data_6UVB # _entry.id 6UVB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6UVB pdb_00006uvb 10.2210/pdb6uvb/pdb WWPDB D_1000245257 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-11-04 2 'Structure model' 1 1 2021-04-21 3 'Structure model' 1 2 2023-10-11 4 'Structure model' 1 3 2024-10-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 4 'Structure model' pdbx_entry_details 8 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' 11 3 'Structure model' '_database_2.pdbx_DOI' 12 3 'Structure model' '_database_2.pdbx_database_accession' 13 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6UVB _pdbx_database_status.recvd_initial_deposition_date 2019-11-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'PDB entries for the same citation' _pdbx_database_related.db_id 6UV8 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yang, X.' 1 0000-0003-1394-9189 'Ren, Z.' 2 0000-0001-7098-3127 'Bandara, S.' 3 0000-0003-1029-1457 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 118 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of a far-red-sensing cyanobacteriochrome reveals an atypical bilin conformation and spectral tuning mechanism.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2025094118 _citation.pdbx_database_id_PubMed 33727422 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bandara, S.' 1 ? primary 'Rockwell, N.C.' 2 0000-0002-7748-7019 primary 'Zeng, X.' 3 ? primary 'Ren, Z.' 4 0000-0001-7098-3127 primary 'Wang, C.' 5 ? primary 'Shin, H.' 6 ? primary 'Martin, S.S.' 7 ? primary 'Moreno, M.V.' 8 0000-0002-2201-8792 primary 'Lagarias, J.C.' 9 0000-0002-2093-0403 primary 'Yang, X.' 10 0000-0003-1394-9189 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Multi-sensor signal transduction histidine kinase' 22056.049 1 ? ? ? ? 2 non-polymer syn PHYCOCYANOBILIN 588.694 1 ? ? ? ? 3 water nat water 18.015 4 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MLQLQRQKIIQDITQQIRSTLNVNHILATVTQQVKELMQVERVIIFRLFPNGRSQIVEEVVSSEYAALKNYHWEDEKWSQ EILDCYWQGKPRIVPDVINDIWTSCLVEYTTQGNIQSKIVAPILQELGENETGRWVSSEHKQKLWGVLVVHACSTKRVWE EDEAQLLQQIANQLAIAIQQLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MLQLQRQKIIQDITQQIRSTLNVNHILATVTQQVKELMQVERVIIFRLFPNGRSQIVEEVVSSEYAALKNYHWEDEKWSQ EILDCYWQGKPRIVPDVINDIWTSCLVEYTTQGNIQSKIVAPILQELGENETGRWVSSEHKQKLWGVLVVHACSTKRVWE EDEAQLLQQIANQLAIAIQQLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 PHYCOCYANOBILIN CYC 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 GLN n 1 4 LEU n 1 5 GLN n 1 6 ARG n 1 7 GLN n 1 8 LYS n 1 9 ILE n 1 10 ILE n 1 11 GLN n 1 12 ASP n 1 13 ILE n 1 14 THR n 1 15 GLN n 1 16 GLN n 1 17 ILE n 1 18 ARG n 1 19 SER n 1 20 THR n 1 21 LEU n 1 22 ASN n 1 23 VAL n 1 24 ASN n 1 25 HIS n 1 26 ILE n 1 27 LEU n 1 28 ALA n 1 29 THR n 1 30 VAL n 1 31 THR n 1 32 GLN n 1 33 GLN n 1 34 VAL n 1 35 LYS n 1 36 GLU n 1 37 LEU n 1 38 MET n 1 39 GLN n 1 40 VAL n 1 41 GLU n 1 42 ARG n 1 43 VAL n 1 44 ILE n 1 45 ILE n 1 46 PHE n 1 47 ARG n 1 48 LEU n 1 49 PHE n 1 50 PRO n 1 51 ASN n 1 52 GLY n 1 53 ARG n 1 54 SER n 1 55 GLN n 1 56 ILE n 1 57 VAL n 1 58 GLU n 1 59 GLU n 1 60 VAL n 1 61 VAL n 1 62 SER n 1 63 SER n 1 64 GLU n 1 65 TYR n 1 66 ALA n 1 67 ALA n 1 68 LEU n 1 69 LYS n 1 70 ASN n 1 71 TYR n 1 72 HIS n 1 73 TRP n 1 74 GLU n 1 75 ASP n 1 76 GLU n 1 77 LYS n 1 78 TRP n 1 79 SER n 1 80 GLN n 1 81 GLU n 1 82 ILE n 1 83 LEU n 1 84 ASP n 1 85 CYS n 1 86 TYR n 1 87 TRP n 1 88 GLN n 1 89 GLY n 1 90 LYS n 1 91 PRO n 1 92 ARG n 1 93 ILE n 1 94 VAL n 1 95 PRO n 1 96 ASP n 1 97 VAL n 1 98 ILE n 1 99 ASN n 1 100 ASP n 1 101 ILE n 1 102 TRP n 1 103 THR n 1 104 SER n 1 105 CYS n 1 106 LEU n 1 107 VAL n 1 108 GLU n 1 109 TYR n 1 110 THR n 1 111 THR n 1 112 GLN n 1 113 GLY n 1 114 ASN n 1 115 ILE n 1 116 GLN n 1 117 SER n 1 118 LYS n 1 119 ILE n 1 120 VAL n 1 121 ALA n 1 122 PRO n 1 123 ILE n 1 124 LEU n 1 125 GLN n 1 126 GLU n 1 127 LEU n 1 128 GLY n 1 129 GLU n 1 130 ASN n 1 131 GLU n 1 132 THR n 1 133 GLY n 1 134 ARG n 1 135 TRP n 1 136 VAL n 1 137 SER n 1 138 SER n 1 139 GLU n 1 140 HIS n 1 141 LYS n 1 142 GLN n 1 143 LYS n 1 144 LEU n 1 145 TRP n 1 146 GLY n 1 147 VAL n 1 148 LEU n 1 149 VAL n 1 150 VAL n 1 151 HIS n 1 152 ALA n 1 153 CYS n 1 154 SER n 1 155 THR n 1 156 LYS n 1 157 ARG n 1 158 VAL n 1 159 TRP n 1 160 GLU n 1 161 GLU n 1 162 ASP n 1 163 GLU n 1 164 ALA n 1 165 GLN n 1 166 LEU n 1 167 LEU n 1 168 GLN n 1 169 GLN n 1 170 ILE n 1 171 ALA n 1 172 ASN n 1 173 GLN n 1 174 LEU n 1 175 ALA n 1 176 ILE n 1 177 ALA n 1 178 ILE n 1 179 GLN n 1 180 GLN n 1 181 LEU n 1 182 GLU n 1 183 HIS n 1 184 HIS n 1 185 HIS n 1 186 HIS n 1 187 HIS n 1 188 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 188 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Anacy_2551 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 27899 / PCC 7122' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Anabaena cylindrica (strain ATCC 27899 / PCC 7122)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 272123 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYC non-polymer . PHYCOCYANOBILIN ? 'C33 H40 N4 O6' 588.694 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 839 839 MET MET A . n A 1 2 LEU 2 840 840 LEU LEU A . n A 1 3 GLN 3 841 841 GLN GLN A . n A 1 4 LEU 4 842 842 LEU LEU A . n A 1 5 GLN 5 843 843 GLN GLN A . n A 1 6 ARG 6 844 844 ARG ARG A . n A 1 7 GLN 7 845 845 GLN GLN A . n A 1 8 LYS 8 846 846 LYS LYS A . n A 1 9 ILE 9 847 847 ILE ILE A . n A 1 10 ILE 10 848 848 ILE ILE A . n A 1 11 GLN 11 849 849 GLN GLN A . n A 1 12 ASP 12 850 850 ASP ASP A . n A 1 13 ILE 13 851 851 ILE ILE A . n A 1 14 THR 14 852 852 THR THR A . n A 1 15 GLN 15 853 853 GLN GLN A . n A 1 16 GLN 16 854 854 GLN GLN A . n A 1 17 ILE 17 855 855 ILE ILE A . n A 1 18 ARG 18 856 856 ARG ARG A . n A 1 19 SER 19 857 857 SER SER A . n A 1 20 THR 20 858 858 THR THR A . n A 1 21 LEU 21 859 859 LEU LEU A . n A 1 22 ASN 22 860 860 ASN ASN A . n A 1 23 VAL 23 861 861 VAL VAL A . n A 1 24 ASN 24 862 862 ASN ASN A . n A 1 25 HIS 25 863 863 HIS HIS A . n A 1 26 ILE 26 864 864 ILE ILE A . n A 1 27 LEU 27 865 865 LEU LEU A . n A 1 28 ALA 28 866 866 ALA ALA A . n A 1 29 THR 29 867 867 THR THR A . n A 1 30 VAL 30 868 868 VAL VAL A . n A 1 31 THR 31 869 869 THR THR A . n A 1 32 GLN 32 870 870 GLN GLN A . n A 1 33 GLN 33 871 871 GLN GLN A . n A 1 34 VAL 34 872 872 VAL VAL A . n A 1 35 LYS 35 873 873 LYS LYS A . n A 1 36 GLU 36 874 874 GLU GLU A . n A 1 37 LEU 37 875 875 LEU LEU A . n A 1 38 MET 38 876 876 MET MET A . n A 1 39 GLN 39 877 877 GLN GLN A . n A 1 40 VAL 40 878 878 VAL VAL A . n A 1 41 GLU 41 879 879 GLU GLU A . n A 1 42 ARG 42 880 880 ARG ARG A . n A 1 43 VAL 43 881 881 VAL VAL A . n A 1 44 ILE 44 882 882 ILE ILE A . n A 1 45 ILE 45 883 883 ILE ILE A . n A 1 46 PHE 46 884 884 PHE PHE A . n A 1 47 ARG 47 885 885 ARG ARG A . n A 1 48 LEU 48 886 886 LEU LEU A . n A 1 49 PHE 49 887 887 PHE PHE A . n A 1 50 PRO 50 888 888 PRO PRO A . n A 1 51 ASN 51 889 889 ASN ASN A . n A 1 52 GLY 52 890 890 GLY GLY A . n A 1 53 ARG 53 891 891 ARG ARG A . n A 1 54 SER 54 892 892 SER SER A . n A 1 55 GLN 55 893 893 GLN GLN A . n A 1 56 ILE 56 894 894 ILE ILE A . n A 1 57 VAL 57 895 895 VAL VAL A . n A 1 58 GLU 58 896 896 GLU GLU A . n A 1 59 GLU 59 897 897 GLU GLU A . n A 1 60 VAL 60 898 898 VAL VAL A . n A 1 61 VAL 61 899 899 VAL VAL A . n A 1 62 SER 62 900 900 SER SER A . n A 1 63 SER 63 901 901 SER SER A . n A 1 64 GLU 64 902 902 GLU GLU A . n A 1 65 TYR 65 903 903 TYR TYR A . n A 1 66 ALA 66 904 904 ALA ALA A . n A 1 67 ALA 67 905 905 ALA ALA A . n A 1 68 LEU 68 906 906 LEU LEU A . n A 1 69 LYS 69 907 907 LYS LYS A . n A 1 70 ASN 70 908 908 ASN ASN A . n A 1 71 TYR 71 909 909 TYR TYR A . n A 1 72 HIS 72 910 910 HIS HIS A . n A 1 73 TRP 73 911 911 TRP TRP A . n A 1 74 GLU 74 912 912 GLU GLU A . n A 1 75 ASP 75 913 913 ASP ASP A . n A 1 76 GLU 76 914 914 GLU GLU A . n A 1 77 LYS 77 915 915 LYS LYS A . n A 1 78 TRP 78 916 916 TRP TRP A . n A 1 79 SER 79 917 917 SER SER A . n A 1 80 GLN 80 918 918 GLN GLN A . n A 1 81 GLU 81 919 919 GLU GLU A . n A 1 82 ILE 82 920 920 ILE ILE A . n A 1 83 LEU 83 921 921 LEU LEU A . n A 1 84 ASP 84 922 922 ASP ASP A . n A 1 85 CYS 85 923 923 CYS CYS A . n A 1 86 TYR 86 924 924 TYR TYR A . n A 1 87 TRP 87 925 925 TRP TRP A . n A 1 88 GLN 88 926 926 GLN GLN A . n A 1 89 GLY 89 927 927 GLY GLY A . n A 1 90 LYS 90 928 928 LYS LYS A . n A 1 91 PRO 91 929 929 PRO PRO A . n A 1 92 ARG 92 930 930 ARG ARG A . n A 1 93 ILE 93 931 931 ILE ILE A . n A 1 94 VAL 94 932 932 VAL VAL A . n A 1 95 PRO 95 933 933 PRO PRO A . n A 1 96 ASP 96 934 934 ASP ASP A . n A 1 97 VAL 97 935 935 VAL VAL A . n A 1 98 ILE 98 936 936 ILE ILE A . n A 1 99 ASN 99 937 937 ASN ASN A . n A 1 100 ASP 100 938 938 ASP ASP A . n A 1 101 ILE 101 939 939 ILE ILE A . n A 1 102 TRP 102 940 940 TRP TRP A . n A 1 103 THR 103 941 941 THR THR A . n A 1 104 SER 104 942 942 SER SER A . n A 1 105 CYS 105 943 943 CYS CYS A . n A 1 106 LEU 106 944 944 LEU LEU A . n A 1 107 VAL 107 945 945 VAL VAL A . n A 1 108 GLU 108 946 946 GLU GLU A . n A 1 109 TYR 109 947 947 TYR TYR A . n A 1 110 THR 110 948 948 THR THR A . n A 1 111 THR 111 949 949 THR THR A . n A 1 112 GLN 112 950 950 GLN GLN A . n A 1 113 GLY 113 951 951 GLY GLY A . n A 1 114 ASN 114 952 952 ASN ASN A . n A 1 115 ILE 115 953 953 ILE ILE A . n A 1 116 GLN 116 954 954 GLN GLN A . n A 1 117 SER 117 955 955 SER SER A . n A 1 118 LYS 118 956 956 LYS LYS A . n A 1 119 ILE 119 957 957 ILE ILE A . n A 1 120 VAL 120 958 958 VAL VAL A . n A 1 121 ALA 121 959 959 ALA ALA A . n A 1 122 PRO 122 960 960 PRO PRO A . n A 1 123 ILE 123 961 961 ILE ILE A . n A 1 124 LEU 124 962 962 LEU LEU A . n A 1 125 GLN 125 963 963 GLN GLN A . n A 1 126 GLU 126 964 964 GLU GLU A . n A 1 127 LEU 127 965 965 LEU LEU A . n A 1 128 GLY 128 966 966 GLY GLY A . n A 1 129 GLU 129 967 967 GLU GLU A . n A 1 130 ASN 130 968 968 ASN ASN A . n A 1 131 GLU 131 969 969 GLU GLU A . n A 1 132 THR 132 970 970 THR THR A . n A 1 133 GLY 133 971 971 GLY GLY A . n A 1 134 ARG 134 972 972 ARG ARG A . n A 1 135 TRP 135 973 973 TRP TRP A . n A 1 136 VAL 136 974 974 VAL VAL A . n A 1 137 SER 137 975 975 SER SER A . n A 1 138 SER 138 976 976 SER SER A . n A 1 139 GLU 139 977 977 GLU GLU A . n A 1 140 HIS 140 978 978 HIS HIS A . n A 1 141 LYS 141 979 979 LYS LYS A . n A 1 142 GLN 142 980 980 GLN GLN A . n A 1 143 LYS 143 981 981 LYS LYS A . n A 1 144 LEU 144 982 982 LEU LEU A . n A 1 145 TRP 145 983 983 TRP TRP A . n A 1 146 GLY 146 984 984 GLY GLY A . n A 1 147 VAL 147 985 985 VAL VAL A . n A 1 148 LEU 148 986 986 LEU LEU A . n A 1 149 VAL 149 987 987 VAL VAL A . n A 1 150 VAL 150 988 988 VAL VAL A . n A 1 151 HIS 151 989 989 HIS HIS A . n A 1 152 ALA 152 990 990 ALA ALA A . n A 1 153 CYS 153 991 991 CYS CYS A . n A 1 154 SER 154 992 992 SER SER A . n A 1 155 THR 155 993 993 THR THR A . n A 1 156 LYS 156 994 994 LYS LYS A . n A 1 157 ARG 157 995 995 ARG ARG A . n A 1 158 VAL 158 996 996 VAL VAL A . n A 1 159 TRP 159 997 997 TRP TRP A . n A 1 160 GLU 160 998 998 GLU GLU A . n A 1 161 GLU 161 999 999 GLU GLU A . n A 1 162 ASP 162 1000 1000 ASP ASP A . n A 1 163 GLU 163 1001 1001 GLU GLU A . n A 1 164 ALA 164 1002 1002 ALA ALA A . n A 1 165 GLN 165 1003 1003 GLN GLN A . n A 1 166 LEU 166 1004 1004 LEU LEU A . n A 1 167 LEU 167 1005 1005 LEU LEU A . n A 1 168 GLN 168 1006 1006 GLN GLN A . n A 1 169 GLN 169 1007 1007 GLN GLN A . n A 1 170 ILE 170 1008 1008 ILE ILE A . n A 1 171 ALA 171 1009 1009 ALA ALA A . n A 1 172 ASN 172 1010 1010 ASN ASN A . n A 1 173 GLN 173 1011 1011 GLN GLN A . n A 1 174 LEU 174 1012 1012 LEU LEU A . n A 1 175 ALA 175 1013 1013 ALA ALA A . n A 1 176 ILE 176 1014 1014 ILE ILE A . n A 1 177 ALA 177 1015 1015 ALA ALA A . n A 1 178 ILE 178 1016 1016 ILE ILE A . n A 1 179 GLN 179 1017 1017 GLN GLN A . n A 1 180 GLN 180 1018 1018 GLN GLN A . n A 1 181 LEU 181 1019 1019 LEU LEU A . n A 1 182 GLU 182 1020 1020 GLU GLU A . n A 1 183 HIS 183 1021 1021 HIS HIS A . n A 1 184 HIS 184 1022 ? ? ? A . n A 1 185 HIS 185 1023 ? ? ? A . n A 1 186 HIS 186 1024 ? ? ? A . n A 1 187 HIS 187 1025 ? ? ? A . n A 1 188 HIS 188 1026 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id CYC _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id CYC _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CYC 1 1900 1900 CYC CYC A . C 3 HOH 1 2001 16 HOH HOH A . C 3 HOH 2 2002 9 HOH HOH A . C 3 HOH 3 2003 3 HOH HOH A . C 3 HOH 4 2004 2 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10.1_2155 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6UVB _cell.details ? _cell.formula_units_Z ? _cell.length_a 108.788 _cell.length_a_esd ? _cell.length_b 108.788 _cell.length_b_esd ? _cell.length_c 68.697 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6UVB _symmetry.cell_setting ? _symmetry.Int_Tables_number 93 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 42 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6UVB _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.61 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 73.31 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 288 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;The protein solution (3 mg/ml) is mixed with the crystallization solution (17% PEG 10000, 0.1 M ammonium acetate, 0.1 M Bis-tris pH 5.5 with Yttrium(III) chloride as an additive) in a 1:1 ratio ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-11-05 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9787 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9787 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 98.980 _reflns.entry_id 6UVB _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.900 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9394 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.700 _reflns.pdbx_Rmerge_I_obs 0.080 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.235 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.087 _reflns.pdbx_Rpim_I_all 0.033 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 63276 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.900 2.950 ? ? ? ? ? ? 456 100.000 ? ? ? ? 1.688 ? ? ? ? ? ? ? ? 6.500 ? 0.556 ? ? 1.834 0.705 ? 1 1 0.488 ? ? 2.950 3.000 ? ? ? ? ? ? 468 100.000 ? ? ? ? 1.482 ? ? ? ? ? ? ? ? 6.900 ? 0.569 ? ? 1.602 0.600 ? 2 1 0.709 ? ? 3.000 3.060 ? ? ? ? ? ? 460 100.000 ? ? ? ? 1.215 ? ? ? ? ? ? ? ? 6.900 ? 0.592 ? ? 1.314 0.494 ? 3 1 0.734 ? ? 3.060 3.120 ? ? ? ? ? ? 470 100.000 ? ? ? ? 0.979 ? ? ? ? ? ? ? ? 6.900 ? 0.644 ? ? 1.058 0.396 ? 4 1 0.802 ? ? 3.120 3.190 ? ? ? ? ? ? 449 100.000 ? ? ? ? 0.784 ? ? ? ? ? ? ? ? 7.000 ? 0.592 ? ? 0.849 0.319 ? 5 1 0.806 ? ? 3.190 3.270 ? ? ? ? ? ? 476 100.000 ? ? ? ? 0.554 ? ? ? ? ? ? ? ? 7.000 ? 0.646 ? ? 0.599 0.224 ? 6 1 0.922 ? ? 3.270 3.350 ? ? ? ? ? ? 459 100.000 ? ? ? ? 0.437 ? ? ? ? ? ? ? ? 6.700 ? 0.672 ? ? 0.476 0.183 ? 7 1 0.944 ? ? 3.350 3.440 ? ? ? ? ? ? 454 99.800 ? ? ? ? 0.322 ? ? ? ? ? ? ? ? 6.200 ? 0.816 ? ? 0.352 0.140 ? 8 1 0.951 ? ? 3.440 3.540 ? ? ? ? ? ? 427 91.000 ? ? ? ? 0.248 ? ? ? ? ? ? ? ? 5.900 ? 0.868 ? ? 0.273 0.110 ? 9 1 0.952 ? ? 3.540 3.650 ? ? ? ? ? ? 473 98.300 ? ? ? ? 0.187 ? ? ? ? ? ? ? ? 6.700 ? 0.999 ? ? 0.203 0.078 ? 10 1 0.983 ? ? 3.650 3.780 ? ? ? ? ? ? 462 100.000 ? ? ? ? 0.192 ? ? ? ? ? ? ? ? 7.400 ? 1.175 ? ? 0.207 0.075 ? 11 1 0.986 ? ? 3.780 3.940 ? ? ? ? ? ? 460 100.000 ? ? ? ? 0.158 ? ? ? ? ? ? ? ? 7.400 ? 1.169 ? ? 0.170 0.062 ? 12 1 0.992 ? ? 3.940 4.110 ? ? ? ? ? ? 472 100.000 ? ? ? ? 0.120 ? ? ? ? ? ? ? ? 7.300 ? 1.305 ? ? 0.129 0.047 ? 13 1 0.992 ? ? 4.110 4.330 ? ? ? ? ? ? 481 100.000 ? ? ? ? 0.096 ? ? ? ? ? ? ? ? 7.100 ? 1.715 ? ? 0.104 0.039 ? 14 1 0.995 ? ? 4.330 4.600 ? ? ? ? ? ? 476 99.800 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 6.900 ? 2.093 ? ? 0.073 0.028 ? 15 1 0.997 ? ? 4.600 4.960 ? ? ? ? ? ? 478 100.000 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? 6.900 ? 1.722 ? ? 0.055 0.021 ? 16 1 0.998 ? ? 4.960 5.460 ? ? ? ? ? ? 484 100.000 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 6.800 ? 1.707 ? ? 0.053 0.020 ? 17 1 0.998 ? ? 5.460 6.240 ? ? ? ? ? ? 487 100.000 ? ? ? ? 0.053 ? ? ? ? ? ? ? ? 6.100 ? 1.926 ? ? 0.058 0.023 ? 18 1 0.997 ? ? 6.240 7.860 ? ? ? ? ? ? 466 92.600 ? ? ? ? 0.040 ? ? ? ? ? ? ? ? 5.900 ? 2.326 ? ? 0.044 0.017 ? 19 1 0.999 ? ? 7.860 50.000 ? ? ? ? ? ? 536 97.100 ? ? ? ? 0.039 ? ? ? ? ? ? ? ? 6.300 ? 2.525 ? ? 0.042 0.016 ? 20 1 0.998 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 317.630 _refine.B_iso_mean 152.0850 _refine.B_iso_min 63.530 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6UVB _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.0000 _refine.ls_d_res_low 39.7030 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8599 _refine.ls_number_reflns_R_free 410 _refine.ls_number_reflns_R_work 8189 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.8300 _refine.ls_percent_reflns_R_free 4.7700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2389 _refine.ls_R_factor_R_free 0.2897 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2365 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4GLQ _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.8200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 3.0000 _refine_hist.d_res_low 39.7030 _refine_hist.number_atoms_solvent 4 _refine_hist.number_atoms_total 1550 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 183 _refine_hist.pdbx_B_iso_mean_ligand 133.35 _refine_hist.pdbx_B_iso_mean_solvent 109.57 _refine_hist.pdbx_number_atoms_protein 1503 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 43 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 ? 1578 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.493 ? 2147 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.060 ? 238 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 271 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 23.529 ? 933 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.0001 3.1073 . . 40 806 100.0000 . . . 0.3381 0.0000 0.3705 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1073 3.2317 . . 39 792 100.0000 . . . 0.2978 0.0000 0.3059 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2317 3.3787 . . 49 812 100.0000 . . . 0.3470 0.0000 0.2829 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3787 3.5567 . . 31 769 95.0000 . . . 0.3371 0.0000 0.3391 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5567 3.7794 . . 45 809 99.0000 . . . 0.3250 0.0000 0.2842 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7794 4.0709 . . 36 822 100.0000 . . . 0.4563 0.0000 0.2941 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0709 4.4801 . . 42 820 100.0000 . . . 0.3481 0.0000 0.2423 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.4801 5.1272 . . 38 838 100.0000 . . . 0.2335 0.0000 0.1984 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.1272 6.4552 . . 49 849 100.0000 . . . 0.2390 0.0000 0.2385 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.4552 39.7030 . . 41 872 95.0000 . . . 0.2518 0.0000 0.1811 . . . . . . . . . . . # _struct.entry_id 6UVB _struct.title 'Crystal structure of far-red-light absorbing cyanobacteriochrome at 100K' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6UVB _struct_keywords.text 'Photoreceptor, bilin-binding protein, signaling protein, far-red light' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code K9ZI18_ANACC _struct_ref.pdbx_db_accession K9ZI18 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LQLQRQKIIQDITQQIRSTLNVNHILATVTQQVKELMQVERVIIFRLFPNGRSQIVEEVVSSEYAALKNYHWEDEKWSQE ILDCYWQGKPRIVPDVINDIWTSCLVEYTTQGNIQSKIVAPILQELGENETGRWVSSEHKQKLWGVLVVHACSTKRVWEE DEAQLLQQIANQLAIAIQQ ; _struct_ref.pdbx_align_begin 840 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6UVB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 180 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession K9ZI18 _struct_ref_seq.db_align_beg 840 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1018 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 840 _struct_ref_seq.pdbx_auth_seq_align_end 1018 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6UVB MET A 1 ? UNP K9ZI18 ? ? 'initiating methionine' 839 1 1 6UVB LEU A 181 ? UNP K9ZI18 ? ? 'expression tag' 1019 2 1 6UVB GLU A 182 ? UNP K9ZI18 ? ? 'expression tag' 1020 3 1 6UVB HIS A 183 ? UNP K9ZI18 ? ? 'expression tag' 1021 4 1 6UVB HIS A 184 ? UNP K9ZI18 ? ? 'expression tag' 1022 5 1 6UVB HIS A 185 ? UNP K9ZI18 ? ? 'expression tag' 1023 6 1 6UVB HIS A 186 ? UNP K9ZI18 ? ? 'expression tag' 1024 7 1 6UVB HIS A 187 ? UNP K9ZI18 ? ? 'expression tag' 1025 8 1 6UVB HIS A 188 ? UNP K9ZI18 ? ? 'expression tag' 1026 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5120 ? 1 MORE -54 ? 1 'SSA (A^2)' 18640 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z+1/2 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 34.3485000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 1 ? GLN A 5 ? MET A 839 GLN A 843 5 ? 5 HELX_P HELX_P2 AA2 ARG A 6 ? ASN A 22 ? ARG A 844 ASN A 860 1 ? 17 HELX_P HELX_P3 AA3 ASN A 22 ? GLN A 39 ? ASN A 860 GLN A 877 1 ? 18 HELX_P HELX_P4 AA4 SER A 79 ? GLN A 88 ? SER A 917 GLN A 926 1 ? 10 HELX_P HELX_P5 AA5 ASP A 96 ? ASP A 100 ? ASP A 934 ASP A 938 5 ? 5 HELX_P HELX_P6 AA6 LEU A 106 ? ASN A 114 ? LEU A 944 ASN A 952 1 ? 9 HELX_P HELX_P7 AA7 GLU A 160 ? LEU A 181 ? GLU A 998 LEU A 1019 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 105 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id CYC _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id CAC _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 943 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYC _struct_conn.ptnr2_auth_seq_id 1900 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.672 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYC _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 105 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYC _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 1900 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 943 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom CAC _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id CYC _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 HIS A 72 ? TRP A 73 ? HIS A 910 TRP A 911 AA1 2 SER A 54 ? VAL A 61 ? SER A 892 VAL A 899 AA1 3 ARG A 42 ? LEU A 48 ? ARG A 880 LEU A 886 AA1 4 GLN A 142 ? ALA A 152 ? GLN A 980 ALA A 990 AA1 5 SER A 117 ? GLN A 125 ? SER A 955 GLN A 963 AA1 6 ARG A 92 ? VAL A 94 ? ARG A 930 VAL A 932 AA2 1 HIS A 72 ? TRP A 73 ? HIS A 910 TRP A 911 AA2 2 SER A 54 ? VAL A 61 ? SER A 892 VAL A 899 AA2 3 ARG A 42 ? LEU A 48 ? ARG A 880 LEU A 886 AA2 4 GLN A 142 ? ALA A 152 ? GLN A 980 ALA A 990 AA2 5 VAL A 136 ? SER A 137 ? VAL A 974 SER A 975 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TRP A 73 ? O TRP A 911 N SER A 54 ? N SER A 892 AA1 2 3 O GLN A 55 ? O GLN A 893 N ARG A 47 ? N ARG A 885 AA1 3 4 N PHE A 46 ? N PHE A 884 O VAL A 147 ? O VAL A 985 AA1 4 5 O ALA A 152 ? O ALA A 990 N SER A 117 ? N SER A 955 AA1 5 6 O LYS A 118 ? O LYS A 956 N VAL A 94 ? N VAL A 932 AA2 1 2 O TRP A 73 ? O TRP A 911 N SER A 54 ? N SER A 892 AA2 2 3 O GLN A 55 ? O GLN A 893 N ARG A 47 ? N ARG A 885 AA2 3 4 N PHE A 46 ? N PHE A 884 O VAL A 147 ? O VAL A 985 AA2 4 5 O GLN A 142 ? O GLN A 980 N SER A 137 ? N SER A 975 # _pdbx_entry_details.entry_id 6UVB _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A GLU 919 ? ? CG A GLU 919 ? ? 1.631 1.517 0.114 0.019 N 2 1 CG A GLN 1003 ? ? CD A GLN 1003 ? ? 1.649 1.506 0.143 0.023 N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 GLN _pdbx_validate_rmsd_angle.auth_seq_id_1 1003 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 GLN _pdbx_validate_rmsd_angle.auth_seq_id_2 1003 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 GLN _pdbx_validate_rmsd_angle.auth_seq_id_3 1003 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 127.02 _pdbx_validate_rmsd_angle.angle_target_value 113.40 _pdbx_validate_rmsd_angle.angle_deviation 13.62 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.20 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 857 ? ? -57.63 -73.42 2 1 SER A 892 ? ? -171.44 134.73 3 1 ASN A 908 ? ? 68.96 -1.94 4 1 TRP A 911 ? ? 171.57 152.77 5 1 GLN A 926 ? ? -68.69 4.98 6 1 LEU A 944 ? ? -67.66 60.24 7 1 GLU A 964 ? ? -64.05 97.02 8 1 GLU A 967 ? ? 66.04 -134.09 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 VAL _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 899 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 SER _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 900 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 148.69 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 20.5860 _pdbx_refine_tls.origin_y 46.1580 _pdbx_refine_tls.origin_z 20.0684 _pdbx_refine_tls.T[1][1] 0.9487 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.5958 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.2503 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 1.5565 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.2045 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.6364 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 16.2429 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -6.2559 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 5.0248 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 6.1754 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 1.1519 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 5.4430 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -1.5483 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -2.3993 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -1.3054 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 1.4403 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 1.4488 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.5055 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.1988 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.1882 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0717 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 839 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 1900 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details 'chain A' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 1022 ? A HIS 184 2 1 Y 1 A HIS 1023 ? A HIS 185 3 1 Y 1 A HIS 1024 ? A HIS 186 4 1 Y 1 A HIS 1025 ? A HIS 187 5 1 Y 1 A HIS 1026 ? A HIS 188 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYC CHA C N N 74 CYC NA N N N 75 CYC C1A C N N 76 CYC C2A C N N 77 CYC C3A C N N 78 CYC C4A C N N 79 CYC CMA C N N 80 CYC CAA C N N 81 CYC CBA C N N 82 CYC CGA C N N 83 CYC O1A O N N 84 CYC O2A O N N 85 CYC CHB C N N 86 CYC NB N N N 87 CYC C1B C N N 88 CYC C2B C N N 89 CYC C3B C N N 90 CYC C4B C N N 91 CYC CMB C N N 92 CYC CAB C N N 93 CYC CBB C N N 94 CYC OB O N N 95 CYC NC N N N 96 CYC C1C C N N 97 CYC C2C C N R 98 CYC C3C C N R 99 CYC C4C C N N 100 CYC CMC C N N 101 CYC CAC C N N 102 CYC CBC C N N 103 CYC OC O N N 104 CYC CHD C N N 105 CYC ND N Y N 106 CYC C1D C Y N 107 CYC C2D C Y N 108 CYC C3D C Y N 109 CYC C4D C Y N 110 CYC CMD C N N 111 CYC CAD C N N 112 CYC CBD C N N 113 CYC CGD C N N 114 CYC O1D O N N 115 CYC O2D O N N 116 CYC HHA H N N 117 CYC HMA1 H N N 118 CYC HMA2 H N N 119 CYC HMA3 H N N 120 CYC HAA1 H N N 121 CYC HAA2 H N N 122 CYC HBA1 H N N 123 CYC HBA2 H N N 124 CYC H2A H N N 125 CYC HHB H N N 126 CYC HB H N N 127 CYC HMB1 H N N 128 CYC HMB2 H N N 129 CYC HMB3 H N N 130 CYC HAB1 H N N 131 CYC HAB2 H N N 132 CYC HBB1 H N N 133 CYC HBB2 H N N 134 CYC HBB3 H N N 135 CYC HC H N N 136 CYC H2C H N N 137 CYC H3C H N N 138 CYC HMC1 H N N 139 CYC HMC2 H N N 140 CYC HMC3 H N N 141 CYC HAC1 H N N 142 CYC HAC2 H N N 143 CYC HBC1 H N N 144 CYC HBC2 H N N 145 CYC HBC3 H N N 146 CYC HHD H N N 147 CYC HD H N N 148 CYC HMD1 H N N 149 CYC HMD2 H N N 150 CYC HMD3 H N N 151 CYC HAD1 H N N 152 CYC HAD2 H N N 153 CYC HBD1 H N N 154 CYC HBD2 H N N 155 CYC H2D H N N 156 CYS N N N N 157 CYS CA C N R 158 CYS C C N N 159 CYS O O N N 160 CYS CB C N N 161 CYS SG S N N 162 CYS OXT O N N 163 CYS H H N N 164 CYS H2 H N N 165 CYS HA H N N 166 CYS HB2 H N N 167 CYS HB3 H N N 168 CYS HG H N N 169 CYS HXT H N N 170 GLN N N N N 171 GLN CA C N S 172 GLN C C N N 173 GLN O O N N 174 GLN CB C N N 175 GLN CG C N N 176 GLN CD C N N 177 GLN OE1 O N N 178 GLN NE2 N N N 179 GLN OXT O N N 180 GLN H H N N 181 GLN H2 H N N 182 GLN HA H N N 183 GLN HB2 H N N 184 GLN HB3 H N N 185 GLN HG2 H N N 186 GLN HG3 H N N 187 GLN HE21 H N N 188 GLN HE22 H N N 189 GLN HXT H N N 190 GLU N N N N 191 GLU CA C N S 192 GLU C C N N 193 GLU O O N N 194 GLU CB C N N 195 GLU CG C N N 196 GLU CD C N N 197 GLU OE1 O N N 198 GLU OE2 O N N 199 GLU OXT O N N 200 GLU H H N N 201 GLU H2 H N N 202 GLU HA H N N 203 GLU HB2 H N N 204 GLU HB3 H N N 205 GLU HG2 H N N 206 GLU HG3 H N N 207 GLU HE2 H N N 208 GLU HXT H N N 209 GLY N N N N 210 GLY CA C N N 211 GLY C C N N 212 GLY O O N N 213 GLY OXT O N N 214 GLY H H N N 215 GLY H2 H N N 216 GLY HA2 H N N 217 GLY HA3 H N N 218 GLY HXT H N N 219 HIS N N N N 220 HIS CA C N S 221 HIS C C N N 222 HIS O O N N 223 HIS CB C N N 224 HIS CG C Y N 225 HIS ND1 N Y N 226 HIS CD2 C Y N 227 HIS CE1 C Y N 228 HIS NE2 N Y N 229 HIS OXT O N N 230 HIS H H N N 231 HIS H2 H N N 232 HIS HA H N N 233 HIS HB2 H N N 234 HIS HB3 H N N 235 HIS HD1 H N N 236 HIS HD2 H N N 237 HIS HE1 H N N 238 HIS HE2 H N N 239 HIS HXT H N N 240 HOH O O N N 241 HOH H1 H N N 242 HOH H2 H N N 243 ILE N N N N 244 ILE CA C N S 245 ILE C C N N 246 ILE O O N N 247 ILE CB C N S 248 ILE CG1 C N N 249 ILE CG2 C N N 250 ILE CD1 C N N 251 ILE OXT O N N 252 ILE H H N N 253 ILE H2 H N N 254 ILE HA H N N 255 ILE HB H N N 256 ILE HG12 H N N 257 ILE HG13 H N N 258 ILE HG21 H N N 259 ILE HG22 H N N 260 ILE HG23 H N N 261 ILE HD11 H N N 262 ILE HD12 H N N 263 ILE HD13 H N N 264 ILE HXT H N N 265 LEU N N N N 266 LEU CA C N S 267 LEU C C N N 268 LEU O O N N 269 LEU CB C N N 270 LEU CG C N N 271 LEU CD1 C N N 272 LEU CD2 C N N 273 LEU OXT O N N 274 LEU H H N N 275 LEU H2 H N N 276 LEU HA H N N 277 LEU HB2 H N N 278 LEU HB3 H N N 279 LEU HG H N N 280 LEU HD11 H N N 281 LEU HD12 H N N 282 LEU HD13 H N N 283 LEU HD21 H N N 284 LEU HD22 H N N 285 LEU HD23 H N N 286 LEU HXT H N N 287 LYS N N N N 288 LYS CA C N S 289 LYS C C N N 290 LYS O O N N 291 LYS CB C N N 292 LYS CG C N N 293 LYS CD C N N 294 LYS CE C N N 295 LYS NZ N N N 296 LYS OXT O N N 297 LYS H H N N 298 LYS H2 H N N 299 LYS HA H N N 300 LYS HB2 H N N 301 LYS HB3 H N N 302 LYS HG2 H N N 303 LYS HG3 H N N 304 LYS HD2 H N N 305 LYS HD3 H N N 306 LYS HE2 H N N 307 LYS HE3 H N N 308 LYS HZ1 H N N 309 LYS HZ2 H N N 310 LYS HZ3 H N N 311 LYS HXT H N N 312 MET N N N N 313 MET CA C N S 314 MET C C N N 315 MET O O N N 316 MET CB C N N 317 MET CG C N N 318 MET SD S N N 319 MET CE C N N 320 MET OXT O N N 321 MET H H N N 322 MET H2 H N N 323 MET HA H N N 324 MET HB2 H N N 325 MET HB3 H N N 326 MET HG2 H N N 327 MET HG3 H N N 328 MET HE1 H N N 329 MET HE2 H N N 330 MET HE3 H N N 331 MET HXT H N N 332 PHE N N N N 333 PHE CA C N S 334 PHE C C N N 335 PHE O O N N 336 PHE CB C N N 337 PHE CG C Y N 338 PHE CD1 C Y N 339 PHE CD2 C Y N 340 PHE CE1 C Y N 341 PHE CE2 C Y N 342 PHE CZ C Y N 343 PHE OXT O N N 344 PHE H H N N 345 PHE H2 H N N 346 PHE HA H N N 347 PHE HB2 H N N 348 PHE HB3 H N N 349 PHE HD1 H N N 350 PHE HD2 H N N 351 PHE HE1 H N N 352 PHE HE2 H N N 353 PHE HZ H N N 354 PHE HXT H N N 355 PRO N N N N 356 PRO CA C N S 357 PRO C C N N 358 PRO O O N N 359 PRO CB C N N 360 PRO CG C N N 361 PRO CD C N N 362 PRO OXT O N N 363 PRO H H N N 364 PRO HA H N N 365 PRO HB2 H N N 366 PRO HB3 H N N 367 PRO HG2 H N N 368 PRO HG3 H N N 369 PRO HD2 H N N 370 PRO HD3 H N N 371 PRO HXT H N N 372 SER N N N N 373 SER CA C N S 374 SER C C N N 375 SER O O N N 376 SER CB C N N 377 SER OG O N N 378 SER OXT O N N 379 SER H H N N 380 SER H2 H N N 381 SER HA H N N 382 SER HB2 H N N 383 SER HB3 H N N 384 SER HG H N N 385 SER HXT H N N 386 THR N N N N 387 THR CA C N S 388 THR C C N N 389 THR O O N N 390 THR CB C N R 391 THR OG1 O N N 392 THR CG2 C N N 393 THR OXT O N N 394 THR H H N N 395 THR H2 H N N 396 THR HA H N N 397 THR HB H N N 398 THR HG1 H N N 399 THR HG21 H N N 400 THR HG22 H N N 401 THR HG23 H N N 402 THR HXT H N N 403 TRP N N N N 404 TRP CA C N S 405 TRP C C N N 406 TRP O O N N 407 TRP CB C N N 408 TRP CG C Y N 409 TRP CD1 C Y N 410 TRP CD2 C Y N 411 TRP NE1 N Y N 412 TRP CE2 C Y N 413 TRP CE3 C Y N 414 TRP CZ2 C Y N 415 TRP CZ3 C Y N 416 TRP CH2 C Y N 417 TRP OXT O N N 418 TRP H H N N 419 TRP H2 H N N 420 TRP HA H N N 421 TRP HB2 H N N 422 TRP HB3 H N N 423 TRP HD1 H N N 424 TRP HE1 H N N 425 TRP HE3 H N N 426 TRP HZ2 H N N 427 TRP HZ3 H N N 428 TRP HH2 H N N 429 TRP HXT H N N 430 TYR N N N N 431 TYR CA C N S 432 TYR C C N N 433 TYR O O N N 434 TYR CB C N N 435 TYR CG C Y N 436 TYR CD1 C Y N 437 TYR CD2 C Y N 438 TYR CE1 C Y N 439 TYR CE2 C Y N 440 TYR CZ C Y N 441 TYR OH O N N 442 TYR OXT O N N 443 TYR H H N N 444 TYR H2 H N N 445 TYR HA H N N 446 TYR HB2 H N N 447 TYR HB3 H N N 448 TYR HD1 H N N 449 TYR HD2 H N N 450 TYR HE1 H N N 451 TYR HE2 H N N 452 TYR HH H N N 453 TYR HXT H N N 454 VAL N N N N 455 VAL CA C N S 456 VAL C C N N 457 VAL O O N N 458 VAL CB C N N 459 VAL CG1 C N N 460 VAL CG2 C N N 461 VAL OXT O N N 462 VAL H H N N 463 VAL H2 H N N 464 VAL HA H N N 465 VAL HB H N N 466 VAL HG11 H N N 467 VAL HG12 H N N 468 VAL HG13 H N N 469 VAL HG21 H N N 470 VAL HG22 H N N 471 VAL HG23 H N N 472 VAL HXT H N N 473 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYC CHA C1A doub N Z 70 CYC CHA C4D sing N N 71 CYC CHA HHA sing N N 72 CYC NA C1A sing N N 73 CYC NA C4A doub N N 74 CYC C1A C2A sing N N 75 CYC C2A C3A doub N N 76 CYC C2A CAA sing N N 77 CYC C3A C4A sing N N 78 CYC C3A CMA sing N N 79 CYC C4A CHB sing N N 80 CYC CMA HMA1 sing N N 81 CYC CMA HMA2 sing N N 82 CYC CMA HMA3 sing N N 83 CYC CAA CBA sing N N 84 CYC CAA HAA1 sing N N 85 CYC CAA HAA2 sing N N 86 CYC CBA CGA sing N N 87 CYC CBA HBA1 sing N N 88 CYC CBA HBA2 sing N N 89 CYC CGA O1A doub N N 90 CYC CGA O2A sing N N 91 CYC O2A H2A sing N N 92 CYC CHB C1B doub N Z 93 CYC CHB HHB sing N N 94 CYC NB C1B sing N N 95 CYC NB C4B sing N N 96 CYC NB HB sing N N 97 CYC C1B C2B sing N N 98 CYC C2B C3B doub N N 99 CYC C2B CMB sing N N 100 CYC C3B C4B sing N N 101 CYC C3B CAB sing N N 102 CYC C4B OB doub N N 103 CYC CMB HMB1 sing N N 104 CYC CMB HMB2 sing N N 105 CYC CMB HMB3 sing N N 106 CYC CAB CBB sing N N 107 CYC CAB HAB1 sing N N 108 CYC CAB HAB2 sing N N 109 CYC CBB HBB1 sing N N 110 CYC CBB HBB2 sing N N 111 CYC CBB HBB3 sing N N 112 CYC NC C1C sing N N 113 CYC NC C4C sing N N 114 CYC NC HC sing N N 115 CYC C1C C2C sing N N 116 CYC C1C OC doub N N 117 CYC C2C C3C sing N N 118 CYC C2C CMC sing N N 119 CYC C2C H2C sing N N 120 CYC C3C C4C sing N N 121 CYC C3C CAC sing N N 122 CYC C3C H3C sing N N 123 CYC C4C CHD doub N Z 124 CYC CMC HMC1 sing N N 125 CYC CMC HMC2 sing N N 126 CYC CMC HMC3 sing N N 127 CYC CAC CBC sing N N 128 CYC CAC HAC1 sing N N 129 CYC CAC HAC2 sing N N 130 CYC CBC HBC1 sing N N 131 CYC CBC HBC2 sing N N 132 CYC CBC HBC3 sing N N 133 CYC CHD C1D sing N N 134 CYC CHD HHD sing N N 135 CYC ND C1D sing Y N 136 CYC ND C4D sing Y N 137 CYC ND HD sing N N 138 CYC C1D C2D doub Y N 139 CYC C2D C3D sing Y N 140 CYC C2D CMD sing N N 141 CYC C3D C4D doub Y N 142 CYC C3D CAD sing N N 143 CYC CMD HMD1 sing N N 144 CYC CMD HMD2 sing N N 145 CYC CMD HMD3 sing N N 146 CYC CAD CBD sing N N 147 CYC CAD HAD1 sing N N 148 CYC CAD HAD2 sing N N 149 CYC CBD CGD sing N N 150 CYC CBD HBD1 sing N N 151 CYC CBD HBD2 sing N N 152 CYC CGD O1D doub N N 153 CYC CGD O2D sing N N 154 CYC O2D H2D sing N N 155 CYS N CA sing N N 156 CYS N H sing N N 157 CYS N H2 sing N N 158 CYS CA C sing N N 159 CYS CA CB sing N N 160 CYS CA HA sing N N 161 CYS C O doub N N 162 CYS C OXT sing N N 163 CYS CB SG sing N N 164 CYS CB HB2 sing N N 165 CYS CB HB3 sing N N 166 CYS SG HG sing N N 167 CYS OXT HXT sing N N 168 GLN N CA sing N N 169 GLN N H sing N N 170 GLN N H2 sing N N 171 GLN CA C sing N N 172 GLN CA CB sing N N 173 GLN CA HA sing N N 174 GLN C O doub N N 175 GLN C OXT sing N N 176 GLN CB CG sing N N 177 GLN CB HB2 sing N N 178 GLN CB HB3 sing N N 179 GLN CG CD sing N N 180 GLN CG HG2 sing N N 181 GLN CG HG3 sing N N 182 GLN CD OE1 doub N N 183 GLN CD NE2 sing N N 184 GLN NE2 HE21 sing N N 185 GLN NE2 HE22 sing N N 186 GLN OXT HXT sing N N 187 GLU N CA sing N N 188 GLU N H sing N N 189 GLU N H2 sing N N 190 GLU CA C sing N N 191 GLU CA CB sing N N 192 GLU CA HA sing N N 193 GLU C O doub N N 194 GLU C OXT sing N N 195 GLU CB CG sing N N 196 GLU CB HB2 sing N N 197 GLU CB HB3 sing N N 198 GLU CG CD sing N N 199 GLU CG HG2 sing N N 200 GLU CG HG3 sing N N 201 GLU CD OE1 doub N N 202 GLU CD OE2 sing N N 203 GLU OE2 HE2 sing N N 204 GLU OXT HXT sing N N 205 GLY N CA sing N N 206 GLY N H sing N N 207 GLY N H2 sing N N 208 GLY CA C sing N N 209 GLY CA HA2 sing N N 210 GLY CA HA3 sing N N 211 GLY C O doub N N 212 GLY C OXT sing N N 213 GLY OXT HXT sing N N 214 HIS N CA sing N N 215 HIS N H sing N N 216 HIS N H2 sing N N 217 HIS CA C sing N N 218 HIS CA CB sing N N 219 HIS CA HA sing N N 220 HIS C O doub N N 221 HIS C OXT sing N N 222 HIS CB CG sing N N 223 HIS CB HB2 sing N N 224 HIS CB HB3 sing N N 225 HIS CG ND1 sing Y N 226 HIS CG CD2 doub Y N 227 HIS ND1 CE1 doub Y N 228 HIS ND1 HD1 sing N N 229 HIS CD2 NE2 sing Y N 230 HIS CD2 HD2 sing N N 231 HIS CE1 NE2 sing Y N 232 HIS CE1 HE1 sing N N 233 HIS NE2 HE2 sing N N 234 HIS OXT HXT sing N N 235 HOH O H1 sing N N 236 HOH O H2 sing N N 237 ILE N CA sing N N 238 ILE N H sing N N 239 ILE N H2 sing N N 240 ILE CA C sing N N 241 ILE CA CB sing N N 242 ILE CA HA sing N N 243 ILE C O doub N N 244 ILE C OXT sing N N 245 ILE CB CG1 sing N N 246 ILE CB CG2 sing N N 247 ILE CB HB sing N N 248 ILE CG1 CD1 sing N N 249 ILE CG1 HG12 sing N N 250 ILE CG1 HG13 sing N N 251 ILE CG2 HG21 sing N N 252 ILE CG2 HG22 sing N N 253 ILE CG2 HG23 sing N N 254 ILE CD1 HD11 sing N N 255 ILE CD1 HD12 sing N N 256 ILE CD1 HD13 sing N N 257 ILE OXT HXT sing N N 258 LEU N CA sing N N 259 LEU N H sing N N 260 LEU N H2 sing N N 261 LEU CA C sing N N 262 LEU CA CB sing N N 263 LEU CA HA sing N N 264 LEU C O doub N N 265 LEU C OXT sing N N 266 LEU CB CG sing N N 267 LEU CB HB2 sing N N 268 LEU CB HB3 sing N N 269 LEU CG CD1 sing N N 270 LEU CG CD2 sing N N 271 LEU CG HG sing N N 272 LEU CD1 HD11 sing N N 273 LEU CD1 HD12 sing N N 274 LEU CD1 HD13 sing N N 275 LEU CD2 HD21 sing N N 276 LEU CD2 HD22 sing N N 277 LEU CD2 HD23 sing N N 278 LEU OXT HXT sing N N 279 LYS N CA sing N N 280 LYS N H sing N N 281 LYS N H2 sing N N 282 LYS CA C sing N N 283 LYS CA CB sing N N 284 LYS CA HA sing N N 285 LYS C O doub N N 286 LYS C OXT sing N N 287 LYS CB CG sing N N 288 LYS CB HB2 sing N N 289 LYS CB HB3 sing N N 290 LYS CG CD sing N N 291 LYS CG HG2 sing N N 292 LYS CG HG3 sing N N 293 LYS CD CE sing N N 294 LYS CD HD2 sing N N 295 LYS CD HD3 sing N N 296 LYS CE NZ sing N N 297 LYS CE HE2 sing N N 298 LYS CE HE3 sing N N 299 LYS NZ HZ1 sing N N 300 LYS NZ HZ2 sing N N 301 LYS NZ HZ3 sing N N 302 LYS OXT HXT sing N N 303 MET N CA sing N N 304 MET N H sing N N 305 MET N H2 sing N N 306 MET CA C sing N N 307 MET CA CB sing N N 308 MET CA HA sing N N 309 MET C O doub N N 310 MET C OXT sing N N 311 MET CB CG sing N N 312 MET CB HB2 sing N N 313 MET CB HB3 sing N N 314 MET CG SD sing N N 315 MET CG HG2 sing N N 316 MET CG HG3 sing N N 317 MET SD CE sing N N 318 MET CE HE1 sing N N 319 MET CE HE2 sing N N 320 MET CE HE3 sing N N 321 MET OXT HXT sing N N 322 PHE N CA sing N N 323 PHE N H sing N N 324 PHE N H2 sing N N 325 PHE CA C sing N N 326 PHE CA CB sing N N 327 PHE CA HA sing N N 328 PHE C O doub N N 329 PHE C OXT sing N N 330 PHE CB CG sing N N 331 PHE CB HB2 sing N N 332 PHE CB HB3 sing N N 333 PHE CG CD1 doub Y N 334 PHE CG CD2 sing Y N 335 PHE CD1 CE1 sing Y N 336 PHE CD1 HD1 sing N N 337 PHE CD2 CE2 doub Y N 338 PHE CD2 HD2 sing N N 339 PHE CE1 CZ doub Y N 340 PHE CE1 HE1 sing N N 341 PHE CE2 CZ sing Y N 342 PHE CE2 HE2 sing N N 343 PHE CZ HZ sing N N 344 PHE OXT HXT sing N N 345 PRO N CA sing N N 346 PRO N CD sing N N 347 PRO N H sing N N 348 PRO CA C sing N N 349 PRO CA CB sing N N 350 PRO CA HA sing N N 351 PRO C O doub N N 352 PRO C OXT sing N N 353 PRO CB CG sing N N 354 PRO CB HB2 sing N N 355 PRO CB HB3 sing N N 356 PRO CG CD sing N N 357 PRO CG HG2 sing N N 358 PRO CG HG3 sing N N 359 PRO CD HD2 sing N N 360 PRO CD HD3 sing N N 361 PRO OXT HXT sing N N 362 SER N CA sing N N 363 SER N H sing N N 364 SER N H2 sing N N 365 SER CA C sing N N 366 SER CA CB sing N N 367 SER CA HA sing N N 368 SER C O doub N N 369 SER C OXT sing N N 370 SER CB OG sing N N 371 SER CB HB2 sing N N 372 SER CB HB3 sing N N 373 SER OG HG sing N N 374 SER OXT HXT sing N N 375 THR N CA sing N N 376 THR N H sing N N 377 THR N H2 sing N N 378 THR CA C sing N N 379 THR CA CB sing N N 380 THR CA HA sing N N 381 THR C O doub N N 382 THR C OXT sing N N 383 THR CB OG1 sing N N 384 THR CB CG2 sing N N 385 THR CB HB sing N N 386 THR OG1 HG1 sing N N 387 THR CG2 HG21 sing N N 388 THR CG2 HG22 sing N N 389 THR CG2 HG23 sing N N 390 THR OXT HXT sing N N 391 TRP N CA sing N N 392 TRP N H sing N N 393 TRP N H2 sing N N 394 TRP CA C sing N N 395 TRP CA CB sing N N 396 TRP CA HA sing N N 397 TRP C O doub N N 398 TRP C OXT sing N N 399 TRP CB CG sing N N 400 TRP CB HB2 sing N N 401 TRP CB HB3 sing N N 402 TRP CG CD1 doub Y N 403 TRP CG CD2 sing Y N 404 TRP CD1 NE1 sing Y N 405 TRP CD1 HD1 sing N N 406 TRP CD2 CE2 doub Y N 407 TRP CD2 CE3 sing Y N 408 TRP NE1 CE2 sing Y N 409 TRP NE1 HE1 sing N N 410 TRP CE2 CZ2 sing Y N 411 TRP CE3 CZ3 doub Y N 412 TRP CE3 HE3 sing N N 413 TRP CZ2 CH2 doub Y N 414 TRP CZ2 HZ2 sing N N 415 TRP CZ3 CH2 sing Y N 416 TRP CZ3 HZ3 sing N N 417 TRP CH2 HH2 sing N N 418 TRP OXT HXT sing N N 419 TYR N CA sing N N 420 TYR N H sing N N 421 TYR N H2 sing N N 422 TYR CA C sing N N 423 TYR CA CB sing N N 424 TYR CA HA sing N N 425 TYR C O doub N N 426 TYR C OXT sing N N 427 TYR CB CG sing N N 428 TYR CB HB2 sing N N 429 TYR CB HB3 sing N N 430 TYR CG CD1 doub Y N 431 TYR CG CD2 sing Y N 432 TYR CD1 CE1 sing Y N 433 TYR CD1 HD1 sing N N 434 TYR CD2 CE2 doub Y N 435 TYR CD2 HD2 sing N N 436 TYR CE1 CZ doub Y N 437 TYR CE1 HE1 sing N N 438 TYR CE2 CZ sing Y N 439 TYR CE2 HE2 sing N N 440 TYR CZ OH sing N N 441 TYR OH HH sing N N 442 TYR OXT HXT sing N N 443 VAL N CA sing N N 444 VAL N H sing N N 445 VAL N H2 sing N N 446 VAL CA C sing N N 447 VAL CA CB sing N N 448 VAL CA HA sing N N 449 VAL C O doub N N 450 VAL C OXT sing N N 451 VAL CB CG1 sing N N 452 VAL CB CG2 sing N N 453 VAL CB HB sing N N 454 VAL CG1 HG11 sing N N 455 VAL CG1 HG12 sing N N 456 VAL CG1 HG13 sing N N 457 VAL CG2 HG21 sing N N 458 VAL CG2 HG22 sing N N 459 VAL CG2 HG23 sing N N 460 VAL OXT HXT sing N N 461 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Eye Institute (NIH/NEI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'R01 EY024363' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4GLQ _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6UVB _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009192 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009192 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014557 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S Y # loop_ # loop_ #