data_6UHQ # _entry.id 6UHQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6UHQ pdb_00006uhq 10.2210/pdb6uhq/pdb WWPDB D_1000244552 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6UHQ _pdbx_database_status.recvd_initial_deposition_date 2019-09-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Winegar, P.W.' 1 0000-0003-0984-4990 'Hayes, O.G.' 2 0000-0002-9647-6411 'McMillan, J.R.' 3 0000-0002-3945-0194 'Figg, C.A.' 4 0000-0003-3514-7750 'Focia, P.J.' 5 ? 'Mirkin, C.A.' 6 0000-0002-6634-7627 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Chem _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2451-9294 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 6 _citation.language ? _citation.page_first 1007 _citation.page_last 1017 _citation.title 'DNA-Directed Protein Packing within Single Crystals.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.chempr.2020.03.002 _citation.pdbx_database_id_PubMed 33709040 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Winegar, P.H.' 1 ? primary 'Hayes, O.G.' 2 ? primary 'McMillan, J.R.' 3 ? primary 'Figg, C.A.' 4 ? primary 'Focia, P.J.' 5 ? primary 'Mirkin, C.A.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 110.330 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6UHQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 106.630 _cell.length_a_esd ? _cell.length_b 50.580 _cell.length_b_esd ? _cell.length_c 56.690 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6UHQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'C148 mGFP-cDNA-3' 31038.908 1 ? S148C ? ;This mutant of EGFP has a single surface cysteine at residue 148 (counting from M37 and counting CRO as 3 residues) and an N-terminal his-tag. ; 2 non-polymer syn 'UNKNOWN LIGAND' 32.065 1 ? ? ? ? 3 water nat water 18.015 32 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MRGSHHHHHHGMASMTGGQQMGRDLYENLYDDDDKMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFILTTGKLPVPWPTLVTTL(CRO)VQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNR IELKGIDFKEDGNILGHKLEYNYNCHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLS TQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK ; _entity_poly.pdbx_seq_one_letter_code_can ;MRGSHHHHHHGMASMTGGQQMGRDLYENLYDDDDKMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFILTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIE LKGIDFKEDGNILGHKLEYNYNCHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQ SALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 GLY n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 GLY n 1 12 MET n 1 13 ALA n 1 14 SER n 1 15 MET n 1 16 THR n 1 17 GLY n 1 18 GLY n 1 19 GLN n 1 20 GLN n 1 21 MET n 1 22 GLY n 1 23 ARG n 1 24 ASP n 1 25 LEU n 1 26 TYR n 1 27 GLU n 1 28 ASN n 1 29 LEU n 1 30 TYR n 1 31 ASP n 1 32 ASP n 1 33 ASP n 1 34 ASP n 1 35 LYS n 1 36 MET n 1 37 VAL n 1 38 SER n 1 39 LYS n 1 40 GLY n 1 41 GLU n 1 42 GLU n 1 43 LEU n 1 44 PHE n 1 45 THR n 1 46 GLY n 1 47 VAL n 1 48 VAL n 1 49 PRO n 1 50 ILE n 1 51 LEU n 1 52 VAL n 1 53 GLU n 1 54 LEU n 1 55 ASP n 1 56 GLY n 1 57 ASP n 1 58 VAL n 1 59 ASN n 1 60 GLY n 1 61 HIS n 1 62 LYS n 1 63 PHE n 1 64 SER n 1 65 VAL n 1 66 SER n 1 67 GLY n 1 68 GLU n 1 69 GLY n 1 70 GLU n 1 71 GLY n 1 72 ASP n 1 73 ALA n 1 74 THR n 1 75 TYR n 1 76 GLY n 1 77 LYS n 1 78 LEU n 1 79 THR n 1 80 LEU n 1 81 LYS n 1 82 PHE n 1 83 ILE n 1 84 LEU n 1 85 THR n 1 86 THR n 1 87 GLY n 1 88 LYS n 1 89 LEU n 1 90 PRO n 1 91 VAL n 1 92 PRO n 1 93 TRP n 1 94 PRO n 1 95 THR n 1 96 LEU n 1 97 VAL n 1 98 THR n 1 99 THR n 1 100 LEU n 1 101 CRO n 1 102 VAL n 1 103 GLN n 1 104 CYS n 1 105 PHE n 1 106 SER n 1 107 ARG n 1 108 TYR n 1 109 PRO n 1 110 ASP n 1 111 HIS n 1 112 MET n 1 113 LYS n 1 114 GLN n 1 115 HIS n 1 116 ASP n 1 117 PHE n 1 118 PHE n 1 119 LYS n 1 120 SER n 1 121 ALA n 1 122 MET n 1 123 PRO n 1 124 GLU n 1 125 GLY n 1 126 TYR n 1 127 VAL n 1 128 GLN n 1 129 GLU n 1 130 ARG n 1 131 THR n 1 132 ILE n 1 133 PHE n 1 134 PHE n 1 135 LYS n 1 136 ASP n 1 137 ASP n 1 138 GLY n 1 139 ASN n 1 140 TYR n 1 141 LYS n 1 142 THR n 1 143 ARG n 1 144 ALA n 1 145 GLU n 1 146 VAL n 1 147 LYS n 1 148 PHE n 1 149 GLU n 1 150 GLY n 1 151 ASP n 1 152 THR n 1 153 LEU n 1 154 VAL n 1 155 ASN n 1 156 ARG n 1 157 ILE n 1 158 GLU n 1 159 LEU n 1 160 LYS n 1 161 GLY n 1 162 ILE n 1 163 ASP n 1 164 PHE n 1 165 LYS n 1 166 GLU n 1 167 ASP n 1 168 GLY n 1 169 ASN n 1 170 ILE n 1 171 LEU n 1 172 GLY n 1 173 HIS n 1 174 LYS n 1 175 LEU n 1 176 GLU n 1 177 TYR n 1 178 ASN n 1 179 TYR n 1 180 ASN n 1 181 CYS n 1 182 HIS n 1 183 ASN n 1 184 VAL n 1 185 TYR n 1 186 ILE n 1 187 MET n 1 188 ALA n 1 189 ASP n 1 190 LYS n 1 191 GLN n 1 192 LYS n 1 193 ASN n 1 194 GLY n 1 195 ILE n 1 196 LYS n 1 197 VAL n 1 198 ASN n 1 199 PHE n 1 200 LYS n 1 201 ILE n 1 202 ARG n 1 203 HIS n 1 204 ASN n 1 205 ILE n 1 206 GLU n 1 207 ASP n 1 208 GLY n 1 209 SER n 1 210 VAL n 1 211 GLN n 1 212 LEU n 1 213 ALA n 1 214 ASP n 1 215 HIS n 1 216 TYR n 1 217 GLN n 1 218 GLN n 1 219 ASN n 1 220 THR n 1 221 PRO n 1 222 ILE n 1 223 GLY n 1 224 ASP n 1 225 GLY n 1 226 PRO n 1 227 VAL n 1 228 LEU n 1 229 LEU n 1 230 PRO n 1 231 ASP n 1 232 ASN n 1 233 HIS n 1 234 TYR n 1 235 LEU n 1 236 SER n 1 237 THR n 1 238 GLN n 1 239 SER n 1 240 ALA n 1 241 LEU n 1 242 SER n 1 243 LYS n 1 244 ASP n 1 245 PRO n 1 246 ASN n 1 247 GLU n 1 248 LYS n 1 249 ARG n 1 250 ASP n 1 251 HIS n 1 252 MET n 1 253 VAL n 1 254 LEU n 1 255 LEU n 1 256 GLU n 1 257 PHE n 1 258 VAL n 1 259 THR n 1 260 ALA n 1 261 ALA n 1 262 GLY n 1 263 ILE n 1 264 THR n 1 265 LEU n 1 266 GLY n 1 267 MET n 1 268 ASP n 1 269 GLU n 1 270 LEU n 1 271 TYR n 1 272 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 272 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aequorea victoria' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6100 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6UHQ _struct_ref.pdbx_db_accession 6UHQ _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6UHQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 272 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6UHQ _struct_ref_seq.db_align_beg -34 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 239 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -34 _struct_ref_seq.pdbx_auth_seq_align_end 239 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CRO 'L-peptide linking' n '{2-[(1R,2R)-1-amino-2-hydroxypropyl]-4-(4-hydroxybenzylidene)-5-oxo-4,5-dihydro-1H-imidazol-1-yl}acetic acid' 'PEPTIDE DERIVED CHROMOPHORE' 'C15 H17 N3 O5' 319.313 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UNL non-polymer . 'UNKNOWN LIGAND' ? ? ? VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6UHQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.31 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.74 _exptl_crystal.description 'Green crystals' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;1 microliter C148 mGFP-cDNA-3 (5 mg/mL (protein concentration) in 10 mM Tris Buffer pH 7.4, 137 mM NaCl) + 1 microliter crystallization condition (0.1 M MES pH 6.5, 30% (w/v) PEG 4000) in a sitting drop with a 70 microliter reservoir (0.1 M MES pH 6.5, 30% (w/v) PEG 4000) ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-300' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-12-01 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'C(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97872 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-F' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97872 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-F _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6UHQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.850 _reflns.d_resolution_low 53.159 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 6723 _reflns.number_obs 6723 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.300 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.300 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.178 _reflns.pdbx_netI_over_av_sigmaI 3.800 _reflns.pdbx_netI_over_sigmaI 5.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.212 _reflns.pdbx_Rpim_I_all 0.112 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 21886 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.850 3.000 ? 2.1 ? ? ? ? 976 99.200 ? ? ? ? 0.677 ? ? ? ? ? ? ? ? 3.200 0.677 ? ? ? 0.802 0.421 ? 1 1 ? ? ? 3.000 3.190 ? 3.1 ? ? ? ? 928 99.300 ? ? ? ? 0.404 ? ? ? ? ? ? ? ? 3.300 0.404 ? ? ? 0.479 0.252 ? 2 1 ? ? ? 3.190 3.410 ? 4.0 ? ? ? ? 850 99.200 ? ? ? ? 0.311 ? ? ? ? ? ? ? ? 3.300 0.311 ? ? ? 0.370 0.194 ? 3 1 ? ? ? 3.410 3.680 ? 5.4 ? ? ? ? 812 99.400 ? ? ? ? 0.212 ? ? ? ? ? ? ? ? 3.300 0.212 ? ? ? 0.252 0.133 ? 4 1 ? ? ? 3.680 4.030 ? 6.5 ? ? ? ? 742 99.700 ? ? ? ? 0.166 ? ? ? ? ? ? ? ? 3.200 0.166 ? ? ? 0.198 0.105 ? 5 1 ? ? ? 4.030 4.510 ? 8.7 ? ? ? ? 681 99.500 ? ? ? ? 0.113 ? ? ? ? ? ? ? ? 3.300 0.113 ? ? ? 0.134 0.070 ? 6 1 ? ? ? 4.510 5.200 ? 9.3 ? ? ? ? 596 99.200 ? ? ? ? 0.095 ? ? ? ? ? ? ? ? 3.300 0.095 ? ? ? 0.112 0.058 ? 7 1 ? ? ? 5.200 6.370 ? 7.8 ? ? ? ? 506 99.100 ? ? ? ? 0.116 ? ? ? ? ? ? ? ? 3.200 0.116 ? ? ? 0.140 0.075 ? 8 1 ? ? ? 6.370 9.010 ? 8.5 ? ? ? ? 402 99.300 ? ? ? ? 0.075 ? ? ? ? ? ? ? ? 3.100 0.075 ? ? ? 0.090 0.049 ? 9 1 ? ? ? 9.010 53.159 ? 11.4 ? ? ? ? 230 98.900 ? ? ? ? 0.054 ? ? ? ? ? ? ? ? 3.100 0.054 ? ? ? 0.066 0.037 ? 10 1 ? ? ? # _refine.aniso_B[1][1] -0.0300 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0100 _refine.aniso_B[2][2] 0.0300 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -0.0100 _refine.B_iso_max 98.200 _refine.B_iso_mean 29.4220 _refine.B_iso_min 1.180 _refine.correlation_coeff_Fo_to_Fc 0.9360 _refine.correlation_coeff_Fo_to_Fc_free 0.8380 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6UHQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8500 _refine.ls_d_res_low 50.0400 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6196 _refine.ls_number_reflns_R_free 526 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.2600 _refine.ls_percent_reflns_R_free 7.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1883 _refine.ls_R_factor_R_free 0.2739 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1812 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.2572 _refine.ls_wR_factor_R_work 0.1690 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5N9O _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.8050 _refine.pdbx_overall_ESU_R_Free 0.4340 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 17.3170 _refine.overall_SU_ML 0.3310 _refine.overall_SU_R_Cruickshank_DPI 0.8051 _refine.overall_SU_R_free 0.4339 _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.7896 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.8500 _refine_hist.d_res_low 50.0400 _refine_hist.number_atoms_solvent 32 _refine_hist.number_atoms_total 1796 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 231 _refine_hist.pdbx_B_iso_mean_ligand 58.90 _refine_hist.pdbx_B_iso_mean_solvent 24.02 _refine_hist.pdbx_number_atoms_protein 1763 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.013 1812 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1584 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.748 1.660 2464 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.188 1.582 3668 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 9.188 5.000 229 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.139 23.929 84 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.701 15.000 271 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 9.522 15.000 5 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.057 0.200 238 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 2056 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 371 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.8500 _refine_ls_shell.d_res_low 2.9240 _refine_ls_shell.number_reflns_all 503 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 29 _refine_ls_shell.number_reflns_R_work 474 _refine_ls_shell.percent_reflns_obs 99.6000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4340 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2960 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6UHQ _struct.title 'Crystal Structure of C148 mGFP-cDNA-3' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6UHQ _struct_keywords.text 'green fluorescent protein, beta-barrel, DNA, protein-DNA conjugate, FLUORESCENT PROTEIN' _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 39 ? PHE A 44 ? LYS A 4 PHE A 9 1 ? 6 HELX_P HELX_P2 AA2 PRO A 92 ? LEU A 96 ? PRO A 57 LEU A 61 5 ? 5 HELX_P HELX_P3 AA3 VAL A 102 ? SER A 106 ? VAL A 69 SER A 73 5 ? 5 HELX_P HELX_P4 AA4 PRO A 109 ? HIS A 115 ? PRO A 76 HIS A 82 5 ? 7 HELX_P HELX_P5 AA5 ASP A 116 ? ALA A 121 ? ASP A 83 ALA A 88 1 ? 6 HELX_P HELX_P6 AA6 LYS A 190 ? ASN A 193 ? LYS A 157 ASN A 160 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 100 C ? ? ? 1_555 A CRO 101 N1 ? ? A LEU 65 A CRO 66 1_555 ? ? ? ? ? ? ? 1.530 ? ? covale2 covale both ? A CRO 101 C3 ? ? ? 1_555 A VAL 102 N ? ? A CRO 66 A VAL 69 1_555 ? ? ? ? ? ? ? 1.439 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 122 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 89 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 123 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 90 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 6.07 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 12 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 48 ? VAL A 58 ? VAL A 13 VAL A 23 AA1 2 HIS A 61 ? ASP A 72 ? HIS A 26 ASP A 37 AA1 3 LYS A 77 ? THR A 86 ? LYS A 42 THR A 51 AA1 4 HIS A 251 ? ALA A 261 ? HIS A 218 ALA A 228 AA1 5 HIS A 233 ? SER A 242 ? HIS A 200 SER A 209 AA1 6 HIS A 182 ? ASP A 189 ? HIS A 149 ASP A 156 AA1 7 GLY A 194 ? ASN A 204 ? GLY A 161 ASN A 171 AA1 8 VAL A 210 ? PRO A 221 ? VAL A 177 PRO A 188 AA1 9 TYR A 126 ? PHE A 134 ? TYR A 93 PHE A 101 AA1 10 ASN A 139 ? GLU A 149 ? ASN A 106 GLU A 116 AA1 11 THR A 152 ? ILE A 162 ? THR A 119 ILE A 129 AA1 12 VAL A 48 ? VAL A 58 ? VAL A 13 VAL A 23 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 56 ? N GLY A 21 O PHE A 63 ? O PHE A 28 AA1 2 3 N GLU A 68 ? N GLU A 33 O LYS A 81 ? O LYS A 46 AA1 3 4 N PHE A 82 ? N PHE A 47 O MET A 252 ? O MET A 219 AA1 4 5 O THR A 259 ? O THR A 226 N SER A 236 ? N SER A 203 AA1 5 6 O HIS A 233 ? O HIS A 200 N ILE A 186 ? N ILE A 153 AA1 6 7 N MET A 187 ? N MET A 154 O LYS A 196 ? O LYS A 163 AA1 7 8 N ILE A 201 ? N ILE A 168 O ALA A 213 ? O ALA A 180 AA1 8 9 O TYR A 216 ? O TYR A 183 N THR A 131 ? N THR A 98 AA1 9 10 N GLN A 128 ? N GLN A 95 O ALA A 144 ? O ALA A 111 AA1 10 11 N LYS A 147 ? N LYS A 114 O VAL A 154 ? O VAL A 121 AA1 11 12 O ILE A 157 ? O ILE A 124 N GLU A 53 ? N GLU A 18 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id UNL _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'binding site for residue UNL A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 CYS A 181 ? CYS A 148 . ? 1_555 ? 2 AC1 2 HIS A 182 ? HIS A 149 . ? 1_555 ? # _database_PDB_matrix.entry_id 6UHQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 6UHQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009378 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.003475 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019771 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018812 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -34 ? ? ? A . n A 1 2 ARG 2 -33 ? ? ? A . n A 1 3 GLY 3 -32 ? ? ? A . n A 1 4 SER 4 -31 ? ? ? A . n A 1 5 HIS 5 -30 ? ? ? A . n A 1 6 HIS 6 -29 ? ? ? A . n A 1 7 HIS 7 -28 ? ? ? A . n A 1 8 HIS 8 -27 ? ? ? A . n A 1 9 HIS 9 -26 ? ? ? A . n A 1 10 HIS 10 -25 ? ? ? A . n A 1 11 GLY 11 -24 ? ? ? A . n A 1 12 MET 12 -23 ? ? ? A . n A 1 13 ALA 13 -22 ? ? ? A . n A 1 14 SER 14 -21 ? ? ? A . n A 1 15 MET 15 -20 ? ? ? A . n A 1 16 THR 16 -19 ? ? ? A . n A 1 17 GLY 17 -18 ? ? ? A . n A 1 18 GLY 18 -17 ? ? ? A . n A 1 19 GLN 19 -16 ? ? ? A . n A 1 20 GLN 20 -15 ? ? ? A . n A 1 21 MET 21 -14 ? ? ? A . n A 1 22 GLY 22 -13 ? ? ? A . n A 1 23 ARG 23 -12 ? ? ? A . n A 1 24 ASP 24 -11 ? ? ? A . n A 1 25 LEU 25 -10 ? ? ? A . n A 1 26 TYR 26 -9 ? ? ? A . n A 1 27 GLU 27 -8 ? ? ? A . n A 1 28 ASN 28 -7 ? ? ? A . n A 1 29 LEU 29 -6 ? ? ? A . n A 1 30 TYR 30 -5 ? ? ? A . n A 1 31 ASP 31 -4 ? ? ? A . n A 1 32 ASP 32 -3 ? ? ? A . n A 1 33 ASP 33 -2 -2 ASP ASP A . n A 1 34 ASP 34 -1 -1 ASP ASP A . n A 1 35 LYS 35 0 0 LYS LYS A . n A 1 36 MET 36 1 1 MET MET A . n A 1 37 VAL 37 2 2 VAL VAL A . n A 1 38 SER 38 3 3 SER SER A . n A 1 39 LYS 39 4 4 LYS LYS A . n A 1 40 GLY 40 5 5 GLY GLY A . n A 1 41 GLU 41 6 6 GLU GLU A . n A 1 42 GLU 42 7 7 GLU GLU A . n A 1 43 LEU 43 8 8 LEU LEU A . n A 1 44 PHE 44 9 9 PHE PHE A . n A 1 45 THR 45 10 10 THR THR A . n A 1 46 GLY 46 11 11 GLY GLY A . n A 1 47 VAL 47 12 12 VAL VAL A . n A 1 48 VAL 48 13 13 VAL VAL A . n A 1 49 PRO 49 14 14 PRO PRO A . n A 1 50 ILE 50 15 15 ILE ILE A . n A 1 51 LEU 51 16 16 LEU LEU A . n A 1 52 VAL 52 17 17 VAL VAL A . n A 1 53 GLU 53 18 18 GLU GLU A . n A 1 54 LEU 54 19 19 LEU LEU A . n A 1 55 ASP 55 20 20 ASP ASP A . n A 1 56 GLY 56 21 21 GLY GLY A . n A 1 57 ASP 57 22 22 ASP ASP A . n A 1 58 VAL 58 23 23 VAL VAL A . n A 1 59 ASN 59 24 24 ASN ASN A . n A 1 60 GLY 60 25 25 GLY GLY A . n A 1 61 HIS 61 26 26 HIS HIS A . n A 1 62 LYS 62 27 27 LYS LYS A . n A 1 63 PHE 63 28 28 PHE PHE A . n A 1 64 SER 64 29 29 SER SER A . n A 1 65 VAL 65 30 30 VAL VAL A . n A 1 66 SER 66 31 31 SER SER A . n A 1 67 GLY 67 32 32 GLY GLY A . n A 1 68 GLU 68 33 33 GLU GLU A . n A 1 69 GLY 69 34 34 GLY GLY A . n A 1 70 GLU 70 35 35 GLU GLU A . n A 1 71 GLY 71 36 36 GLY GLY A . n A 1 72 ASP 72 37 37 ASP ASP A . n A 1 73 ALA 73 38 38 ALA ALA A . n A 1 74 THR 74 39 39 THR THR A . n A 1 75 TYR 75 40 40 TYR TYR A . n A 1 76 GLY 76 41 41 GLY GLY A . n A 1 77 LYS 77 42 42 LYS LYS A . n A 1 78 LEU 78 43 43 LEU LEU A . n A 1 79 THR 79 44 44 THR THR A . n A 1 80 LEU 80 45 45 LEU LEU A . n A 1 81 LYS 81 46 46 LYS LYS A . n A 1 82 PHE 82 47 47 PHE PHE A . n A 1 83 ILE 83 48 48 ILE ILE A . n A 1 84 LEU 84 49 49 LEU LEU A . n A 1 85 THR 85 50 50 THR THR A . n A 1 86 THR 86 51 51 THR THR A . n A 1 87 GLY 87 52 52 GLY GLY A . n A 1 88 LYS 88 53 53 LYS LYS A . n A 1 89 LEU 89 54 54 LEU LEU A . n A 1 90 PRO 90 55 55 PRO PRO A . n A 1 91 VAL 91 56 56 VAL VAL A . n A 1 92 PRO 92 57 57 PRO PRO A . n A 1 93 TRP 93 58 58 TRP TRP A . n A 1 94 PRO 94 59 59 PRO PRO A . n A 1 95 THR 95 60 60 THR THR A . n A 1 96 LEU 96 61 61 LEU LEU A . n A 1 97 VAL 97 62 62 VAL VAL A . n A 1 98 THR 98 63 63 THR THR A . n A 1 99 THR 99 64 64 THR THR A . n A 1 100 LEU 100 65 65 LEU LEU A . n A 1 101 CRO 101 66 66 CRO CRO A . n A 1 102 VAL 102 69 69 VAL VAL A . n A 1 103 GLN 103 70 70 GLN GLN A . n A 1 104 CYS 104 71 71 CYS CYS A . n A 1 105 PHE 105 72 72 PHE PHE A . n A 1 106 SER 106 73 73 SER SER A . n A 1 107 ARG 107 74 74 ARG ARG A . n A 1 108 TYR 108 75 75 TYR TYR A . n A 1 109 PRO 109 76 76 PRO PRO A . n A 1 110 ASP 110 77 77 ASP ASP A . n A 1 111 HIS 111 78 78 HIS HIS A . n A 1 112 MET 112 79 79 MET MET A . n A 1 113 LYS 113 80 80 LYS LYS A . n A 1 114 GLN 114 81 81 GLN GLN A . n A 1 115 HIS 115 82 82 HIS HIS A . n A 1 116 ASP 116 83 83 ASP ASP A . n A 1 117 PHE 117 84 84 PHE PHE A . n A 1 118 PHE 118 85 85 PHE PHE A . n A 1 119 LYS 119 86 86 LYS LYS A . n A 1 120 SER 120 87 87 SER SER A . n A 1 121 ALA 121 88 88 ALA ALA A . n A 1 122 MET 122 89 89 MET MET A . n A 1 123 PRO 123 90 90 PRO PRO A . n A 1 124 GLU 124 91 91 GLU GLU A . n A 1 125 GLY 125 92 92 GLY GLY A . n A 1 126 TYR 126 93 93 TYR TYR A . n A 1 127 VAL 127 94 94 VAL VAL A . n A 1 128 GLN 128 95 95 GLN GLN A . n A 1 129 GLU 129 96 96 GLU GLU A . n A 1 130 ARG 130 97 97 ARG ARG A . n A 1 131 THR 131 98 98 THR THR A . n A 1 132 ILE 132 99 99 ILE ILE A . n A 1 133 PHE 133 100 100 PHE PHE A . n A 1 134 PHE 134 101 101 PHE PHE A . n A 1 135 LYS 135 102 102 LYS LYS A . n A 1 136 ASP 136 103 103 ASP ASP A . n A 1 137 ASP 137 104 104 ASP ASP A . n A 1 138 GLY 138 105 105 GLY GLY A . n A 1 139 ASN 139 106 106 ASN ASN A . n A 1 140 TYR 140 107 107 TYR TYR A . n A 1 141 LYS 141 108 108 LYS LYS A . n A 1 142 THR 142 109 109 THR THR A . n A 1 143 ARG 143 110 110 ARG ARG A . n A 1 144 ALA 144 111 111 ALA ALA A . n A 1 145 GLU 145 112 112 GLU GLU A . n A 1 146 VAL 146 113 113 VAL VAL A . n A 1 147 LYS 147 114 114 LYS LYS A . n A 1 148 PHE 148 115 115 PHE PHE A . n A 1 149 GLU 149 116 116 GLU GLU A . n A 1 150 GLY 150 117 117 GLY GLY A . n A 1 151 ASP 151 118 118 ASP ASP A . n A 1 152 THR 152 119 119 THR THR A . n A 1 153 LEU 153 120 120 LEU LEU A . n A 1 154 VAL 154 121 121 VAL VAL A . n A 1 155 ASN 155 122 122 ASN ASN A . n A 1 156 ARG 156 123 123 ARG ARG A . n A 1 157 ILE 157 124 124 ILE ILE A . n A 1 158 GLU 158 125 125 GLU GLU A . n A 1 159 LEU 159 126 126 LEU LEU A . n A 1 160 LYS 160 127 127 LYS LYS A . n A 1 161 GLY 161 128 128 GLY GLY A . n A 1 162 ILE 162 129 129 ILE ILE A . n A 1 163 ASP 163 130 130 ASP ASP A . n A 1 164 PHE 164 131 131 PHE PHE A . n A 1 165 LYS 165 132 132 LYS LYS A . n A 1 166 GLU 166 133 133 GLU GLU A . n A 1 167 ASP 167 134 134 ASP ASP A . n A 1 168 GLY 168 135 135 GLY GLY A . n A 1 169 ASN 169 136 136 ASN ASN A . n A 1 170 ILE 170 137 137 ILE ILE A . n A 1 171 LEU 171 138 138 LEU LEU A . n A 1 172 GLY 172 139 139 GLY GLY A . n A 1 173 HIS 173 140 140 HIS HIS A . n A 1 174 LYS 174 141 141 LYS LYS A . n A 1 175 LEU 175 142 142 LEU LEU A . n A 1 176 GLU 176 143 143 GLU GLU A . n A 1 177 TYR 177 144 144 TYR TYR A . n A 1 178 ASN 178 145 145 ASN ASN A . n A 1 179 TYR 179 146 146 TYR TYR A . n A 1 180 ASN 180 147 147 ASN ASN A . n A 1 181 CYS 181 148 148 CYS CYS A . n A 1 182 HIS 182 149 149 HIS HIS A . n A 1 183 ASN 183 150 150 ASN ASN A . n A 1 184 VAL 184 151 151 VAL VAL A . n A 1 185 TYR 185 152 152 TYR TYR A . n A 1 186 ILE 186 153 153 ILE ILE A . n A 1 187 MET 187 154 154 MET MET A . n A 1 188 ALA 188 155 155 ALA ALA A . n A 1 189 ASP 189 156 156 ASP ASP A . n A 1 190 LYS 190 157 157 LYS LYS A . n A 1 191 GLN 191 158 158 GLN GLN A . n A 1 192 LYS 192 159 159 LYS LYS A . n A 1 193 ASN 193 160 160 ASN ASN A . n A 1 194 GLY 194 161 161 GLY GLY A . n A 1 195 ILE 195 162 162 ILE ILE A . n A 1 196 LYS 196 163 163 LYS LYS A . n A 1 197 VAL 197 164 164 VAL VAL A . n A 1 198 ASN 198 165 165 ASN ASN A . n A 1 199 PHE 199 166 166 PHE PHE A . n A 1 200 LYS 200 167 167 LYS LYS A . n A 1 201 ILE 201 168 168 ILE ILE A . n A 1 202 ARG 202 169 169 ARG ARG A . n A 1 203 HIS 203 170 170 HIS HIS A . n A 1 204 ASN 204 171 171 ASN ASN A . n A 1 205 ILE 205 172 172 ILE ILE A . n A 1 206 GLU 206 173 173 GLU GLU A . n A 1 207 ASP 207 174 174 ASP ASP A . n A 1 208 GLY 208 175 175 GLY GLY A . n A 1 209 SER 209 176 176 SER SER A . n A 1 210 VAL 210 177 177 VAL VAL A . n A 1 211 GLN 211 178 178 GLN GLN A . n A 1 212 LEU 212 179 179 LEU LEU A . n A 1 213 ALA 213 180 180 ALA ALA A . n A 1 214 ASP 214 181 181 ASP ASP A . n A 1 215 HIS 215 182 182 HIS HIS A . n A 1 216 TYR 216 183 183 TYR TYR A . n A 1 217 GLN 217 184 184 GLN GLN A . n A 1 218 GLN 218 185 185 GLN GLN A . n A 1 219 ASN 219 186 186 ASN ASN A . n A 1 220 THR 220 187 187 THR THR A . n A 1 221 PRO 221 188 188 PRO PRO A . n A 1 222 ILE 222 189 189 ILE ILE A . n A 1 223 GLY 223 190 190 GLY GLY A . n A 1 224 ASP 224 191 191 ASP ASP A . n A 1 225 GLY 225 192 192 GLY GLY A . n A 1 226 PRO 226 193 193 PRO PRO A . n A 1 227 VAL 227 194 194 VAL VAL A . n A 1 228 LEU 228 195 195 LEU LEU A . n A 1 229 LEU 229 196 196 LEU LEU A . n A 1 230 PRO 230 197 197 PRO PRO A . n A 1 231 ASP 231 198 198 ASP ASP A . n A 1 232 ASN 232 199 199 ASN ASN A . n A 1 233 HIS 233 200 200 HIS HIS A . n A 1 234 TYR 234 201 201 TYR TYR A . n A 1 235 LEU 235 202 202 LEU LEU A . n A 1 236 SER 236 203 203 SER SER A . n A 1 237 THR 237 204 204 THR THR A . n A 1 238 GLN 238 205 205 GLN GLN A . n A 1 239 SER 239 206 206 SER SER A . n A 1 240 ALA 240 207 207 ALA ALA A . n A 1 241 LEU 241 208 208 LEU LEU A . n A 1 242 SER 242 209 209 SER SER A . n A 1 243 LYS 243 210 210 LYS LYS A . n A 1 244 ASP 244 211 211 ASP ASP A . n A 1 245 PRO 245 212 212 PRO PRO A . n A 1 246 ASN 246 213 213 ASN ASN A . n A 1 247 GLU 247 214 214 GLU GLU A . n A 1 248 LYS 248 215 215 LYS LYS A . n A 1 249 ARG 249 216 216 ARG ARG A . n A 1 250 ASP 250 217 217 ASP ASP A . n A 1 251 HIS 251 218 218 HIS HIS A . n A 1 252 MET 252 219 219 MET MET A . n A 1 253 VAL 253 220 220 VAL VAL A . n A 1 254 LEU 254 221 221 LEU LEU A . n A 1 255 LEU 255 222 222 LEU LEU A . n A 1 256 GLU 256 223 223 GLU GLU A . n A 1 257 PHE 257 224 224 PHE PHE A . n A 1 258 VAL 258 225 225 VAL VAL A . n A 1 259 THR 259 226 226 THR THR A . n A 1 260 ALA 260 227 227 ALA ALA A . n A 1 261 ALA 261 228 228 ALA ALA A . n A 1 262 GLY 262 229 229 GLY GLY A . n A 1 263 ILE 263 230 230 ILE ILE A . n A 1 264 THR 264 231 ? ? ? A . n A 1 265 LEU 265 232 ? ? ? A . n A 1 266 GLY 266 233 ? ? ? A . n A 1 267 MET 267 234 ? ? ? A . n A 1 268 ASP 268 235 ? ? ? A . n A 1 269 GLU 269 236 ? ? ? A . n A 1 270 LEU 270 237 ? ? ? A . n A 1 271 TYR 271 238 ? ? ? A . n A 1 272 LYS 272 239 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 UNL 1 301 1 UNL S A . C 3 HOH 1 401 3 HOH HOH A . C 3 HOH 2 402 16 HOH HOH A . C 3 HOH 3 403 4 HOH HOH A . C 3 HOH 4 404 28 HOH HOH A . C 3 HOH 5 405 17 HOH HOH A . C 3 HOH 6 406 12 HOH HOH A . C 3 HOH 7 407 30 HOH HOH A . C 3 HOH 8 408 31 HOH HOH A . C 3 HOH 9 409 6 HOH HOH A . C 3 HOH 10 410 2 HOH HOH A . C 3 HOH 11 411 9 HOH HOH A . C 3 HOH 12 412 1 HOH HOH A . C 3 HOH 13 413 8 HOH HOH A . C 3 HOH 14 414 11 HOH HOH A . C 3 HOH 15 415 18 HOH HOH A . C 3 HOH 16 416 29 HOH HOH A . C 3 HOH 17 417 15 HOH HOH A . C 3 HOH 18 418 10 HOH HOH A . C 3 HOH 19 419 13 HOH HOH A . C 3 HOH 20 420 5 HOH HOH A . C 3 HOH 21 421 32 HOH HOH A . C 3 HOH 22 422 7 HOH HOH A . C 3 HOH 23 423 20 HOH HOH A . C 3 HOH 24 424 21 HOH HOH A . C 3 HOH 25 425 14 HOH HOH A . C 3 HOH 26 426 25 HOH HOH A . C 3 HOH 27 427 19 HOH HOH A . C 3 HOH 28 428 24 HOH HOH A . C 3 HOH 29 429 26 HOH HOH A . C 3 HOH 30 430 23 HOH HOH A . C 3 HOH 31 431 22 HOH HOH A . C 3 HOH 32 432 27 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-03-18 2 'Structure model' 1 1 2021-03-24 3 'Structure model' 1 2 2023-10-11 4 'Structure model' 1 3 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation_author.identifier_ORCID' 7 2 'Structure model' '_citation_author.name' 8 3 'Structure model' '_database_2.pdbx_DOI' 9 3 'Structure model' '_database_2.pdbx_database_accession' 10 4 'Structure model' '_chem_comp_atom.atom_id' 11 4 'Structure model' '_chem_comp_bond.atom_id_2' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0257 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 6UHQ _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP -2 ? N ? A ASP 33 N 2 1 Y 1 A ASP -2 ? CA ? A ASP 33 CA 3 1 Y 1 A ASP -2 ? CB ? A ASP 33 CB 4 1 Y 1 A ASP -2 ? CG ? A ASP 33 CG 5 1 Y 1 A ASP -2 ? OD1 ? A ASP 33 OD1 6 1 Y 1 A ASP -2 ? OD2 ? A ASP 33 OD2 7 1 Y 1 A LYS 0 ? CD ? A LYS 35 CD 8 1 Y 1 A LYS 0 ? CE ? A LYS 35 CE 9 1 Y 1 A LYS 0 ? NZ ? A LYS 35 NZ 10 1 Y 1 A MET 1 ? CE ? A MET 36 CE 11 1 Y 1 A VAL 2 ? CG1 ? A VAL 37 CG1 12 1 Y 1 A VAL 2 ? CG2 ? A VAL 37 CG2 13 1 Y 1 A LYS 4 ? CE ? A LYS 39 CE 14 1 Y 1 A LYS 4 ? NZ ? A LYS 39 NZ 15 1 Y 1 A GLU 6 ? CB ? A GLU 41 CB 16 1 Y 1 A GLU 6 ? CG ? A GLU 41 CG 17 1 Y 1 A GLU 6 ? CD ? A GLU 41 CD 18 1 Y 1 A GLU 6 ? OE1 ? A GLU 41 OE1 19 1 Y 1 A GLU 6 ? OE2 ? A GLU 41 OE2 20 1 Y 1 A GLU 7 ? CD ? A GLU 42 CD 21 1 Y 1 A GLU 7 ? OE1 ? A GLU 42 OE1 22 1 Y 1 A GLU 7 ? OE2 ? A GLU 42 OE2 23 1 Y 1 A LYS 53 ? CG ? A LYS 88 CG 24 1 Y 1 A LYS 53 ? CD ? A LYS 88 CD 25 1 Y 1 A LYS 53 ? CE ? A LYS 88 CE 26 1 Y 1 A LYS 53 ? NZ ? A LYS 88 NZ 27 1 Y 1 A LYS 102 ? CD ? A LYS 135 CD 28 1 Y 1 A LYS 102 ? CE ? A LYS 135 CE 29 1 Y 1 A LYS 102 ? NZ ? A LYS 135 NZ 30 1 Y 1 A LYS 108 ? CD ? A LYS 141 CD 31 1 Y 1 A LYS 108 ? CE ? A LYS 141 CE 32 1 Y 1 A LYS 108 ? NZ ? A LYS 141 NZ 33 1 Y 1 A GLU 112 ? CG ? A GLU 145 CG 34 1 Y 1 A GLU 112 ? CD ? A GLU 145 CD 35 1 Y 1 A GLU 112 ? OE1 ? A GLU 145 OE1 36 1 Y 1 A GLU 112 ? OE2 ? A GLU 145 OE2 37 1 Y 1 A LYS 114 ? CE ? A LYS 147 CE 38 1 Y 1 A LYS 114 ? NZ ? A LYS 147 NZ 39 1 Y 1 A ASP 118 ? CG ? A ASP 151 CG 40 1 Y 1 A ASP 118 ? OD1 ? A ASP 151 OD1 41 1 Y 1 A ASP 118 ? OD2 ? A ASP 151 OD2 42 1 Y 1 A GLU 125 ? CD ? A GLU 158 CD 43 1 Y 1 A GLU 125 ? OE1 ? A GLU 158 OE1 44 1 Y 1 A GLU 125 ? OE2 ? A GLU 158 OE2 45 1 Y 1 A LYS 127 ? CG ? A LYS 160 CG 46 1 Y 1 A LYS 127 ? CD ? A LYS 160 CD 47 1 Y 1 A LYS 127 ? CE ? A LYS 160 CE 48 1 Y 1 A LYS 127 ? NZ ? A LYS 160 NZ 49 1 Y 1 A LYS 132 ? CE ? A LYS 165 CE 50 1 Y 1 A LYS 132 ? NZ ? A LYS 165 NZ 51 1 Y 1 A GLU 133 ? CD ? A GLU 166 CD 52 1 Y 1 A GLU 133 ? OE1 ? A GLU 166 OE1 53 1 Y 1 A GLU 133 ? OE2 ? A GLU 166 OE2 54 1 Y 1 A ASP 134 ? CG ? A ASP 167 CG 55 1 Y 1 A ASP 134 ? OD1 ? A ASP 167 OD1 56 1 Y 1 A ASP 134 ? OD2 ? A ASP 167 OD2 57 1 Y 1 A LYS 141 ? CG ? A LYS 174 CG 58 1 Y 1 A LYS 141 ? CD ? A LYS 174 CD 59 1 Y 1 A LYS 141 ? CE ? A LYS 174 CE 60 1 Y 1 A LYS 141 ? NZ ? A LYS 174 NZ 61 1 Y 1 A GLN 158 ? CD ? A GLN 191 CD 62 1 Y 1 A GLN 158 ? OE1 ? A GLN 191 OE1 63 1 Y 1 A GLN 158 ? NE2 ? A GLN 191 NE2 64 1 Y 1 A LYS 159 ? CD ? A LYS 192 CD 65 1 Y 1 A LYS 159 ? CE ? A LYS 192 CE 66 1 Y 1 A LYS 159 ? NZ ? A LYS 192 NZ 67 1 Y 1 A LYS 163 ? CD ? A LYS 196 CD 68 1 Y 1 A LYS 163 ? CE ? A LYS 196 CE 69 1 Y 1 A LYS 163 ? NZ ? A LYS 196 NZ 70 1 Y 1 A LYS 167 ? CG ? A LYS 200 CG 71 1 Y 1 A LYS 167 ? CD ? A LYS 200 CD 72 1 Y 1 A LYS 167 ? CE ? A LYS 200 CE 73 1 Y 1 A LYS 167 ? NZ ? A LYS 200 NZ 74 1 Y 1 A ARG 169 ? CZ ? A ARG 202 CZ 75 1 Y 1 A ARG 169 ? NH1 ? A ARG 202 NH1 76 1 Y 1 A ARG 169 ? NH2 ? A ARG 202 NH2 77 1 Y 1 A ASP 181 ? OD1 ? A ASP 214 OD1 78 1 Y 1 A ASP 181 ? OD2 ? A ASP 214 OD2 79 1 Y 1 A GLN 185 ? CD ? A GLN 218 CD 80 1 Y 1 A GLN 185 ? OE1 ? A GLN 218 OE1 81 1 Y 1 A GLN 185 ? NE2 ? A GLN 218 NE2 82 1 Y 1 A ASP 191 ? CG ? A ASP 224 CG 83 1 Y 1 A ASP 191 ? OD1 ? A ASP 224 OD1 84 1 Y 1 A ASP 191 ? OD2 ? A ASP 224 OD2 85 1 Y 1 A LYS 215 ? CG ? A LYS 248 CG 86 1 Y 1 A LYS 215 ? CD ? A LYS 248 CD 87 1 Y 1 A LYS 215 ? CE ? A LYS 248 CE 88 1 Y 1 A LYS 215 ? NZ ? A LYS 248 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -34 ? A MET 1 2 1 Y 1 A ARG -33 ? A ARG 2 3 1 Y 1 A GLY -32 ? A GLY 3 4 1 Y 1 A SER -31 ? A SER 4 5 1 Y 1 A HIS -30 ? A HIS 5 6 1 Y 1 A HIS -29 ? A HIS 6 7 1 Y 1 A HIS -28 ? A HIS 7 8 1 Y 1 A HIS -27 ? A HIS 8 9 1 Y 1 A HIS -26 ? A HIS 9 10 1 Y 1 A HIS -25 ? A HIS 10 11 1 Y 1 A GLY -24 ? A GLY 11 12 1 Y 1 A MET -23 ? A MET 12 13 1 Y 1 A ALA -22 ? A ALA 13 14 1 Y 1 A SER -21 ? A SER 14 15 1 Y 1 A MET -20 ? A MET 15 16 1 Y 1 A THR -19 ? A THR 16 17 1 Y 1 A GLY -18 ? A GLY 17 18 1 Y 1 A GLY -17 ? A GLY 18 19 1 Y 1 A GLN -16 ? A GLN 19 20 1 Y 1 A GLN -15 ? A GLN 20 21 1 Y 1 A MET -14 ? A MET 21 22 1 Y 1 A GLY -13 ? A GLY 22 23 1 Y 1 A ARG -12 ? A ARG 23 24 1 Y 1 A ASP -11 ? A ASP 24 25 1 Y 1 A LEU -10 ? A LEU 25 26 1 Y 1 A TYR -9 ? A TYR 26 27 1 Y 1 A GLU -8 ? A GLU 27 28 1 Y 1 A ASN -7 ? A ASN 28 29 1 Y 1 A LEU -6 ? A LEU 29 30 1 Y 1 A TYR -5 ? A TYR 30 31 1 Y 1 A ASP -4 ? A ASP 31 32 1 Y 1 A ASP -3 ? A ASP 32 33 1 Y 1 A THR 231 ? A THR 264 34 1 Y 1 A LEU 232 ? A LEU 265 35 1 Y 1 A GLY 233 ? A GLY 266 36 1 Y 1 A MET 234 ? A MET 267 37 1 Y 1 A ASP 235 ? A ASP 268 38 1 Y 1 A GLU 236 ? A GLU 269 39 1 Y 1 A LEU 237 ? A LEU 270 40 1 Y 1 A TYR 238 ? A TYR 271 41 1 Y 1 A LYS 239 ? A LYS 272 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CRO N1 N N N 74 CRO CA1 C N R 75 CRO CB1 C N R 76 CRO CG1 C N N 77 CRO OG1 O N N 78 CRO C1 C N N 79 CRO N2 N N N 80 CRO N3 N N N 81 CRO C2 C N N 82 CRO O2 O N N 83 CRO CA2 C N N 84 CRO CA3 C N N 85 CRO C3 C N N 86 CRO O3 O N N 87 CRO CB2 C N N 88 CRO CG2 C Y N 89 CRO CD1 C Y N 90 CRO CD2 C Y N 91 CRO CE1 C Y N 92 CRO CE2 C Y N 93 CRO CZ C Y N 94 CRO OH O N N 95 CRO OXT O N N 96 CRO H H N N 97 CRO H2 H N N 98 CRO HA1 H N N 99 CRO HB1 H N N 100 CRO HG11 H N N 101 CRO HG12 H N N 102 CRO HG13 H N N 103 CRO HOG1 H N N 104 CRO HA31 H N N 105 CRO HA32 H N N 106 CRO HXT H N N 107 CRO HB2 H N N 108 CRO HD1 H N N 109 CRO HD2 H N N 110 CRO HE1 H N N 111 CRO HE2 H N N 112 CRO HOH H N N 113 CYS N N N N 114 CYS CA C N R 115 CYS C C N N 116 CYS O O N N 117 CYS CB C N N 118 CYS SG S N N 119 CYS OXT O N N 120 CYS H H N N 121 CYS H2 H N N 122 CYS HA H N N 123 CYS HB2 H N N 124 CYS HB3 H N N 125 CYS HG H N N 126 CYS HXT H N N 127 GLN N N N N 128 GLN CA C N S 129 GLN C C N N 130 GLN O O N N 131 GLN CB C N N 132 GLN CG C N N 133 GLN CD C N N 134 GLN OE1 O N N 135 GLN NE2 N N N 136 GLN OXT O N N 137 GLN H H N N 138 GLN H2 H N N 139 GLN HA H N N 140 GLN HB2 H N N 141 GLN HB3 H N N 142 GLN HG2 H N N 143 GLN HG3 H N N 144 GLN HE21 H N N 145 GLN HE22 H N N 146 GLN HXT H N N 147 GLU N N N N 148 GLU CA C N S 149 GLU C C N N 150 GLU O O N N 151 GLU CB C N N 152 GLU CG C N N 153 GLU CD C N N 154 GLU OE1 O N N 155 GLU OE2 O N N 156 GLU OXT O N N 157 GLU H H N N 158 GLU H2 H N N 159 GLU HA H N N 160 GLU HB2 H N N 161 GLU HB3 H N N 162 GLU HG2 H N N 163 GLU HG3 H N N 164 GLU HE2 H N N 165 GLU HXT H N N 166 GLY N N N N 167 GLY CA C N N 168 GLY C C N N 169 GLY O O N N 170 GLY OXT O N N 171 GLY H H N N 172 GLY H2 H N N 173 GLY HA2 H N N 174 GLY HA3 H N N 175 GLY HXT H N N 176 HIS N N N N 177 HIS CA C N S 178 HIS C C N N 179 HIS O O N N 180 HIS CB C N N 181 HIS CG C Y N 182 HIS ND1 N Y N 183 HIS CD2 C Y N 184 HIS CE1 C Y N 185 HIS NE2 N Y N 186 HIS OXT O N N 187 HIS H H N N 188 HIS H2 H N N 189 HIS HA H N N 190 HIS HB2 H N N 191 HIS HB3 H N N 192 HIS HD1 H N N 193 HIS HD2 H N N 194 HIS HE1 H N N 195 HIS HE2 H N N 196 HIS HXT H N N 197 HOH O O N N 198 HOH H1 H N N 199 HOH H2 H N N 200 ILE N N N N 201 ILE CA C N S 202 ILE C C N N 203 ILE O O N N 204 ILE CB C N S 205 ILE CG1 C N N 206 ILE CG2 C N N 207 ILE CD1 C N N 208 ILE OXT O N N 209 ILE H H N N 210 ILE H2 H N N 211 ILE HA H N N 212 ILE HB H N N 213 ILE HG12 H N N 214 ILE HG13 H N N 215 ILE HG21 H N N 216 ILE HG22 H N N 217 ILE HG23 H N N 218 ILE HD11 H N N 219 ILE HD12 H N N 220 ILE HD13 H N N 221 ILE HXT H N N 222 LEU N N N N 223 LEU CA C N S 224 LEU C C N N 225 LEU O O N N 226 LEU CB C N N 227 LEU CG C N N 228 LEU CD1 C N N 229 LEU CD2 C N N 230 LEU OXT O N N 231 LEU H H N N 232 LEU H2 H N N 233 LEU HA H N N 234 LEU HB2 H N N 235 LEU HB3 H N N 236 LEU HG H N N 237 LEU HD11 H N N 238 LEU HD12 H N N 239 LEU HD13 H N N 240 LEU HD21 H N N 241 LEU HD22 H N N 242 LEU HD23 H N N 243 LEU HXT H N N 244 LYS N N N N 245 LYS CA C N S 246 LYS C C N N 247 LYS O O N N 248 LYS CB C N N 249 LYS CG C N N 250 LYS CD C N N 251 LYS CE C N N 252 LYS NZ N N N 253 LYS OXT O N N 254 LYS H H N N 255 LYS H2 H N N 256 LYS HA H N N 257 LYS HB2 H N N 258 LYS HB3 H N N 259 LYS HG2 H N N 260 LYS HG3 H N N 261 LYS HD2 H N N 262 LYS HD3 H N N 263 LYS HE2 H N N 264 LYS HE3 H N N 265 LYS HZ1 H N N 266 LYS HZ2 H N N 267 LYS HZ3 H N N 268 LYS HXT H N N 269 MET N N N N 270 MET CA C N S 271 MET C C N N 272 MET O O N N 273 MET CB C N N 274 MET CG C N N 275 MET SD S N N 276 MET CE C N N 277 MET OXT O N N 278 MET H H N N 279 MET H2 H N N 280 MET HA H N N 281 MET HB2 H N N 282 MET HB3 H N N 283 MET HG2 H N N 284 MET HG3 H N N 285 MET HE1 H N N 286 MET HE2 H N N 287 MET HE3 H N N 288 MET HXT H N N 289 PHE N N N N 290 PHE CA C N S 291 PHE C C N N 292 PHE O O N N 293 PHE CB C N N 294 PHE CG C Y N 295 PHE CD1 C Y N 296 PHE CD2 C Y N 297 PHE CE1 C Y N 298 PHE CE2 C Y N 299 PHE CZ C Y N 300 PHE OXT O N N 301 PHE H H N N 302 PHE H2 H N N 303 PHE HA H N N 304 PHE HB2 H N N 305 PHE HB3 H N N 306 PHE HD1 H N N 307 PHE HD2 H N N 308 PHE HE1 H N N 309 PHE HE2 H N N 310 PHE HZ H N N 311 PHE HXT H N N 312 PRO N N N N 313 PRO CA C N S 314 PRO C C N N 315 PRO O O N N 316 PRO CB C N N 317 PRO CG C N N 318 PRO CD C N N 319 PRO OXT O N N 320 PRO H H N N 321 PRO HA H N N 322 PRO HB2 H N N 323 PRO HB3 H N N 324 PRO HG2 H N N 325 PRO HG3 H N N 326 PRO HD2 H N N 327 PRO HD3 H N N 328 PRO HXT H N N 329 SER N N N N 330 SER CA C N S 331 SER C C N N 332 SER O O N N 333 SER CB C N N 334 SER OG O N N 335 SER OXT O N N 336 SER H H N N 337 SER H2 H N N 338 SER HA H N N 339 SER HB2 H N N 340 SER HB3 H N N 341 SER HG H N N 342 SER HXT H N N 343 THR N N N N 344 THR CA C N S 345 THR C C N N 346 THR O O N N 347 THR CB C N R 348 THR OG1 O N N 349 THR CG2 C N N 350 THR OXT O N N 351 THR H H N N 352 THR H2 H N N 353 THR HA H N N 354 THR HB H N N 355 THR HG1 H N N 356 THR HG21 H N N 357 THR HG22 H N N 358 THR HG23 H N N 359 THR HXT H N N 360 TRP N N N N 361 TRP CA C N S 362 TRP C C N N 363 TRP O O N N 364 TRP CB C N N 365 TRP CG C Y N 366 TRP CD1 C Y N 367 TRP CD2 C Y N 368 TRP NE1 N Y N 369 TRP CE2 C Y N 370 TRP CE3 C Y N 371 TRP CZ2 C Y N 372 TRP CZ3 C Y N 373 TRP CH2 C Y N 374 TRP OXT O N N 375 TRP H H N N 376 TRP H2 H N N 377 TRP HA H N N 378 TRP HB2 H N N 379 TRP HB3 H N N 380 TRP HD1 H N N 381 TRP HE1 H N N 382 TRP HE3 H N N 383 TRP HZ2 H N N 384 TRP HZ3 H N N 385 TRP HH2 H N N 386 TRP HXT H N N 387 TYR N N N N 388 TYR CA C N S 389 TYR C C N N 390 TYR O O N N 391 TYR CB C N N 392 TYR CG C Y N 393 TYR CD1 C Y N 394 TYR CD2 C Y N 395 TYR CE1 C Y N 396 TYR CE2 C Y N 397 TYR CZ C Y N 398 TYR OH O N N 399 TYR OXT O N N 400 TYR H H N N 401 TYR H2 H N N 402 TYR HA H N N 403 TYR HB2 H N N 404 TYR HB3 H N N 405 TYR HD1 H N N 406 TYR HD2 H N N 407 TYR HE1 H N N 408 TYR HE2 H N N 409 TYR HH H N N 410 TYR HXT H N N 411 VAL N N N N 412 VAL CA C N S 413 VAL C C N N 414 VAL O O N N 415 VAL CB C N N 416 VAL CG1 C N N 417 VAL CG2 C N N 418 VAL OXT O N N 419 VAL H H N N 420 VAL H2 H N N 421 VAL HA H N N 422 VAL HB H N N 423 VAL HG11 H N N 424 VAL HG12 H N N 425 VAL HG13 H N N 426 VAL HG21 H N N 427 VAL HG22 H N N 428 VAL HG23 H N N 429 VAL HXT H N N 430 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CRO CG1 CB1 sing N N 70 CRO OG1 CB1 sing N N 71 CRO CB1 CA1 sing N N 72 CRO N1 CA1 sing N N 73 CRO OH CZ sing N N 74 CRO CE1 CZ doub Y N 75 CRO CE1 CD1 sing Y N 76 CRO CA1 C1 sing N N 77 CRO CZ CE2 sing Y N 78 CRO CD1 CG2 doub Y N 79 CRO N2 C1 doub N N 80 CRO N2 CA2 sing N N 81 CRO C1 N3 sing N N 82 CRO CE2 CD2 doub Y N 83 CRO CG2 CD2 sing Y N 84 CRO CG2 CB2 sing N N 85 CRO N3 CA3 sing N N 86 CRO N3 C2 sing N N 87 CRO CA2 CB2 doub N Z 88 CRO CA2 C2 sing N N 89 CRO CA3 C3 sing N N 90 CRO OXT C3 sing N N 91 CRO C3 O3 doub N N 92 CRO C2 O2 doub N N 93 CRO N1 H sing N N 94 CRO N1 H2 sing N N 95 CRO CA1 HA1 sing N N 96 CRO CB1 HB1 sing N N 97 CRO CG1 HG11 sing N N 98 CRO CG1 HG12 sing N N 99 CRO CG1 HG13 sing N N 100 CRO OG1 HOG1 sing N N 101 CRO CA3 HA31 sing N N 102 CRO CA3 HA32 sing N N 103 CRO OXT HXT sing N N 104 CRO CB2 HB2 sing N N 105 CRO CD1 HD1 sing N N 106 CRO CD2 HD2 sing N N 107 CRO CE1 HE1 sing N N 108 CRO CE2 HE2 sing N N 109 CRO OH HOH sing N N 110 CYS N CA sing N N 111 CYS N H sing N N 112 CYS N H2 sing N N 113 CYS CA C sing N N 114 CYS CA CB sing N N 115 CYS CA HA sing N N 116 CYS C O doub N N 117 CYS C OXT sing N N 118 CYS CB SG sing N N 119 CYS CB HB2 sing N N 120 CYS CB HB3 sing N N 121 CYS SG HG sing N N 122 CYS OXT HXT sing N N 123 GLN N CA sing N N 124 GLN N H sing N N 125 GLN N H2 sing N N 126 GLN CA C sing N N 127 GLN CA CB sing N N 128 GLN CA HA sing N N 129 GLN C O doub N N 130 GLN C OXT sing N N 131 GLN CB CG sing N N 132 GLN CB HB2 sing N N 133 GLN CB HB3 sing N N 134 GLN CG CD sing N N 135 GLN CG HG2 sing N N 136 GLN CG HG3 sing N N 137 GLN CD OE1 doub N N 138 GLN CD NE2 sing N N 139 GLN NE2 HE21 sing N N 140 GLN NE2 HE22 sing N N 141 GLN OXT HXT sing N N 142 GLU N CA sing N N 143 GLU N H sing N N 144 GLU N H2 sing N N 145 GLU CA C sing N N 146 GLU CA CB sing N N 147 GLU CA HA sing N N 148 GLU C O doub N N 149 GLU C OXT sing N N 150 GLU CB CG sing N N 151 GLU CB HB2 sing N N 152 GLU CB HB3 sing N N 153 GLU CG CD sing N N 154 GLU CG HG2 sing N N 155 GLU CG HG3 sing N N 156 GLU CD OE1 doub N N 157 GLU CD OE2 sing N N 158 GLU OE2 HE2 sing N N 159 GLU OXT HXT sing N N 160 GLY N CA sing N N 161 GLY N H sing N N 162 GLY N H2 sing N N 163 GLY CA C sing N N 164 GLY CA HA2 sing N N 165 GLY CA HA3 sing N N 166 GLY C O doub N N 167 GLY C OXT sing N N 168 GLY OXT HXT sing N N 169 HIS N CA sing N N 170 HIS N H sing N N 171 HIS N H2 sing N N 172 HIS CA C sing N N 173 HIS CA CB sing N N 174 HIS CA HA sing N N 175 HIS C O doub N N 176 HIS C OXT sing N N 177 HIS CB CG sing N N 178 HIS CB HB2 sing N N 179 HIS CB HB3 sing N N 180 HIS CG ND1 sing Y N 181 HIS CG CD2 doub Y N 182 HIS ND1 CE1 doub Y N 183 HIS ND1 HD1 sing N N 184 HIS CD2 NE2 sing Y N 185 HIS CD2 HD2 sing N N 186 HIS CE1 NE2 sing Y N 187 HIS CE1 HE1 sing N N 188 HIS NE2 HE2 sing N N 189 HIS OXT HXT sing N N 190 HOH O H1 sing N N 191 HOH O H2 sing N N 192 ILE N CA sing N N 193 ILE N H sing N N 194 ILE N H2 sing N N 195 ILE CA C sing N N 196 ILE CA CB sing N N 197 ILE CA HA sing N N 198 ILE C O doub N N 199 ILE C OXT sing N N 200 ILE CB CG1 sing N N 201 ILE CB CG2 sing N N 202 ILE CB HB sing N N 203 ILE CG1 CD1 sing N N 204 ILE CG1 HG12 sing N N 205 ILE CG1 HG13 sing N N 206 ILE CG2 HG21 sing N N 207 ILE CG2 HG22 sing N N 208 ILE CG2 HG23 sing N N 209 ILE CD1 HD11 sing N N 210 ILE CD1 HD12 sing N N 211 ILE CD1 HD13 sing N N 212 ILE OXT HXT sing N N 213 LEU N CA sing N N 214 LEU N H sing N N 215 LEU N H2 sing N N 216 LEU CA C sing N N 217 LEU CA CB sing N N 218 LEU CA HA sing N N 219 LEU C O doub N N 220 LEU C OXT sing N N 221 LEU CB CG sing N N 222 LEU CB HB2 sing N N 223 LEU CB HB3 sing N N 224 LEU CG CD1 sing N N 225 LEU CG CD2 sing N N 226 LEU CG HG sing N N 227 LEU CD1 HD11 sing N N 228 LEU CD1 HD12 sing N N 229 LEU CD1 HD13 sing N N 230 LEU CD2 HD21 sing N N 231 LEU CD2 HD22 sing N N 232 LEU CD2 HD23 sing N N 233 LEU OXT HXT sing N N 234 LYS N CA sing N N 235 LYS N H sing N N 236 LYS N H2 sing N N 237 LYS CA C sing N N 238 LYS CA CB sing N N 239 LYS CA HA sing N N 240 LYS C O doub N N 241 LYS C OXT sing N N 242 LYS CB CG sing N N 243 LYS CB HB2 sing N N 244 LYS CB HB3 sing N N 245 LYS CG CD sing N N 246 LYS CG HG2 sing N N 247 LYS CG HG3 sing N N 248 LYS CD CE sing N N 249 LYS CD HD2 sing N N 250 LYS CD HD3 sing N N 251 LYS CE NZ sing N N 252 LYS CE HE2 sing N N 253 LYS CE HE3 sing N N 254 LYS NZ HZ1 sing N N 255 LYS NZ HZ2 sing N N 256 LYS NZ HZ3 sing N N 257 LYS OXT HXT sing N N 258 MET N CA sing N N 259 MET N H sing N N 260 MET N H2 sing N N 261 MET CA C sing N N 262 MET CA CB sing N N 263 MET CA HA sing N N 264 MET C O doub N N 265 MET C OXT sing N N 266 MET CB CG sing N N 267 MET CB HB2 sing N N 268 MET CB HB3 sing N N 269 MET CG SD sing N N 270 MET CG HG2 sing N N 271 MET CG HG3 sing N N 272 MET SD CE sing N N 273 MET CE HE1 sing N N 274 MET CE HE2 sing N N 275 MET CE HE3 sing N N 276 MET OXT HXT sing N N 277 PHE N CA sing N N 278 PHE N H sing N N 279 PHE N H2 sing N N 280 PHE CA C sing N N 281 PHE CA CB sing N N 282 PHE CA HA sing N N 283 PHE C O doub N N 284 PHE C OXT sing N N 285 PHE CB CG sing N N 286 PHE CB HB2 sing N N 287 PHE CB HB3 sing N N 288 PHE CG CD1 doub Y N 289 PHE CG CD2 sing Y N 290 PHE CD1 CE1 sing Y N 291 PHE CD1 HD1 sing N N 292 PHE CD2 CE2 doub Y N 293 PHE CD2 HD2 sing N N 294 PHE CE1 CZ doub Y N 295 PHE CE1 HE1 sing N N 296 PHE CE2 CZ sing Y N 297 PHE CE2 HE2 sing N N 298 PHE CZ HZ sing N N 299 PHE OXT HXT sing N N 300 PRO N CA sing N N 301 PRO N CD sing N N 302 PRO N H sing N N 303 PRO CA C sing N N 304 PRO CA CB sing N N 305 PRO CA HA sing N N 306 PRO C O doub N N 307 PRO C OXT sing N N 308 PRO CB CG sing N N 309 PRO CB HB2 sing N N 310 PRO CB HB3 sing N N 311 PRO CG CD sing N N 312 PRO CG HG2 sing N N 313 PRO CG HG3 sing N N 314 PRO CD HD2 sing N N 315 PRO CD HD3 sing N N 316 PRO OXT HXT sing N N 317 SER N CA sing N N 318 SER N H sing N N 319 SER N H2 sing N N 320 SER CA C sing N N 321 SER CA CB sing N N 322 SER CA HA sing N N 323 SER C O doub N N 324 SER C OXT sing N N 325 SER CB OG sing N N 326 SER CB HB2 sing N N 327 SER CB HB3 sing N N 328 SER OG HG sing N N 329 SER OXT HXT sing N N 330 THR N CA sing N N 331 THR N H sing N N 332 THR N H2 sing N N 333 THR CA C sing N N 334 THR CA CB sing N N 335 THR CA HA sing N N 336 THR C O doub N N 337 THR C OXT sing N N 338 THR CB OG1 sing N N 339 THR CB CG2 sing N N 340 THR CB HB sing N N 341 THR OG1 HG1 sing N N 342 THR CG2 HG21 sing N N 343 THR CG2 HG22 sing N N 344 THR CG2 HG23 sing N N 345 THR OXT HXT sing N N 346 TRP N CA sing N N 347 TRP N H sing N N 348 TRP N H2 sing N N 349 TRP CA C sing N N 350 TRP CA CB sing N N 351 TRP CA HA sing N N 352 TRP C O doub N N 353 TRP C OXT sing N N 354 TRP CB CG sing N N 355 TRP CB HB2 sing N N 356 TRP CB HB3 sing N N 357 TRP CG CD1 doub Y N 358 TRP CG CD2 sing Y N 359 TRP CD1 NE1 sing Y N 360 TRP CD1 HD1 sing N N 361 TRP CD2 CE2 doub Y N 362 TRP CD2 CE3 sing Y N 363 TRP NE1 CE2 sing Y N 364 TRP NE1 HE1 sing N N 365 TRP CE2 CZ2 sing Y N 366 TRP CE3 CZ3 doub Y N 367 TRP CE3 HE3 sing N N 368 TRP CZ2 CH2 doub Y N 369 TRP CZ2 HZ2 sing N N 370 TRP CZ3 CH2 sing Y N 371 TRP CZ3 HZ3 sing N N 372 TRP CH2 HH2 sing N N 373 TRP OXT HXT sing N N 374 TYR N CA sing N N 375 TYR N H sing N N 376 TYR N H2 sing N N 377 TYR CA C sing N N 378 TYR CA CB sing N N 379 TYR CA HA sing N N 380 TYR C O doub N N 381 TYR C OXT sing N N 382 TYR CB CG sing N N 383 TYR CB HB2 sing N N 384 TYR CB HB3 sing N N 385 TYR CG CD1 doub Y N 386 TYR CG CD2 sing Y N 387 TYR CD1 CE1 sing Y N 388 TYR CD1 HD1 sing N N 389 TYR CD2 CE2 doub Y N 390 TYR CD2 HD2 sing N N 391 TYR CE1 CZ doub Y N 392 TYR CE1 HE1 sing N N 393 TYR CE2 CZ sing Y N 394 TYR CE2 HE2 sing N N 395 TYR CZ OH sing N N 396 TYR OH HH sing N N 397 TYR OXT HXT sing N N 398 VAL N CA sing N N 399 VAL N H sing N N 400 VAL N H2 sing N N 401 VAL CA C sing N N 402 VAL CA CB sing N N 403 VAL CA HA sing N N 404 VAL C O doub N N 405 VAL C OXT sing N N 406 VAL CB CG1 sing N N 407 VAL CB CG2 sing N N 408 VAL CB HB sing N N 409 VAL CG1 HG11 sing N N 410 VAL CG1 HG12 sing N N 411 VAL CG1 HG13 sing N N 412 VAL CG2 HG21 sing N N 413 VAL CG2 HG22 sing N N 414 VAL CG2 HG23 sing N N 415 VAL OXT HXT sing N N 416 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Department of Defense (DOD, United States)' 'United States' N00014-15-1-0043 1 'Department of Defense (DOD, United States)' 'United States' FA9550-17-1-0348 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'UNKNOWN LIGAND' UNL 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5N9O _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #