 ? GLU A 435 THR A 457 1 ? 23 HELX_P HELX_P10 AB1 SER A 195 ? LEU A 200 ? SER A 461 LEU A 466 1 ? 6 HELX_P HELX_P11 AB2 PRO A 202 ? HIS A 224 ? PRO A 468 HIS A 490 1 ? 23 HELX_P HELX_P12 AB3 PHE A 232 ? PHE A 240 ? PHE A 498 PHE A 506 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 103 ? ASN A 104 ? TYR A 369 ASN A 370 AA1 2 THR A 109 ? PHE A 112 ? THR A 375 PHE A 378 AA1 3 LYS A 115 ? GLY A 117 ? LYS A 381 GLY A 383 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 104 ? N ASN A 370 O THR A 109 ? O THR A 375 AA1 2 3 N VAL A 110 ? N VAL A 376 O GLY A 117 ? O GLY A 383 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id Q3Y _struct_site.pdbx_auth_seq_id 601 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 16 _struct_site.details 'binding site for residue Q3Y A 601' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 16 LEU A 58 ? LEU A 324 . ? 1_555 ? 2 AC1 16 THR A 59 ? THR A 325 . ? 1_555 ? 3 AC1 16 ILE A 62 ? ILE A 328 . ? 1_555 ? 4 AC1 16 GLN A 63 ? GLN A 329 . ? 1_555 ? 5 AC1 16 LEU A 87 ? LEU A 353 . ? 1_555 ? 6 AC1 16 LYS A 88 ? LYS A 354 . ? 1_555 ? 7 AC1 16 MET A 92 ? MET A 358 . ? 1_555 ? 8 AC1 16 VAL A 214 ? VAL A 480 . ? 1_555 ? 9 AC1 16 LEU A 217 ? LEU A 483 . ? 1_555 ? 10 AC1 16 ALA A 230 ? ALA A 496 . ? 1_555 ? 11 AC1 16 ALA A 231 ? ALA A 497 . ? 1_555 ? 12 AC1 16 PHE A 232 ? PHE A 498 . ? 1_555 ? 13 AC1 16 LEU A 235 ? LEU A 501 . ? 1_555 ? 14 AC1 16 TYR A 236 ? TYR A 502 . ? 1_555 ? 15 AC1 16 LEU A 239 ? LEU A 505 . ? 1_555 ? 16 AC1 16 PHE A 240 ? PHE A 506 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 269 ? ? 64.30 -29.24 2 1 ASN A 298 ? ? -69.00 90.86 3 1 GLU A 435 ? ? -144.67 58.12 # _pdbx_entry_details.entry_id 6UCG _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 Q3Y N1 N Y N 290 Q3Y C2 C Y N 291 Q3Y C4 C Y N 292 Q3Y C8 C Y N 293 Q3Y C7 C N N 294 Q3Y C6 C Y N 295 Q3Y C9 C Y N 296 Q3Y C10 C Y N 297 Q3Y C5 C Y N 298 Q3Y C13 C Y N 299 Q3Y C12 C Y N 300 Q3Y C11 C Y N 301 Q3Y C17 C N N 302 Q3Y C16 C N N 303 Q3Y C15 C N N 304 Q3Y C14 C N N 305 Q3Y N N Y N 306 Q3Y C C Y N 307 Q3Y O O N N 308 Q3Y C22 C N N 309 Q3Y C20 C N N 310 Q3Y C19 C N R 311 Q3Y O2 O N N 312 Q3Y O1 O N N 313 Q3Y C18 C N S 314 Q3Y O3 O N N 315 Q3Y C21 C N N 316 Q3Y N2 N N N 317 Q3Y F F N N 318 Q3Y C3 C Y N 319 Q3Y C1 C Y N 320 Q3Y CL CL N N 321 Q3Y H1 H N N 322 Q3Y H2 H N N 323 Q3Y H3 H N N 324 Q3Y H4 H N N 325 Q3Y H5 H N N 326 Q3Y H6 H N N 327 Q3Y H7 H N N 328 Q3Y H8 H N N 329 Q3Y H9 H N N 330 Q3Y H10 H N N 331 Q3Y H11 H N N 332 Q3Y H12 H N N 333 Q3Y H13 H N N 334 Q3Y H14 H N N 335 Q3Y H15 H N N 336 Q3Y H16 H N N 337 Q3Y H17 H N N 338 Q3Y H18 H N N 339 Q3Y H19 H N N 340 Q3Y H20 H N N 341 Q3Y H21 H N N 342 SER N N N N 343 SER CA C N S 344 SER C C N N 345 SER O O N N 346 SER CB C N N 347 SER OG O N N 348 SER OXT O N N 349 SER H H N N 350 SER H2 H N N 351 SER HA H N N 352 SER HB2 H N N 353 SER HB3 H N N 354 SER HG H N N 355 SER HXT H N N 356 THR N N N N 357 THR CA C N S 358 THR C C N N 359 THR O O N N 360 THR CB C N R 361 THR OG1 O N N 362 THR CG2 C N N 363 THR OXT O N N 364 THR H H N N 365 THR H2 H N N 366 THR HA H N N 367 THR HB H N N 368 THR HG1 H N N 369 THR HG21 H N N 370 THR HG22 H N N 371 THR HG23 H N N 372 THR HXT H N N 373 TRP N N N N 374 TRP CA C N S 375 TRP C C N N 376 TRP O O N N 377 TRP CB C N N 378 TRP CG C Y N 379 TRP CD1 C Y N 380 TRP CD2 C Y N 381 TRP NE1 N Y N 382 TRP CE2 C Y N 383 TRP CE3 C Y N 384 TRP CZ2 C Y N 385 TRP CZ3 C Y N 386 TRP CH2 C Y N 387 TRP OXT O N N 388 TRP H H N N 389 TRP H2 H N N 390 TRP HA H N N 391 TRP HB2 H N N 392 TRP HB3 H N N 393 TRP HD1 H N N 394 TRP HE1 H N N 395 TRP HE3 H N N 396 TRP HZ2 H N N 397 TRP HZ3 H N N 398 TRP HH2 H N N 399 TRP HXT H N N 400 TYR N N N N 401 TYR CA C N S 402 TYR C C N N 403 TYR O O N N 404 TYR CB C N N 405 TYR CG C Y N 406 TYR CD1 C Y N 407 TYR CD2 C Y N 408 TYR CE1 C Y N 409 TYR CE2 C Y N 410 TYR CZ C Y N 411 TYR OH O N N 412 TYR OXT O N N 413 TYR H H N N 414 TYR H2 H N N 415 TYR HA H N N 416 TYR HB2 H N N 417 TYR HB3 H N N 418 TYR HD1 H N N 419 TYR HD2 H N N 420 TYR HE1 H N N 421 TYR HE2 H N N 422 TYR HH H N N 423 TYR HXT H N N 424 VAL N N N N 425 VAL CA C N S 426 VAL C C N N 427 VAL O O N N 428 VAL CB C N N 429 VAL CG1 C N N 430 VAL CG2 C N N 431 VAL OXT O N N 432 VAL H H N N 433 VAL H2 H N N 434 VAL HA H N N 435 VAL HB H N N 436 VAL HG11 H N N 437 VAL HG12 H N N 438 VAL HG13 H N N 439 VAL HG21 H N N 440 VAL HG22 H N N 441 VAL HG23 H N N 442 VAL HXT H N N 443 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 Q3Y C1 C2 doub Y N 277 Q3Y C1 C sing Y N 278 Q3Y C2 C3 sing Y N 279 Q3Y C C5 doub Y N 280 Q3Y O C7 doub N N 281 Q3Y C3 N1 sing Y N 282 Q3Y C3 C4 doub Y N 283 Q3Y C5 C4 sing Y N 284 Q3Y C5 F sing N N 285 Q3Y CL C13 sing N N 286 Q3Y C7 N1 sing N N 287 Q3Y C7 C8 sing N N 288 Q3Y N1 N sing Y N 289 Q3Y C4 C6 sing Y N 290 Q3Y C8 C13 doub Y N 291 Q3Y C8 C9 sing Y N 292 Q3Y C13 C12 sing Y N 293 Q3Y N C6 doub Y N 294 Q3Y C6 N2 sing N N 295 Q3Y C9 C14 sing N N 296 Q3Y C9 C10 doub Y N 297 Q3Y C14 C15 sing N N 298 Q3Y C14 C16 sing N N 299 Q3Y C12 C11 doub Y N 300 Q3Y C15 C16 sing N N 301 Q3Y N2 C21 sing N N 302 Q3Y N2 C17 sing N N 303 Q3Y C10 C11 sing Y N 304 Q3Y C21 C20 sing N N 305 Q3Y C17 C18 sing N N 306 Q3Y C20 C19 sing N N 307 Q3Y C18 C19 sing N N 308 Q3Y C18 O3 sing N N 309 Q3Y C19 C22 sing N N 310 Q3Y C22 O1 doub N N 311 Q3Y C22 O2 sing N N 312 Q3Y C2 H1 sing N N 313 Q3Y C10 H2 sing N N 314 Q3Y C12 H3 sing N N 315 Q3Y C11 H4 sing N N 316 Q3Y C17 H5 sing N N 317 Q3Y C17 H6 sing N N 318 Q3Y C16 H7 sing N N 319 Q3Y C16 H8 sing N N 320 Q3Y C15 H9 sing N N 321 Q3Y C15 H10 sing N N 322 Q3Y C14 H11 sing N N 323 Q3Y C H12 sing N N 324 Q3Y C20 H13 sing N N 325 Q3Y C20 H14 sing N N 326 Q3Y C19 H15 sing N N 327 Q3Y O2 H16 sing N N 328 Q3Y C18 H17 sing N N 329 Q3Y O3 H18 sing N N 330 Q3Y C21 H19 sing N N 331 Q3Y C21 H20 sing N N 332 Q3Y C1 H21 sing N N 333 SER N CA sing N N 334 SER N H sing N N 335 SER N H2 sing N N 336 SER CA C sing N N 337 SER CA CB sing N N 338 SER CA HA sing N N 339 SER C O doub N N 340 SER C OXT sing N N 341 SER CB OG sing N N 342 SER CB HB2 sing N N 343 SER CB HB3 sing N N 344 SER OG HG sing N N 345 SER OXT HXT sing N N 346 THR N CA sing N N 347 THR N H sing N N 348 THR N H2 sing N N 349 THR CA C sing N N 350 THR CA CB sing N N 351 THR CA HA sing N N 352 THR C O doub N N 353 THR C OXT sing N N 354 THR CB OG1 sing N N 355 THR CB CG2 sing N N 356 THR CB HB sing N N 357 THR OG1 HG1 sing N N 358 THR CG2 HG21 sing N N 359 THR CG2 HG22 sing N N 360 THR CG2 HG23 sing N N 361 THR OXT HXT sing N N 362 TRP N CA sing N N 363 TRP N H sing N N 364 TRP N H2 sing N N 365 TRP CA C sing N N 366 TRP CA CB sing N N 367 TRP CA HA sing N N 368 TRP C O doub N N 369 TRP C OXT sing N N 370 TRP CB CG sing N N 371 TRP CB HB2 sing N N 372 TRP CB HB3 sing N N 373 TRP CG CD1 doub Y N 374 TRP CG CD2 sing Y N 375 TRP CD1 NE1 sing Y N 376 TRP CD1 HD1 sing N N 377 TRP CD2 CE2 doub Y N 378 TRP CD2 CE3 sing Y N 379 TRP NE1 CE2 sing Y N 380 TRP NE1 HE1 sing N N 381 TRP CE2 CZ2 sing Y N 382 TRP CE3 CZ3 doub Y N 383 TRP CE3 HE3 sing N N 384 TRP CZ2 CH2 doub Y N 385 TRP CZ2 HZ2 sing N N 386 TRP CZ3 CH2 sing Y N 387 TRP CZ3 HZ3 sing N N 388 TRP CH2 HH2 sing N N 389 TRP OXT HXT sing N N 390 TYR N CA sing N N 391 TYR N H sing N N 392 TYR N H2 sing N N 393 TYR CA C sing N N 394 TYR CA CB sing N N 395 TYR CA HA sing N N 396 TYR C O doub N N 397 TYR C OXT sing N N 398 TYR CB CG sing N N 399 TYR CB HB2 sing N N 400 TYR CB HB3 sing N N 401 TYR CG CD1 doub Y N 402 TYR CG CD2 sing Y N 403 TYR CD1 CE1 sing Y N 404 TYR CD1 HD1 sing N N 405 TYR CD2 CE2 doub Y N 406 TYR CD2 HD2 sing N N 407 TYR CE1 CZ doub Y N 408 TYR CE1 HE1 sing N N 409 TYR CE2 CZ sing Y N 410 TYR CE2 HE2 sing N N 411 TYR CZ OH sing N N 412 TYR OH HH sing N N 413 TYR OXT HXT sing N N 414 VAL N CA sing N N 415 VAL N H sing N N 416 VAL N H2 sing N N 417 VAL CA C sing N N 418 VAL CA CB sing N N 419 VAL CA HA sing N N 420 VAL C O doub N N 421 VAL C OXT sing N N 422 VAL CB CG1 sing N N 423 VAL CB CG2 sing N N 424 VAL CB HB sing N N 425 VAL CG1 HG11 sing N N 426 VAL CG1 HG12 sing N N 427 VAL CG1 HG13 sing N N 428 VAL CG2 HG21 sing N N 429 VAL CG2 HG22 sing N N 430 VAL CG2 HG23 sing N N 431 VAL OXT HXT sing N N 432 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id Q3Y _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id Q3Y _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _atom_sites.entry_id 6UCG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009222 _atom_sites.fract_transf_matrix[1][2] 0.005324 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010648 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009586 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL F N O S # loop_