data_6UVW # _entry.id 6UVW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6UVW pdb_00006uvw 10.2210/pdb6uvw/pdb WWPDB D_1000245259 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6UVW _pdbx_database_status.recvd_initial_deposition_date 2019-11-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Werther, R.' 1 0000-0002-3058-1550 'Stoddard, B.L.' 2 0000-0003-2250-9601 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 0969-2126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 28 _citation.language ? _citation.page_first 760 _citation.page_last 775.e8 _citation.title 'Optimization of Protein Thermostability and Exploitation of Recognition Behavior to Engineer Altered Protein-DNA Recognition.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2020.04.009 _citation.pdbx_database_id_PubMed 32359399 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lambert, A.R.' 1 ? primary 'Hallinan, J.P.' 2 ? primary 'Werther, R.' 3 ? primary 'Glow, D.' 4 ? primary 'Stoddard, B.L.' 5 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6UVW _cell.details ? _cell.formula_units_Z ? _cell.length_a 75.426 _cell.length_a_esd ? _cell.length_b 82.259 _cell.length_b_esd ? _cell.length_c 167.398 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6UVW _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man I-OnuI-e-Therm 34904.559 2 ? ? ? ? 2 polymer syn 'DNA (27-MER)' 8248.316 2 ? ? ? ? 3 polymer syn 'DNA (27-MER)' 8342.427 2 ? ? ? ? 4 non-polymer syn 'CALCIUM ION' 40.078 5 ? ? ? ? 5 water nat water 18.015 23 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MASSRRESINPWILTGFADAEGSFLLRIRKNNKSSVGYSTELGFQITLHNKDKSILENIQSTWGVGVIANSGDNAVSLKV TRFEDLKVIIDHFEKYPLITQKYADYMLFKQAFNVMENKEHLTIEGIKELVRIKAKLNWGLTDELKKAFPEIISKERSLI NKNIPNFKWLAGFTSGEGCFFVNLIKSKSKLGVQVQLVFSITQHIRDKNLMNSLITYLGCGYIKKKNKSEFSWLDFVVTK FSDIRDKIIPFFQEYTLIGTKLKDFEDWCKVAKLIEEKKHLTEEGLDEIKKIKLNMNKGRVF ; ;MASSRRESINPWILTGFADAEGSFLLRIRKNNKSSVGYSTELGFQITLHNKDKSILENIQSTWGVGVIANSGDNAVSLKV TRFEDLKVIIDHFEKYPLITQKYADYMLFKQAFNVMENKEHLTIEGIKELVRIKAKLNWGLTDELKKAFPEIISKERSLI NKNIPNFKWLAGFTSGEGCFFVNLIKSKSKLGVQVQLVFSITQHIRDKNLMNSLITYLGCGYIKKKNKSEFSWLDFVVTK FSDIRDKIIPFFQEYTLIGTKLKDFEDWCKVAKLIEEKKHLTEEGLDEIKKIKLNMNKGRVF ; A,D ? 2 polydeoxyribonucleotide no no ;(DG)(DG)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DC)(DT)(DT)(DA)(DT)(DT)(DC)(DA)(DA)(DC)(DC) (DT)(DT)(DT)(DT)(DA)(DG)(DG) ; GGGTTTCCACTTATTCAACCTTTTAGG B,E ? 3 polydeoxyribonucleotide no no ;(DC)(DC)(DC)(DT)(DA)(DA)(DA)(DA)(DG)(DG)(DT)(DT)(DG)(DA)(DA)(DT)(DA)(DA)(DG)(DT) (DG)(DG)(DA)(DA)(DA)(DC)(DC) ; CCCTAAAAGGTTGAATAAGTGGAAACC C,F ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 SER n 1 5 ARG n 1 6 ARG n 1 7 GLU n 1 8 SER n 1 9 ILE n 1 10 ASN n 1 11 PRO n 1 12 TRP n 1 13 ILE n 1 14 LEU n 1 15 THR n 1 16 GLY n 1 17 PHE n 1 18 ALA n 1 19 ASP n 1 20 ALA n 1 21 GLU n 1 22 GLY n 1 23 SER n 1 24 PHE n 1 25 LEU n 1 26 LEU n 1 27 ARG n 1 28 ILE n 1 29 ARG n 1 30 LYS n 1 31 ASN n 1 32 ASN n 1 33 LYS n 1 34 SER n 1 35 SER n 1 36 VAL n 1 37 GLY n 1 38 TYR n 1 39 SER n 1 40 THR n 1 41 GLU n 1 42 LEU n 1 43 GLY n 1 44 PHE n 1 45 GLN n 1 46 ILE n 1 47 THR n 1 48 LEU n 1 49 HIS n 1 50 ASN n 1 51 LYS n 1 52 ASP n 1 53 LYS n 1 54 SER n 1 55 ILE n 1 56 LEU n 1 57 GLU n 1 58 ASN n 1 59 ILE n 1 60 GLN n 1 61 SER n 1 62 THR n 1 63 TRP n 1 64 GLY n 1 65 VAL n 1 66 GLY n 1 67 VAL n 1 68 ILE n 1 69 ALA n 1 70 ASN n 1 71 SER n 1 72 GLY n 1 73 ASP n 1 74 ASN n 1 75 ALA n 1 76 VAL n 1 77 SER n 1 78 LEU n 1 79 LYS n 1 80 VAL n 1 81 THR n 1 82 ARG n 1 83 PHE n 1 84 GLU n 1 85 ASP n 1 86 LEU n 1 87 LYS n 1 88 VAL n 1 89 ILE n 1 90 ILE n 1 91 ASP n 1 92 HIS n 1 93 PHE n 1 94 GLU n 1 95 LYS n 1 96 TYR n 1 97 PRO n 1 98 LEU n 1 99 ILE n 1 100 THR n 1 101 GLN n 1 102 LYS n 1 103 TYR n 1 104 ALA n 1 105 ASP n 1 106 TYR n 1 107 MET n 1 108 LEU n 1 109 PHE n 1 110 LYS n 1 111 GLN n 1 112 ALA n 1 113 PHE n 1 114 ASN n 1 115 VAL n 1 116 MET n 1 117 GLU n 1 118 ASN n 1 119 LYS n 1 120 GLU n 1 121 HIS n 1 122 LEU n 1 123 THR n 1 124 ILE n 1 125 GLU n 1 126 GLY n 1 127 ILE n 1 128 LYS n 1 129 GLU n 1 130 LEU n 1 131 VAL n 1 132 ARG n 1 133 ILE n 1 134 LYS n 1 135 ALA n 1 136 LYS n 1 137 LEU n 1 138 ASN n 1 139 TRP n 1 140 GLY n 1 141 LEU n 1 142 THR n 1 143 ASP n 1 144 GLU n 1 145 LEU n 1 146 LYS n 1 147 LYS n 1 148 ALA n 1 149 PHE n 1 150 PRO n 1 151 GLU n 1 152 ILE n 1 153 ILE n 1 154 SER n 1 155 LYS n 1 156 GLU n 1 157 ARG n 1 158 SER n 1 159 LEU n 1 160 ILE n 1 161 ASN n 1 162 LYS n 1 163 ASN n 1 164 ILE n 1 165 PRO n 1 166 ASN n 1 167 PHE n 1 168 LYS n 1 169 TRP n 1 170 LEU n 1 171 ALA n 1 172 GLY n 1 173 PHE n 1 174 THR n 1 175 SER n 1 176 GLY n 1 177 GLU n 1 178 GLY n 1 179 CYS n 1 180 PHE n 1 181 PHE n 1 182 VAL n 1 183 ASN n 1 184 LEU n 1 185 ILE n 1 186 LYS n 1 187 SER n 1 188 LYS n 1 189 SER n 1 190 LYS n 1 191 LEU n 1 192 GLY n 1 193 VAL n 1 194 GLN n 1 195 VAL n 1 196 GLN n 1 197 LEU n 1 198 VAL n 1 199 PHE n 1 200 SER n 1 201 ILE n 1 202 THR n 1 203 GLN n 1 204 HIS n 1 205 ILE n 1 206 ARG n 1 207 ASP n 1 208 LYS n 1 209 ASN n 1 210 LEU n 1 211 MET n 1 212 ASN n 1 213 SER n 1 214 LEU n 1 215 ILE n 1 216 THR n 1 217 TYR n 1 218 LEU n 1 219 GLY n 1 220 CYS n 1 221 GLY n 1 222 TYR n 1 223 ILE n 1 224 LYS n 1 225 LYS n 1 226 LYS n 1 227 ASN n 1 228 LYS n 1 229 SER n 1 230 GLU n 1 231 PHE n 1 232 SER n 1 233 TRP n 1 234 LEU n 1 235 ASP n 1 236 PHE n 1 237 VAL n 1 238 VAL n 1 239 THR n 1 240 LYS n 1 241 PHE n 1 242 SER n 1 243 ASP n 1 244 ILE n 1 245 ARG n 1 246 ASP n 1 247 LYS n 1 248 ILE n 1 249 ILE n 1 250 PRO n 1 251 PHE n 1 252 PHE n 1 253 GLN n 1 254 GLU n 1 255 TYR n 1 256 THR n 1 257 LEU n 1 258 ILE n 1 259 GLY n 1 260 THR n 1 261 LYS n 1 262 LEU n 1 263 LYS n 1 264 ASP n 1 265 PHE n 1 266 GLU n 1 267 ASP n 1 268 TRP n 1 269 CYS n 1 270 LYS n 1 271 VAL n 1 272 ALA n 1 273 LYS n 1 274 LEU n 1 275 ILE n 1 276 GLU n 1 277 GLU n 1 278 LYS n 1 279 LYS n 1 280 HIS n 1 281 LEU n 1 282 THR n 1 283 GLU n 1 284 GLU n 1 285 GLY n 1 286 LEU n 1 287 ASP n 1 288 GLU n 1 289 ILE n 1 290 LYS n 1 291 LYS n 1 292 ILE n 1 293 LYS n 1 294 LEU n 1 295 ASN n 1 296 MET n 1 297 ASN n 1 298 LYS n 1 299 GLY n 1 300 ARG n 1 301 VAL n 1 302 PHE n 2 1 DG n 2 2 DG n 2 3 DG n 2 4 DT n 2 5 DT n 2 6 DT n 2 7 DC n 2 8 DC n 2 9 DA n 2 10 DC n 2 11 DT n 2 12 DT n 2 13 DA n 2 14 DT n 2 15 DT n 2 16 DC n 2 17 DA n 2 18 DA n 2 19 DC n 2 20 DC n 2 21 DT n 2 22 DT n 2 23 DT n 2 24 DT n 2 25 DA n 2 26 DG n 2 27 DG n 3 1 DC n 3 2 DC n 3 3 DC n 3 4 DT n 3 5 DA n 3 6 DA n 3 7 DA n 3 8 DA n 3 9 DG n 3 10 DG n 3 11 DT n 3 12 DT n 3 13 DG n 3 14 DA n 3 15 DA n 3 16 DT n 3 17 DA n 3 18 DA n 3 19 DG n 3 20 DT n 3 21 DG n 3 22 DG n 3 23 DA n 3 24 DA n 3 25 DA n 3 26 DC n 3 27 DC n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 302 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 2 1 sample 1 27 'synthetic construct' ? 32630 ? 3 1 sample 1 27 'synthetic construct' ? 32630 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 PDB 6UVW 6UVW ? 1 ? 1 2 PDB 6UVW 6UVW ? 2 ? 1 3 PDB 6UVW 6UVW ? 3 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6UVW A 1 ? 302 ? 6UVW 2 ? 303 ? 2 303 2 2 6UVW B 1 ? 27 ? 6UVW -1 ? 25 ? -1 25 3 3 6UVW C 1 ? 27 ? 6UVW 0 ? 26 ? 0 26 4 1 6UVW D 1 ? 302 ? 6UVW 2 ? 303 ? 2 303 5 2 6UVW E 1 ? 27 ? 6UVW -1 ? 25 ? -1 25 6 3 6UVW F 1 ? 27 ? 6UVW 0 ? 26 ? 0 26 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DA 'DNA linking' y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 DC 'DNA linking' y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P' 307.197 DG 'DNA linking' y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 DT 'DNA linking' y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P' 322.208 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6UVW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.52 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.21 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100mM HEPES pH 8.5, 200mM ammonium sulfate, 28% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-04-06 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.977 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.977 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 51.300 _reflns.entry_id 6UVW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.550 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 34285 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.900 _reflns.pdbx_Rmerge_I_obs 0.073 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.022 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.077 _reflns.pdbx_Rpim_I_all 0.022 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 409080 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.550 2.640 ? ? ? ? ? ? 5625 90.000 ? ? ? ? 0.377 ? ? ? ? ? ? ? ? 8.500 ? 0.910 ? ? 0.400 0.129 ? 1 1 0.955 ? ? 2.640 2.750 ? ? ? ? ? ? 6248 96.800 ? ? ? ? 0.350 ? ? ? ? ? ? ? ? 10.100 ? 0.943 ? ? 0.368 0.111 ? 2 1 0.969 ? ? 2.750 2.870 ? ? ? ? ? ? 6512 99.400 ? ? ? ? 0.296 ? ? ? ? ? ? ? ? 11.500 ? 0.929 ? ? 0.310 0.090 ? 3 1 0.986 ? ? 2.870 3.020 ? ? ? ? ? ? 6535 100.000 ? ? ? ? 0.214 ? ? ? ? ? ? ? ? 12.100 ? 0.974 ? ? 0.223 0.063 ? 4 1 0.993 ? ? 3.020 3.210 ? ? ? ? ? ? 6553 100.000 ? ? ? ? 0.144 ? ? ? ? ? ? ? ? 12.800 ? 1.057 ? ? 0.150 0.042 ? 5 1 0.997 ? ? 3.210 3.460 ? ? ? ? ? ? 6554 100.000 ? ? ? ? 0.095 ? ? ? ? ? ? ? ? 13.200 ? 1.196 ? ? 0.099 0.027 ? 6 1 0.998 ? ? 3.460 3.810 ? ? ? ? ? ? 6575 100.000 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 12.800 ? 1.106 ? ? 0.079 0.022 ? 7 1 0.999 ? ? 3.810 4.360 ? ? ? ? ? ? 6536 100.000 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 13.000 ? 1.034 ? ? 0.064 0.018 ? 8 1 0.999 ? ? 4.360 5.490 ? ? ? ? ? ? 6573 100.000 ? ? ? ? 0.054 ? ? ? ? ? ? ? ? 12.500 ? 0.968 ? ? 0.056 0.016 ? 9 1 0.999 ? ? 5.490 50.000 ? ? ? ? ? ? 6577 100.000 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 12.300 ? 1.009 ? ? 0.049 0.014 ? 10 1 0.998 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 93.570 _refine.B_iso_mean 55.8565 _refine.B_iso_min 34.340 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6UVW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5510 _refine.ls_d_res_low 46.3090 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 34193 _refine.ls_number_reflns_R_free 1988 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.5400 _refine.ls_percent_reflns_R_free 5.8100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2249 _refine.ls_R_factor_R_free 0.2607 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2226 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3QQY _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.5900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5510 _refine_hist.d_res_low 46.3090 _refine_hist.number_atoms_solvent 23 _refine_hist.number_atoms_total 6750 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 699 _refine_hist.pdbx_B_iso_mean_ligand 47.96 _refine_hist.pdbx_B_iso_mean_solvent 48.51 _refine_hist.pdbx_number_atoms_protein 4522 _refine_hist.pdbx_number_atoms_nucleic_acid 2200 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? 7081 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.743 ? 10057 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.045 ? 1148 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 899 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 17.559 ? 3765 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 2594 9.114 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? D 2594 9.114 ? 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 3 TORSIONAL ? C 532 9.114 ? 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 4 TORSIONAL ? F 532 9.114 ? 2 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 5 TORSIONAL ? B 526 9.114 ? 3 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 6 TORSIONAL ? E 526 9.114 ? 3 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5510 2.6146 . . 126 2038 89.0000 . . . 0.3780 0.0000 0.3014 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6146 2.6852 . . 129 2144 94.0000 . . . 0.3562 0.0000 0.3045 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6852 2.7643 . . 146 2263 98.0000 . . . 0.3147 0.0000 0.2944 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7643 2.8535 . . 131 2298 99.0000 . . . 0.3710 0.0000 0.2925 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8535 2.9554 . . 145 2294 100.0000 . . . 0.3538 0.0000 0.2932 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9554 3.0737 . . 148 2298 100.0000 . . . 0.3153 0.0000 0.2882 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0737 3.2136 . . 137 2317 100.0000 . . . 0.3658 0.0000 0.2706 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2136 3.3830 . . 140 2319 100.0000 . . . 0.2696 0.0000 0.2400 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3830 3.5949 . . 151 2332 100.0000 . . . 0.2797 0.0000 0.2355 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5949 3.8723 . . 149 2302 100.0000 . . . 0.2699 0.0000 0.2274 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8723 4.2617 . . 142 2342 100.0000 . . . 0.2610 0.0000 0.2037 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.2617 4.8778 . . 136 2372 100.0000 . . . 0.2326 0.0000 0.1835 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.8778 6.1433 . . 150 2389 100.0000 . . . 0.2177 0.0000 0.1999 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.1433 46.3090 . . 158 2497 100.0000 . . . 0.1781 0.0000 0.1727 . . . . . . . . . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 9 through 30 or (resid 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 33 or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 82 or (resid 83 and (name N or name CA or name C or name O or name CB )) or resid 84 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 122 or (resid 123 and (name N or name CA or name C or name O or name CB )) or resid 124 through 143 or (resid 144 through 145 and (name N or name CA or name C or name O or name CB )) or resid 146 or (resid 147 through 149 and (name N or name CA or name C or name O or name CB )) or resid 150 through 153 or (resid 155 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 185 or (resid 186 through 191 and (name N or name CA or name C or name O or name CB )) or resid 192 through 228 or (resid 229 through 231 and (name N or name CA or name C or name O or name CB )) or resid 232 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 274 or (resid 275 and (name N or name CA or name C or name O or name CB )) or resid 276 through 281 or (resid 282 and (name N or name CA or name C or name O or name CB )) or resid 283 through 289 or (resid 290 through 292 and (name N or name CA or name C or name O or name CB )) or resid 293 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 303)) ; 1 2 ;(chain D and (resid 9 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 155 or (resid 156 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 186 or (resid 187 through 191 and (name N or name CA or name C or name O or name CB )) or resid 192 through 253 or (resid 254 and (name N or name CA or name C or name O or name CB )) or resid 255 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 276 or (resid 277 and (name N or name CA or name C or name O or name CB )) or resid 278 through 288 or (resid 289 through 292 and (name N or name CA or name C or name O or name CB )) or resid 293 through 295 or (resid 296 and (name N or name CA or name C or name O or name CB )) or resid 297 through 303)) ; 2 1 'chain C' 2 2 'chain F' 3 1 'chain B' 3 2 ;(chain E and ((resid -1 and (name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 0 through 25)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A SER 8 . A ARG 29 . A SER 9 A ARG 30 ? ;(chain A and (resid 9 through 30 or (resid 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 33 or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 82 or (resid 83 and (name N or name CA or name C or name O or name CB )) or resid 84 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 122 or (resid 123 and (name N or name CA or name C or name O or name CB )) or resid 124 through 143 or (resid 144 through 145 and (name N or name CA or name C or name O or name CB )) or resid 146 or (resid 147 through 149 and (name N or name CA or name C or name O or name CB )) or resid 150 through 153 or (resid 155 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 185 or (resid 186 through 191 and (name N or name CA or name C or name O or name CB )) or resid 192 through 228 or (resid 229 through 231 and (name N or name CA or name C or name O or name CB )) or resid 232 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 274 or (resid 275 and (name N or name CA or name C or name O or name CB )) or resid 276 through 281 or (resid 282 and (name N or name CA or name C or name O or name CB )) or resid 283 through 289 or (resid 290 through 292 and (name N or name CA or name C or name O or name CB )) or resid 293 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 303)) ; 1 1 2 A LYS 30 . A LYS 30 . A LYS 31 A LYS 31 ? ;(chain A and (resid 9 through 30 or (resid 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 33 or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 82 or (resid 83 and (name N or name CA or name C or name O or name CB )) or resid 84 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 122 or (resid 123 and (name N or name CA or name C or name O or name CB )) or resid 124 through 143 or (resid 144 through 145 and (name N or name CA or name C or name O or name CB )) or resid 146 or (resid 147 through 149 and (name N or name CA or name C or name O or name CB )) or resid 150 through 153 or (resid 155 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 185 or (resid 186 through 191 and (name N or name CA or name C or name O or name CB )) or resid 192 through 228 or (resid 229 through 231 and (name N or name CA or name C or name O or name CB )) or resid 232 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 274 or (resid 275 and (name N or name CA or name C or name O or name CB )) or resid 276 through 281 or (resid 282 and (name N or name CA or name C or name O or name CB )) or resid 283 through 289 or (resid 290 through 292 and (name N or name CA or name C or name O or name CB )) or resid 293 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 303)) ; 1 1 3 A SER 8 . A PHE 302 . A SER 9 A PHE 303 ? ;(chain A and (resid 9 through 30 or (resid 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 33 or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 82 or (resid 83 and (name N or name CA or name C or name O or name CB )) or resid 84 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 122 or (resid 123 and (name N or name CA or name C or name O or name CB )) or resid 124 through 143 or (resid 144 through 145 and (name N or name CA or name C or name O or name CB )) or resid 146 or (resid 147 through 149 and (name N or name CA or name C or name O or name CB )) or resid 150 through 153 or (resid 155 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 185 or (resid 186 through 191 and (name N or name CA or name C or name O or name CB )) or resid 192 through 228 or (resid 229 through 231 and (name N or name CA or name C or name O or name CB )) or resid 232 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 274 or (resid 275 and (name N or name CA or name C or name O or name CB )) or resid 276 through 281 or (resid 282 and (name N or name CA or name C or name O or name CB )) or resid 283 through 289 or (resid 290 through 292 and (name N or name CA or name C or name O or name CB )) or resid 293 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 303)) ; 1 1 4 A SER 8 . A PHE 302 . A SER 9 A PHE 303 ? ;(chain A and (resid 9 through 30 or (resid 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 33 or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 82 or (resid 83 and (name N or name CA or name C or name O or name CB )) or resid 84 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 122 or (resid 123 and (name N or name CA or name C or name O or name CB )) or resid 124 through 143 or (resid 144 through 145 and (name N or name CA or name C or name O or name CB )) or resid 146 or (resid 147 through 149 and (name N or name CA or name C or name O or name CB )) or resid 150 through 153 or (resid 155 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 185 or (resid 186 through 191 and (name N or name CA or name C or name O or name CB )) or resid 192 through 228 or (resid 229 through 231 and (name N or name CA or name C or name O or name CB )) or resid 232 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 274 or (resid 275 and (name N or name CA or name C or name O or name CB )) or resid 276 through 281 or (resid 282 and (name N or name CA or name C or name O or name CB )) or resid 283 through 289 or (resid 290 through 292 and (name N or name CA or name C or name O or name CB )) or resid 293 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 303)) ; 1 1 5 A SER 8 . A PHE 302 . A SER 9 A PHE 303 ? ;(chain A and (resid 9 through 30 or (resid 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 33 or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 82 or (resid 83 and (name N or name CA or name C or name O or name CB )) or resid 84 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 122 or (resid 123 and (name N or name CA or name C or name O or name CB )) or resid 124 through 143 or (resid 144 through 145 and (name N or name CA or name C or name O or name CB )) or resid 146 or (resid 147 through 149 and (name N or name CA or name C or name O or name CB )) or resid 150 through 153 or (resid 155 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 185 or (resid 186 through 191 and (name N or name CA or name C or name O or name CB )) or resid 192 through 228 or (resid 229 through 231 and (name N or name CA or name C or name O or name CB )) or resid 232 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 274 or (resid 275 and (name N or name CA or name C or name O or name CB )) or resid 276 through 281 or (resid 282 and (name N or name CA or name C or name O or name CB )) or resid 283 through 289 or (resid 290 through 292 and (name N or name CA or name C or name O or name CB )) or resid 293 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 303)) ; 1 1 6 A SER 8 . A PHE 302 . A SER 9 A PHE 303 ? ;(chain A and (resid 9 through 30 or (resid 31 and (name N or name CA or name C or name O or name CB )) or resid 32 through 33 or (resid 34 and (name N or name CA or name C or name O or name CB )) or resid 35 through 82 or (resid 83 and (name N or name CA or name C or name O or name CB )) or resid 84 through 119 or (resid 120 and (name N or name CA or name C or name O or name CB )) or resid 121 through 122 or (resid 123 and (name N or name CA or name C or name O or name CB )) or resid 124 through 143 or (resid 144 through 145 and (name N or name CA or name C or name O or name CB )) or resid 146 or (resid 147 through 149 and (name N or name CA or name C or name O or name CB )) or resid 150 through 153 or (resid 155 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 185 or (resid 186 through 191 and (name N or name CA or name C or name O or name CB )) or resid 192 through 228 or (resid 229 through 231 and (name N or name CA or name C or name O or name CB )) or resid 232 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 274 or (resid 275 and (name N or name CA or name C or name O or name CB )) or resid 276 through 281 or (resid 282 and (name N or name CA or name C or name O or name CB )) or resid 283 through 289 or (resid 290 through 292 and (name N or name CA or name C or name O or name CB )) or resid 293 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 303)) ; 1 2 1 D SER 8 . D GLU 57 . D SER 9 D GLU 58 ? ;(chain D and (resid 9 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 155 or (resid 156 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 186 or (resid 187 through 191 and (name N or name CA or name C or name O or name CB )) or resid 192 through 253 or (resid 254 and (name N or name CA or name C or name O or name CB )) or resid 255 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 276 or (resid 277 and (name N or name CA or name C or name O or name CB )) or resid 278 through 288 or (resid 289 through 292 and (name N or name CA or name C or name O or name CB )) or resid 293 through 295 or (resid 296 and (name N or name CA or name C or name O or name CB )) or resid 297 through 303)) ; 1 2 2 D ASN 58 . D ASN 58 . D ASN 59 D ASN 59 ? ;(chain D and (resid 9 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 155 or (resid 156 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 186 or (resid 187 through 191 and (name N or name CA or name C or name O or name CB )) or resid 192 through 253 or (resid 254 and (name N or name CA or name C or name O or name CB )) or resid 255 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 276 or (resid 277 and (name N or name CA or name C or name O or name CB )) or resid 278 through 288 or (resid 289 through 292 and (name N or name CA or name C or name O or name CB )) or resid 293 through 295 or (resid 296 and (name N or name CA or name C or name O or name CB )) or resid 297 through 303)) ; 1 2 3 D ARG 6 . D PHE 302 . D ARG 7 D PHE 303 ? ;(chain D and (resid 9 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 155 or (resid 156 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 186 or (resid 187 through 191 and (name N or name CA or name C or name O or name CB )) or resid 192 through 253 or (resid 254 and (name N or name CA or name C or name O or name CB )) or resid 255 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 276 or (resid 277 and (name N or name CA or name C or name O or name CB )) or resid 278 through 288 or (resid 289 through 292 and (name N or name CA or name C or name O or name CB )) or resid 293 through 295 or (resid 296 and (name N or name CA or name C or name O or name CB )) or resid 297 through 303)) ; 1 2 4 D ARG 6 . D PHE 302 . D ARG 7 D PHE 303 ? ;(chain D and (resid 9 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 155 or (resid 156 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 186 or (resid 187 through 191 and (name N or name CA or name C or name O or name CB )) or resid 192 through 253 or (resid 254 and (name N or name CA or name C or name O or name CB )) or resid 255 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 276 or (resid 277 and (name N or name CA or name C or name O or name CB )) or resid 278 through 288 or (resid 289 through 292 and (name N or name CA or name C or name O or name CB )) or resid 293 through 295 or (resid 296 and (name N or name CA or name C or name O or name CB )) or resid 297 through 303)) ; 1 2 5 D ARG 6 . D PHE 302 . D ARG 7 D PHE 303 ? ;(chain D and (resid 9 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 155 or (resid 156 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 186 or (resid 187 through 191 and (name N or name CA or name C or name O or name CB )) or resid 192 through 253 or (resid 254 and (name N or name CA or name C or name O or name CB )) or resid 255 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 276 or (resid 277 and (name N or name CA or name C or name O or name CB )) or resid 278 through 288 or (resid 289 through 292 and (name N or name CA or name C or name O or name CB )) or resid 293 through 295 or (resid 296 and (name N or name CA or name C or name O or name CB )) or resid 297 through 303)) ; 1 2 6 D ARG 6 . D PHE 302 . D ARG 7 D PHE 303 ? ;(chain D and (resid 9 through 58 or (resid 59 and (name N or name CA or name C or name O or name CB )) or resid 60 through 155 or (resid 156 through 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 186 or (resid 187 through 191 and (name N or name CA or name C or name O or name CB )) or resid 192 through 253 or (resid 254 and (name N or name CA or name C or name O or name CB )) or resid 255 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 276 or (resid 277 and (name N or name CA or name C or name O or name CB )) or resid 278 through 288 or (resid 289 through 292 and (name N or name CA or name C or name O or name CB )) or resid 293 through 295 or (resid 296 and (name N or name CA or name C or name O or name CB )) or resid 297 through 303)) ; 2 1 1 C DC 1 . C DC 27 . C DC 0 C DC 26 ? 'chain C' 2 2 1 F DC 1 . F DC 27 . F DC 0 F DC 26 ? 'chain F' 3 1 1 B DG 1 . B DG 27 . B DG -1 B DG 25 ? 'chain B' 3 2 1 E DG 1 . E DG 1 . E DG -1 E DG -1 ? ;(chain E and ((resid -1 and (name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 0 through 25)) ; 3 2 2 E DG 1 . E DG 27 . E DG -1 E DG 25 ? ;(chain E and ((resid -1 and (name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 0 through 25)) ; 3 2 3 E DG 1 . E DG 27 . E DG -1 E DG 25 ? ;(chain E and ((resid -1 and (name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 0 through 25)) ; 3 2 4 E DG 1 . E DG 27 . E DG -1 E DG 25 ? ;(chain E and ((resid -1 and (name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 0 through 25)) ; 3 2 5 E DG 1 . E DG 27 . E DG -1 E DG 25 ? ;(chain E and ((resid -1 and (name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 0 through 25)) ; 3 2 6 E DG 1 . E DG 27 . E DG -1 E DG 25 ? ;(chain E and ((resid -1 and (name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 0 through 25)) ; 3 2 7 E DG 1 . E DG 27 . E DG -1 E DG 25 ? ;(chain E and ((resid -1 and (name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 0 through 25)) ; 3 2 8 E DG 1 . E DG 27 . E DG -1 E DG 25 ? ;(chain E and ((resid -1 and (name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 0 through 25)) ; 3 2 9 E DG 1 . E DG 27 . E DG -1 E DG 25 ? ;(chain E and ((resid -1 and (name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 0 through 25)) ; 3 2 10 E DG 1 . E DG 27 . E DG -1 E DG 25 ? ;(chain E and ((resid -1 and (name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 0 through 25)) ; 3 2 11 E DG 1 . E DG 27 . E DG -1 E DG 25 ? ;(chain E and ((resid -1 and (name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 0 through 25)) ; 3 2 12 E DG 1 . E DG 27 . E DG -1 E DG 25 ? ;(chain E and ((resid -1 and (name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 0 through 25)) ; 3 2 13 E DG 1 . E DG 27 . E DG -1 E DG 25 ? ;(chain E and ((resid -1 and (name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 0 through 25)) ; 3 2 14 E DG 1 . E DG 27 . E DG -1 E DG 25 ? ;(chain E and ((resid -1 and (name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 0 through 25)) ; 3 2 15 E DG 1 . E DG 27 . E DG -1 E DG 25 ? ;(chain E and ((resid -1 and (name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 0 through 25)) ; 3 2 16 E DG 1 . E DG 27 . E DG -1 E DG 25 ? ;(chain E and ((resid -1 and (name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 0 through 25)) ; 3 2 17 E DG 1 . E DG 27 . E DG -1 E DG 25 ? ;(chain E and ((resid -1 and (name C4 or name O4 or name C3 or name O3 or name C2 or name C1 or name N9 or name C8 or name N7 or name C5 or name C6 or name O6 or name N1 or name C2 or name N2 or name N3 or name C4 )) or resid 0 through 25)) ; # loop_ _struct_ncs_ens.id _struct_ncs_ens.details 1 ? 2 ? 3 ? # _struct.entry_id 6UVW _struct.title 'Engineered variant of I-OnuI meganuclease with improved thermostability' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6UVW _struct_keywords.text 'Meganuclease, Homing Endonuclease, DNA BINDING PROTEIN, DNA BINDING PROTEIN-DNA complex' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN/DNA' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 1 ? E N N 2 ? F N N 3 ? G N N 4 ? H N N 4 ? I N N 4 ? J N N 4 ? K N N 4 ? L N N 5 ? M N N 5 ? N N N 5 ? O N N 5 ? P N N 5 ? Q N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 10 ? GLU A 21 ? ASN A 11 GLU A 22 1 ? 12 HELX_P HELX_P2 AA2 ASP A 52 ? GLY A 64 ? ASP A 53 GLY A 65 1 ? 13 HELX_P HELX_P3 AA3 ARG A 82 ? GLU A 84 ? ARG A 83 GLU A 85 5 ? 3 HELX_P HELX_P4 AA4 ASP A 85 ? TYR A 96 ? ASP A 86 TYR A 97 1 ? 12 HELX_P HELX_P5 AA5 GLN A 101 ? ASN A 118 ? GLN A 102 ASN A 119 1 ? 18 HELX_P HELX_P6 AA6 LYS A 119 ? LEU A 122 ? LYS A 120 LEU A 123 5 ? 4 HELX_P HELX_P7 AA7 THR A 123 ? LEU A 137 ? THR A 124 LEU A 138 1 ? 15 HELX_P HELX_P8 AA8 THR A 142 ? PHE A 149 ? THR A 143 PHE A 150 1 ? 8 HELX_P HELX_P9 AA9 ASN A 166 ? GLU A 177 ? ASN A 167 GLU A 178 1 ? 12 HELX_P HELX_P10 AB1 ASP A 207 ? GLY A 219 ? ASP A 208 GLY A 220 1 ? 13 HELX_P HELX_P11 AB2 LYS A 240 ? LYS A 247 ? LYS A 241 LYS A 248 1 ? 8 HELX_P HELX_P12 AB3 LYS A 247 ? TYR A 255 ? LYS A 248 TYR A 256 1 ? 9 HELX_P HELX_P13 AB4 GLY A 259 ? GLU A 277 ? GLY A 260 GLU A 278 1 ? 19 HELX_P HELX_P14 AB5 LYS A 278 ? LEU A 281 ? LYS A 279 LEU A 282 5 ? 4 HELX_P HELX_P15 AB6 THR A 282 ? MET A 296 ? THR A 283 MET A 297 1 ? 15 HELX_P HELX_P16 AB7 ASN A 297 ? ARG A 300 ? ASN A 298 ARG A 301 5 ? 4 HELX_P HELX_P17 AB8 ASN D 10 ? GLU D 21 ? ASN D 11 GLU D 22 1 ? 12 HELX_P HELX_P18 AB9 ASP D 52 ? GLY D 64 ? ASP D 53 GLY D 65 1 ? 13 HELX_P HELX_P19 AC1 ARG D 82 ? GLU D 84 ? ARG D 83 GLU D 85 5 ? 3 HELX_P HELX_P20 AC2 ASP D 85 ? TYR D 96 ? ASP D 86 TYR D 97 1 ? 12 HELX_P HELX_P21 AC3 GLN D 101 ? ASN D 118 ? GLN D 102 ASN D 119 1 ? 18 HELX_P HELX_P22 AC4 LYS D 119 ? LEU D 122 ? LYS D 120 LEU D 123 5 ? 4 HELX_P HELX_P23 AC5 THR D 123 ? LEU D 137 ? THR D 124 LEU D 138 1 ? 15 HELX_P HELX_P24 AC6 THR D 142 ? PHE D 149 ? THR D 143 PHE D 150 1 ? 8 HELX_P HELX_P25 AC7 ASN D 166 ? GLU D 177 ? ASN D 167 GLU D 178 1 ? 12 HELX_P HELX_P26 AC8 ASP D 207 ? GLY D 219 ? ASP D 208 GLY D 220 1 ? 13 HELX_P HELX_P27 AC9 LYS D 240 ? LYS D 247 ? LYS D 241 LYS D 248 1 ? 8 HELX_P HELX_P28 AD1 LYS D 247 ? TYR D 255 ? LYS D 248 TYR D 256 1 ? 9 HELX_P HELX_P29 AD2 GLY D 259 ? GLU D 277 ? GLY D 260 GLU D 278 1 ? 19 HELX_P HELX_P30 AD3 LYS D 278 ? LEU D 281 ? LYS D 279 LEU D 282 5 ? 4 HELX_P HELX_P31 AD4 THR D 282 ? ASN D 295 ? THR D 283 ASN D 296 1 ? 14 HELX_P HELX_P32 AD5 MET D 296 ? ARG D 300 ? MET D 297 ARG D 301 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ALA 20 O ? ? ? 1_555 G CA . CA ? ? A ALA 21 A CA 401 1_555 ? ? ? ? ? ? ? 2.426 ? ? metalc2 metalc ? ? A GLU 21 OE1 ? ? ? 1_555 H CA . CA ? ? A GLU 22 A CA 402 1_555 ? ? ? ? ? ? ? 2.379 ? ? metalc3 metalc ? ? A GLU 21 OE2 ? ? ? 1_555 I CA . CA ? ? A GLU 22 A CA 403 1_555 ? ? ? ? ? ? ? 2.325 ? ? metalc4 metalc ? ? A GLY 176 O ? ? ? 1_555 H CA . CA ? ? A GLY 177 A CA 402 1_555 ? ? ? ? ? ? ? 2.415 ? ? metalc5 metalc ? ? A GLU 177 OE1 ? ? ? 1_555 G CA . CA ? ? A GLU 178 A CA 401 1_555 ? ? ? ? ? ? ? 2.368 ? ? metalc6 metalc ? ? A GLU 177 OE1 ? ? ? 1_555 I CA . CA ? ? A GLU 178 A CA 403 1_555 ? ? ? ? ? ? ? 3.136 ? ? metalc7 metalc ? ? A GLU 177 OE2 ? ? ? 1_555 I CA . CA ? ? A GLU 178 A CA 403 1_555 ? ? ? ? ? ? ? 2.170 ? ? metalc8 metalc ? ? G CA . CA ? ? ? 1_555 L HOH . O ? ? A CA 401 A HOH 504 1_555 ? ? ? ? ? ? ? 2.522 ? ? metalc9 metalc ? ? G CA . CA ? ? ? 1_555 B DC 16 OP1 ? ? A CA 401 B DC 14 1_555 ? ? ? ? ? ? ? 2.289 ? ? metalc10 metalc ? ? G CA . CA ? ? ? 1_555 C DA 17 OP2 ? ? A CA 401 C DA 16 1_555 ? ? ? ? ? ? ? 2.205 ? ? metalc11 metalc ? ? H CA . CA ? ? ? 1_555 L HOH . O ? ? A CA 402 A HOH 505 1_555 ? ? ? ? ? ? ? 2.404 ? ? metalc12 metalc ? ? H CA . CA ? ? ? 1_555 B DA 17 OP2 ? ? A CA 402 B DA 15 1_555 ? ? ? ? ? ? ? 2.327 ? ? metalc13 metalc ? ? H CA . CA ? ? ? 1_555 C DT 16 OP1 ? ? A CA 402 C DT 15 1_555 ? ? ? ? ? ? ? 2.390 ? ? metalc14 metalc ? ? I CA . CA ? ? ? 1_555 B DC 16 "O3'" ? ? A CA 403 B DC 14 1_555 ? ? ? ? ? ? ? 2.891 ? ? metalc15 metalc ? ? I CA . CA ? ? ? 1_555 B DA 17 OP2 ? ? A CA 403 B DA 15 1_555 ? ? ? ? ? ? ? 2.582 ? ? metalc16 metalc ? ? I CA . CA ? ? ? 1_555 C DT 16 "O3'" ? ? A CA 403 C DT 15 1_555 ? ? ? ? ? ? ? 2.846 ? ? metalc17 metalc ? ? I CA . CA ? ? ? 1_555 C DA 17 OP2 ? ? A CA 403 C DA 16 1_555 ? ? ? ? ? ? ? 2.192 ? ? metalc18 metalc ? ? D ALA 20 O ? ? ? 1_555 J CA . CA ? ? D ALA 21 D CA 401 1_555 ? ? ? ? ? ? ? 2.464 ? ? metalc19 metalc ? ? D GLU 21 OE2 ? ? ? 1_555 K CA . CA ? ? D GLU 22 D CA 402 1_555 ? ? ? ? ? ? ? 2.201 ? ? metalc20 metalc ? ? D GLY 176 O ? ? ? 1_555 K CA . CA ? ? D GLY 177 D CA 402 1_555 ? ? ? ? ? ? ? 2.450 ? ? metalc21 metalc ? ? D GLU 177 OE1 ? ? ? 1_555 J CA . CA ? ? D GLU 178 D CA 401 1_555 ? ? ? ? ? ? ? 2.255 ? ? metalc22 metalc ? ? J CA . CA ? ? ? 1_555 O HOH . O ? ? D CA 401 D HOH 503 1_555 ? ? ? ? ? ? ? 2.490 ? ? metalc23 metalc ? ? J CA . CA ? ? ? 1_555 E DC 16 OP1 ? ? D CA 401 E DC 14 1_555 ? ? ? ? ? ? ? 2.272 ? ? metalc24 metalc ? ? J CA . CA ? ? ? 1_555 P HOH . O ? ? D CA 401 E HOH 101 1_555 ? ? ? ? ? ? ? 2.554 ? ? metalc25 metalc ? ? J CA . CA ? ? ? 1_555 F DA 17 OP2 ? ? D CA 401 F DA 16 1_555 ? ? ? ? ? ? ? 2.293 ? ? metalc26 metalc ? ? K CA . CA ? ? ? 1_555 O HOH . O ? ? D CA 402 D HOH 504 1_555 ? ? ? ? ? ? ? 2.493 ? ? metalc27 metalc ? ? K CA . CA ? ? ? 1_555 O HOH . O ? ? D CA 402 D HOH 509 1_555 ? ? ? ? ? ? ? 2.689 ? ? metalc28 metalc ? ? K CA . CA ? ? ? 1_555 E DA 17 OP2 ? ? D CA 402 E DA 15 1_555 ? ? ? ? ? ? ? 2.284 ? ? metalc29 metalc ? ? K CA . CA ? ? ? 1_555 F DT 16 OP1 ? ? D CA 402 F DT 15 1_555 ? ? ? ? ? ? ? 2.372 ? ? hydrog1 hydrog ? ? B DG 2 N1 ? ? ? 1_555 C DC 27 N3 ? ? B DG 0 C DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog2 hydrog ? ? B DG 2 N2 ? ? ? 1_555 C DC 27 O2 ? ? B DG 0 C DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog3 hydrog ? ? B DG 2 O6 ? ? ? 1_555 C DC 27 N4 ? ? B DG 0 C DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog4 hydrog ? ? B DG 3 N1 ? ? ? 1_555 C DC 26 N3 ? ? B DG 1 C DC 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog5 hydrog ? ? B DG 3 N2 ? ? ? 1_555 C DC 26 O2 ? ? B DG 1 C DC 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog6 hydrog ? ? B DG 3 O6 ? ? ? 1_555 C DC 26 N4 ? ? B DG 1 C DC 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog7 hydrog ? ? B DT 4 N3 ? ? ? 1_555 C DA 25 N1 ? ? B DT 2 C DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog8 hydrog ? ? B DT 4 O4 ? ? ? 1_555 C DA 25 N6 ? ? B DT 2 C DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog9 hydrog ? ? B DT 5 N3 ? ? ? 1_555 C DA 24 N1 ? ? B DT 3 C DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog10 hydrog ? ? B DT 5 O4 ? ? ? 1_555 C DA 24 N6 ? ? B DT 3 C DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog11 hydrog ? ? B DT 6 N3 ? ? ? 1_555 C DA 23 N1 ? ? B DT 4 C DA 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog12 hydrog ? ? B DT 6 O4 ? ? ? 1_555 C DA 23 N6 ? ? B DT 4 C DA 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog13 hydrog ? ? B DC 7 N3 ? ? ? 1_555 C DG 22 N1 ? ? B DC 5 C DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog14 hydrog ? ? B DC 7 N4 ? ? ? 1_555 C DG 22 O6 ? ? B DC 5 C DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog15 hydrog ? ? B DC 7 O2 ? ? ? 1_555 C DG 22 N2 ? ? B DC 5 C DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog16 hydrog ? ? B DC 8 N3 ? ? ? 1_555 C DG 21 N1 ? ? B DC 6 C DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog17 hydrog ? ? B DC 8 N4 ? ? ? 1_555 C DG 21 O6 ? ? B DC 6 C DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog18 hydrog ? ? B DC 8 O2 ? ? ? 1_555 C DG 21 N2 ? ? B DC 6 C DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog19 hydrog ? ? B DA 9 N1 ? ? ? 1_555 C DT 20 N3 ? ? B DA 7 C DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog20 hydrog ? ? B DA 9 N6 ? ? ? 1_555 C DT 20 O4 ? ? B DA 7 C DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog21 hydrog ? ? B DC 10 N3 ? ? ? 1_555 C DG 19 N1 ? ? B DC 8 C DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog22 hydrog ? ? B DC 10 N4 ? ? ? 1_555 C DG 19 O6 ? ? B DC 8 C DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog23 hydrog ? ? B DC 10 O2 ? ? ? 1_555 C DG 19 N2 ? ? B DC 8 C DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog24 hydrog ? ? B DT 11 N3 ? ? ? 1_555 C DA 18 N1 ? ? B DT 9 C DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog25 hydrog ? ? B DT 11 O4 ? ? ? 1_555 C DA 18 N6 ? ? B DT 9 C DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog26 hydrog ? ? B DT 12 N3 ? ? ? 1_555 C DA 17 N1 ? ? B DT 10 C DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog27 hydrog ? ? B DT 12 O4 ? ? ? 1_555 C DA 17 N6 ? ? B DT 10 C DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog28 hydrog ? ? B DA 13 N1 ? ? ? 1_555 C DT 16 N3 ? ? B DA 11 C DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog29 hydrog ? ? B DA 13 N6 ? ? ? 1_555 C DT 16 O4 ? ? B DA 11 C DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog30 hydrog ? ? B DT 14 N3 ? ? ? 1_555 C DA 15 N1 ? ? B DT 12 C DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog31 hydrog ? ? B DT 14 O4 ? ? ? 1_555 C DA 15 N6 ? ? B DT 12 C DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog32 hydrog ? ? B DT 15 N3 ? ? ? 1_555 C DA 14 N1 ? ? B DT 13 C DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog33 hydrog ? ? B DT 15 O4 ? ? ? 1_555 C DA 14 N6 ? ? B DT 13 C DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog34 hydrog ? ? B DC 16 N3 ? ? ? 1_555 C DG 13 N1 ? ? B DC 14 C DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog35 hydrog ? ? B DC 16 N4 ? ? ? 1_555 C DG 13 O6 ? ? B DC 14 C DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog36 hydrog ? ? B DC 16 O2 ? ? ? 1_555 C DG 13 N2 ? ? B DC 14 C DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog37 hydrog ? ? B DA 17 N1 ? ? ? 1_555 C DT 12 N3 ? ? B DA 15 C DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog38 hydrog ? ? B DA 17 N6 ? ? ? 1_555 C DT 12 O4 ? ? B DA 15 C DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog39 hydrog ? ? B DA 18 N1 ? ? ? 1_555 C DT 11 N3 ? ? B DA 16 C DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog40 hydrog ? ? B DA 18 N6 ? ? ? 1_555 C DT 11 O4 ? ? B DA 16 C DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog41 hydrog ? ? B DC 19 N3 ? ? ? 1_555 C DG 10 N1 ? ? B DC 17 C DG 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog42 hydrog ? ? B DC 19 N4 ? ? ? 1_555 C DG 10 O6 ? ? B DC 17 C DG 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog43 hydrog ? ? B DC 19 O2 ? ? ? 1_555 C DG 10 N2 ? ? B DC 17 C DG 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog44 hydrog ? ? B DC 20 N3 ? ? ? 1_555 C DG 9 N1 ? ? B DC 18 C DG 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog45 hydrog ? ? B DC 20 N4 ? ? ? 1_555 C DG 9 O6 ? ? B DC 18 C DG 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog46 hydrog ? ? B DC 20 O2 ? ? ? 1_555 C DG 9 N2 ? ? B DC 18 C DG 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog47 hydrog ? ? B DT 21 N3 ? ? ? 1_555 C DA 8 N1 ? ? B DT 19 C DA 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog48 hydrog ? ? B DT 21 O4 ? ? ? 1_555 C DA 8 N6 ? ? B DT 19 C DA 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog49 hydrog ? ? B DT 22 N3 ? ? ? 1_555 C DA 7 N1 ? ? B DT 20 C DA 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog50 hydrog ? ? B DT 22 O4 ? ? ? 1_555 C DA 7 N6 ? ? B DT 20 C DA 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog51 hydrog ? ? B DT 23 N3 ? ? ? 1_555 C DA 6 N1 ? ? B DT 21 C DA 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog52 hydrog ? ? B DT 23 O4 ? ? ? 1_555 C DA 6 N6 ? ? B DT 21 C DA 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog53 hydrog ? ? B DT 24 N3 ? ? ? 1_555 C DA 5 N1 ? ? B DT 22 C DA 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog54 hydrog ? ? B DT 24 O4 ? ? ? 1_555 C DA 5 N6 ? ? B DT 22 C DA 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog55 hydrog ? ? B DA 25 N1 ? ? ? 1_555 C DT 4 N3 ? ? B DA 23 C DT 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog56 hydrog ? ? B DA 25 N6 ? ? ? 1_555 C DT 4 O4 ? ? B DA 23 C DT 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog57 hydrog ? ? B DG 26 N1 ? ? ? 1_555 C DC 3 N3 ? ? B DG 24 C DC 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog58 hydrog ? ? B DG 26 N2 ? ? ? 1_555 C DC 3 O2 ? ? B DG 24 C DC 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog59 hydrog ? ? B DG 26 O6 ? ? ? 1_555 C DC 3 N4 ? ? B DG 24 C DC 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog60 hydrog ? ? B DG 27 N1 ? ? ? 1_555 C DC 2 N3 ? ? B DG 25 C DC 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog61 hydrog ? ? B DG 27 N2 ? ? ? 1_555 C DC 2 O2 ? ? B DG 25 C DC 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog62 hydrog ? ? B DG 27 O6 ? ? ? 1_555 C DC 2 N4 ? ? B DG 25 C DC 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog63 hydrog ? ? E DG 2 N1 ? ? ? 1_555 F DC 27 N3 ? ? E DG 0 F DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog64 hydrog ? ? E DG 2 N2 ? ? ? 1_555 F DC 27 O2 ? ? E DG 0 F DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog65 hydrog ? ? E DG 2 O6 ? ? ? 1_555 F DC 27 N4 ? ? E DG 0 F DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog66 hydrog ? ? E DG 3 N1 ? ? ? 1_555 F DC 26 N3 ? ? E DG 1 F DC 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog67 hydrog ? ? E DG 3 N2 ? ? ? 1_555 F DC 26 O2 ? ? E DG 1 F DC 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog68 hydrog ? ? E DG 3 O6 ? ? ? 1_555 F DC 26 N4 ? ? E DG 1 F DC 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog69 hydrog ? ? E DT 4 N3 ? ? ? 1_555 F DA 25 N1 ? ? E DT 2 F DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog70 hydrog ? ? E DT 4 O4 ? ? ? 1_555 F DA 25 N6 ? ? E DT 2 F DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog71 hydrog ? ? E DT 5 N3 ? ? ? 1_555 F DA 24 N1 ? ? E DT 3 F DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog72 hydrog ? ? E DT 5 O4 ? ? ? 1_555 F DA 24 N6 ? ? E DT 3 F DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog73 hydrog ? ? E DT 6 N3 ? ? ? 1_555 F DA 23 N1 ? ? E DT 4 F DA 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog74 hydrog ? ? E DT 6 O4 ? ? ? 1_555 F DA 23 N6 ? ? E DT 4 F DA 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog75 hydrog ? ? E DC 7 N3 ? ? ? 1_555 F DG 22 N1 ? ? E DC 5 F DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog76 hydrog ? ? E DC 7 N4 ? ? ? 1_555 F DG 22 O6 ? ? E DC 5 F DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog77 hydrog ? ? E DC 7 O2 ? ? ? 1_555 F DG 22 N2 ? ? E DC 5 F DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog78 hydrog ? ? E DC 8 N3 ? ? ? 1_555 F DG 21 N1 ? ? E DC 6 F DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog79 hydrog ? ? E DC 8 N4 ? ? ? 1_555 F DG 21 O6 ? ? E DC 6 F DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog80 hydrog ? ? E DC 8 O2 ? ? ? 1_555 F DG 21 N2 ? ? E DC 6 F DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog81 hydrog ? ? E DA 9 N1 ? ? ? 1_555 F DT 20 N3 ? ? E DA 7 F DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog82 hydrog ? ? E DA 9 N6 ? ? ? 1_555 F DT 20 O4 ? ? E DA 7 F DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog83 hydrog ? ? E DC 10 N3 ? ? ? 1_555 F DG 19 N1 ? ? E DC 8 F DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog84 hydrog ? ? E DC 10 N4 ? ? ? 1_555 F DG 19 O6 ? ? E DC 8 F DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog85 hydrog ? ? E DC 10 O2 ? ? ? 1_555 F DG 19 N2 ? ? E DC 8 F DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog86 hydrog ? ? E DT 11 N3 ? ? ? 1_555 F DA 18 N1 ? ? E DT 9 F DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog87 hydrog ? ? E DT 11 O4 ? ? ? 1_555 F DA 18 N6 ? ? E DT 9 F DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog88 hydrog ? ? E DT 12 N3 ? ? ? 1_555 F DA 17 N1 ? ? E DT 10 F DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog89 hydrog ? ? E DT 12 O4 ? ? ? 1_555 F DA 17 N6 ? ? E DT 10 F DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog90 hydrog ? ? E DA 13 N1 ? ? ? 1_555 F DT 16 N3 ? ? E DA 11 F DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog91 hydrog ? ? E DA 13 N6 ? ? ? 1_555 F DT 16 O4 ? ? E DA 11 F DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog92 hydrog ? ? E DT 14 N3 ? ? ? 1_555 F DA 15 N1 ? ? E DT 12 F DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog93 hydrog ? ? E DT 14 O4 ? ? ? 1_555 F DA 15 N6 ? ? E DT 12 F DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog94 hydrog ? ? E DT 15 N3 ? ? ? 1_555 F DA 14 N1 ? ? E DT 13 F DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog95 hydrog ? ? E DT 15 O4 ? ? ? 1_555 F DA 14 N6 ? ? E DT 13 F DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog96 hydrog ? ? E DC 16 N3 ? ? ? 1_555 F DG 13 N1 ? ? E DC 14 F DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog97 hydrog ? ? E DC 16 N4 ? ? ? 1_555 F DG 13 O6 ? ? E DC 14 F DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog98 hydrog ? ? E DC 16 O2 ? ? ? 1_555 F DG 13 N2 ? ? E DC 14 F DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog99 hydrog ? ? E DA 17 N1 ? ? ? 1_555 F DT 12 N3 ? ? E DA 15 F DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog100 hydrog ? ? E DA 17 N6 ? ? ? 1_555 F DT 12 O4 ? ? E DA 15 F DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog101 hydrog ? ? E DA 18 N1 ? ? ? 1_555 F DT 11 N3 ? ? E DA 16 F DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog102 hydrog ? ? E DA 18 N6 ? ? ? 1_555 F DT 11 O4 ? ? E DA 16 F DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog103 hydrog ? ? E DC 19 N3 ? ? ? 1_555 F DG 10 N1 ? ? E DC 17 F DG 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog104 hydrog ? ? E DC 19 N4 ? ? ? 1_555 F DG 10 O6 ? ? E DC 17 F DG 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog105 hydrog ? ? E DC 19 O2 ? ? ? 1_555 F DG 10 N2 ? ? E DC 17 F DG 9 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog106 hydrog ? ? E DC 20 N3 ? ? ? 1_555 F DG 9 N1 ? ? E DC 18 F DG 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog107 hydrog ? ? E DC 20 N4 ? ? ? 1_555 F DG 9 O6 ? ? E DC 18 F DG 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog108 hydrog ? ? E DC 20 O2 ? ? ? 1_555 F DG 9 N2 ? ? E DC 18 F DG 8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog109 hydrog ? ? E DT 21 N3 ? ? ? 1_555 F DA 8 N1 ? ? E DT 19 F DA 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog110 hydrog ? ? E DT 21 O4 ? ? ? 1_555 F DA 8 N6 ? ? E DT 19 F DA 7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog111 hydrog ? ? E DT 22 N3 ? ? ? 1_555 F DA 7 N1 ? ? E DT 20 F DA 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog112 hydrog ? ? E DT 22 O4 ? ? ? 1_555 F DA 7 N6 ? ? E DT 20 F DA 6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog113 hydrog ? ? E DT 23 N3 ? ? ? 1_555 F DA 6 N1 ? ? E DT 21 F DA 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog114 hydrog ? ? E DT 23 O4 ? ? ? 1_555 F DA 6 N6 ? ? E DT 21 F DA 5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog115 hydrog ? ? E DT 24 N3 ? ? ? 1_555 F DA 5 N1 ? ? E DT 22 F DA 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog116 hydrog ? ? E DT 24 O4 ? ? ? 1_555 F DA 5 N6 ? ? E DT 22 F DA 4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog117 hydrog ? ? E DA 25 N1 ? ? ? 1_555 F DT 4 N3 ? ? E DA 23 F DT 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog118 hydrog ? ? E DA 25 N6 ? ? ? 1_555 F DT 4 O4 ? ? E DA 23 F DT 3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog119 hydrog ? ? E DG 26 N1 ? ? ? 1_555 F DC 3 N3 ? ? E DG 24 F DC 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog120 hydrog ? ? E DG 26 N2 ? ? ? 1_555 F DC 3 O2 ? ? E DG 24 F DC 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog121 hydrog ? ? E DG 26 O6 ? ? ? 1_555 F DC 3 N4 ? ? E DG 24 F DC 2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog122 hydrog ? ? E DG 27 N1 ? ? ? 1_555 F DC 2 N3 ? ? E DG 25 F DC 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog123 hydrog ? ? E DG 27 N2 ? ? ? 1_555 F DC 2 O2 ? ? E DG 25 F DC 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog124 hydrog ? ? E DG 27 O6 ? ? ? 1_555 F DC 2 N4 ? ? E DG 25 F DC 1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference metalc ? ? hydrog ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 4 ? AA4 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 23 ? LYS A 30 ? SER A 24 LYS A 31 AA1 2 TYR A 38 ? HIS A 49 ? TYR A 39 HIS A 50 AA1 3 ALA A 75 ? VAL A 80 ? ALA A 76 VAL A 81 AA1 4 VAL A 67 ? ASN A 70 ? VAL A 68 ASN A 71 AA2 1 GLY A 178 ? LYS A 186 ? GLY A 179 LYS A 187 AA2 2 VAL A 193 ? HIS A 204 ? VAL A 194 HIS A 205 AA2 3 PHE A 231 ? VAL A 238 ? PHE A 232 VAL A 239 AA2 4 TYR A 222 ? LYS A 228 ? TYR A 223 LYS A 229 AA3 1 GLY D 22 ? LYS D 30 ? GLY D 23 LYS D 31 AA3 2 TYR D 38 ? HIS D 49 ? TYR D 39 HIS D 50 AA3 3 ALA D 75 ? VAL D 80 ? ALA D 76 VAL D 81 AA3 4 VAL D 67 ? ASN D 70 ? VAL D 68 ASN D 71 AA4 1 CYS D 179 ? LYS D 186 ? CYS D 180 LYS D 187 AA4 2 VAL D 193 ? HIS D 204 ? VAL D 194 HIS D 205 AA4 3 PHE D 231 ? VAL D 238 ? PHE D 232 VAL D 239 AA4 4 TYR D 222 ? LYS D 228 ? TYR D 223 LYS D 229 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 27 ? N ARG A 28 O GLU A 41 ? O GLU A 42 AA1 2 3 N LEU A 48 ? N LEU A 49 O VAL A 76 ? O VAL A 77 AA1 3 4 O SER A 77 ? O SER A 78 N ALA A 69 ? N ALA A 70 AA2 1 2 N ILE A 185 ? N ILE A 186 O GLN A 194 ? O GLN A 195 AA2 2 3 N GLN A 203 ? N GLN A 204 O LEU A 234 ? O LEU A 235 AA2 3 4 O VAL A 237 ? O VAL A 238 N TYR A 222 ? N TYR A 223 AA3 1 2 N LEU D 25 ? N LEU D 26 O GLY D 43 ? O GLY D 44 AA3 2 3 N ILE D 46 ? N ILE D 47 O LEU D 78 ? O LEU D 79 AA3 3 4 O LYS D 79 ? O LYS D 80 N VAL D 67 ? N VAL D 68 AA4 1 2 N ILE D 185 ? N ILE D 186 O GLN D 194 ? O GLN D 195 AA4 2 3 N ILE D 201 ? N ILE D 202 O PHE D 236 ? O PHE D 237 AA4 3 4 O PHE D 231 ? O PHE D 232 N LYS D 228 ? N LYS D 229 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 401 ? 5 'binding site for residue CA A 401' AC2 Software A CA 402 ? 5 'binding site for residue CA A 402' AC3 Software A CA 403 ? 6 'binding site for residue CA A 403' AC4 Software D CA 401 ? 6 'binding site for residue CA D 401' AC5 Software D CA 402 ? 6 'binding site for residue CA D 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ALA A 20 ? ALA A 21 . ? 1_555 ? 2 AC1 5 GLU A 177 ? GLU A 178 . ? 1_555 ? 3 AC1 5 HOH L . ? HOH A 504 . ? 1_555 ? 4 AC1 5 DC B 16 ? DC B 14 . ? 1_555 ? 5 AC1 5 DA C 17 ? DA C 16 . ? 1_555 ? 6 AC2 5 GLU A 21 ? GLU A 22 . ? 1_555 ? 7 AC2 5 GLY A 176 ? GLY A 177 . ? 1_555 ? 8 AC2 5 HOH L . ? HOH A 505 . ? 1_555 ? 9 AC2 5 DA B 17 ? DA B 15 . ? 1_555 ? 10 AC2 5 DT C 16 ? DT C 15 . ? 1_555 ? 11 AC3 6 GLU A 21 ? GLU A 22 . ? 1_555 ? 12 AC3 6 GLU A 177 ? GLU A 178 . ? 1_555 ? 13 AC3 6 DC B 16 ? DC B 14 . ? 1_555 ? 14 AC3 6 DA B 17 ? DA B 15 . ? 1_555 ? 15 AC3 6 DT C 16 ? DT C 15 . ? 1_555 ? 16 AC3 6 DA C 17 ? DA C 16 . ? 1_555 ? 17 AC4 6 ALA D 20 ? ALA D 21 . ? 1_555 ? 18 AC4 6 GLU D 177 ? GLU D 178 . ? 1_555 ? 19 AC4 6 HOH O . ? HOH D 503 . ? 1_555 ? 20 AC4 6 DC E 16 ? DC E 14 . ? 1_555 ? 21 AC4 6 HOH P . ? HOH E 101 . ? 1_555 ? 22 AC4 6 DA F 17 ? DA F 16 . ? 1_555 ? 23 AC5 6 GLU D 21 ? GLU D 22 . ? 1_555 ? 24 AC5 6 GLY D 176 ? GLY D 177 . ? 1_555 ? 25 AC5 6 HOH O . ? HOH D 504 . ? 1_555 ? 26 AC5 6 HOH O . ? HOH D 509 . ? 1_555 ? 27 AC5 6 DA E 17 ? DA E 15 . ? 1_555 ? 28 AC5 6 DT F 16 ? DT F 15 . ? 1_555 ? # _atom_sites.entry_id 6UVW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013258 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012157 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005974 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 2 ? ? ? A . n A 1 2 ALA 2 3 ? ? ? A . n A 1 3 SER 3 4 ? ? ? A . n A 1 4 SER 4 5 ? ? ? A . n A 1 5 ARG 5 6 ? ? ? A . n A 1 6 ARG 6 7 ? ? ? A . n A 1 7 GLU 7 8 ? ? ? A . n A 1 8 SER 8 9 9 SER SER A . n A 1 9 ILE 9 10 10 ILE ILE A . n A 1 10 ASN 10 11 11 ASN ASN A . n A 1 11 PRO 11 12 12 PRO PRO A . n A 1 12 TRP 12 13 13 TRP TRP A . n A 1 13 ILE 13 14 14 ILE ILE A . n A 1 14 LEU 14 15 15 LEU LEU A . n A 1 15 THR 15 16 16 THR THR A . n A 1 16 GLY 16 17 17 GLY GLY A . n A 1 17 PHE 17 18 18 PHE PHE A . n A 1 18 ALA 18 19 19 ALA ALA A . n A 1 19 ASP 19 20 20 ASP ASP A . n A 1 20 ALA 20 21 21 ALA ALA A . n A 1 21 GLU 21 22 22 GLU GLU A . n A 1 22 GLY 22 23 23 GLY GLY A . n A 1 23 SER 23 24 24 SER SER A . n A 1 24 PHE 24 25 25 PHE PHE A . n A 1 25 LEU 25 26 26 LEU LEU A . n A 1 26 LEU 26 27 27 LEU LEU A . n A 1 27 ARG 27 28 28 ARG ARG A . n A 1 28 ILE 28 29 29 ILE ILE A . n A 1 29 ARG 29 30 30 ARG ARG A . n A 1 30 LYS 30 31 31 LYS LYS A . n A 1 31 ASN 31 32 32 ASN ASN A . n A 1 32 ASN 32 33 33 ASN ASN A . n A 1 33 LYS 33 34 34 LYS LYS A . n A 1 34 SER 34 35 35 SER SER A . n A 1 35 SER 35 36 36 SER SER A . n A 1 36 VAL 36 37 37 VAL VAL A . n A 1 37 GLY 37 38 38 GLY GLY A . n A 1 38 TYR 38 39 39 TYR TYR A . n A 1 39 SER 39 40 40 SER SER A . n A 1 40 THR 40 41 41 THR THR A . n A 1 41 GLU 41 42 42 GLU GLU A . n A 1 42 LEU 42 43 43 LEU LEU A . n A 1 43 GLY 43 44 44 GLY GLY A . n A 1 44 PHE 44 45 45 PHE PHE A . n A 1 45 GLN 45 46 46 GLN GLN A . n A 1 46 ILE 46 47 47 ILE ILE A . n A 1 47 THR 47 48 48 THR THR A . n A 1 48 LEU 48 49 49 LEU LEU A . n A 1 49 HIS 49 50 50 HIS HIS A . n A 1 50 ASN 50 51 51 ASN ASN A . n A 1 51 LYS 51 52 52 LYS LYS A . n A 1 52 ASP 52 53 53 ASP ASP A . n A 1 53 LYS 53 54 54 LYS LYS A . n A 1 54 SER 54 55 55 SER SER A . n A 1 55 ILE 55 56 56 ILE ILE A . n A 1 56 LEU 56 57 57 LEU LEU A . n A 1 57 GLU 57 58 58 GLU GLU A . n A 1 58 ASN 58 59 59 ASN ASN A . n A 1 59 ILE 59 60 60 ILE ILE A . n A 1 60 GLN 60 61 61 GLN GLN A . n A 1 61 SER 61 62 62 SER SER A . n A 1 62 THR 62 63 63 THR THR A . n A 1 63 TRP 63 64 64 TRP TRP A . n A 1 64 GLY 64 65 65 GLY GLY A . n A 1 65 VAL 65 66 66 VAL VAL A . n A 1 66 GLY 66 67 67 GLY GLY A . n A 1 67 VAL 67 68 68 VAL VAL A . n A 1 68 ILE 68 69 69 ILE ILE A . n A 1 69 ALA 69 70 70 ALA ALA A . n A 1 70 ASN 70 71 71 ASN ASN A . n A 1 71 SER 71 72 72 SER SER A . n A 1 72 GLY 72 73 73 GLY GLY A . n A 1 73 ASP 73 74 74 ASP ASP A . n A 1 74 ASN 74 75 75 ASN ASN A . n A 1 75 ALA 75 76 76 ALA ALA A . n A 1 76 VAL 76 77 77 VAL VAL A . n A 1 77 SER 77 78 78 SER SER A . n A 1 78 LEU 78 79 79 LEU LEU A . n A 1 79 LYS 79 80 80 LYS LYS A . n A 1 80 VAL 80 81 81 VAL VAL A . n A 1 81 THR 81 82 82 THR THR A . n A 1 82 ARG 82 83 83 ARG ARG A . n A 1 83 PHE 83 84 84 PHE PHE A . n A 1 84 GLU 84 85 85 GLU GLU A . n A 1 85 ASP 85 86 86 ASP ASP A . n A 1 86 LEU 86 87 87 LEU LEU A . n A 1 87 LYS 87 88 88 LYS LYS A . n A 1 88 VAL 88 89 89 VAL VAL A . n A 1 89 ILE 89 90 90 ILE ILE A . n A 1 90 ILE 90 91 91 ILE ILE A . n A 1 91 ASP 91 92 92 ASP ASP A . n A 1 92 HIS 92 93 93 HIS HIS A . n A 1 93 PHE 93 94 94 PHE PHE A . n A 1 94 GLU 94 95 95 GLU GLU A . n A 1 95 LYS 95 96 96 LYS LYS A . n A 1 96 TYR 96 97 97 TYR TYR A . n A 1 97 PRO 97 98 98 PRO PRO A . n A 1 98 LEU 98 99 99 LEU LEU A . n A 1 99 ILE 99 100 100 ILE ILE A . n A 1 100 THR 100 101 101 THR THR A . n A 1 101 GLN 101 102 102 GLN GLN A . n A 1 102 LYS 102 103 103 LYS LYS A . n A 1 103 TYR 103 104 104 TYR TYR A . n A 1 104 ALA 104 105 105 ALA ALA A . n A 1 105 ASP 105 106 106 ASP ASP A . n A 1 106 TYR 106 107 107 TYR TYR A . n A 1 107 MET 107 108 108 MET MET A . n A 1 108 LEU 108 109 109 LEU LEU A . n A 1 109 PHE 109 110 110 PHE PHE A . n A 1 110 LYS 110 111 111 LYS LYS A . n A 1 111 GLN 111 112 112 GLN GLN A . n A 1 112 ALA 112 113 113 ALA ALA A . n A 1 113 PHE 113 114 114 PHE PHE A . n A 1 114 ASN 114 115 115 ASN ASN A . n A 1 115 VAL 115 116 116 VAL VAL A . n A 1 116 MET 116 117 117 MET MET A . n A 1 117 GLU 117 118 118 GLU GLU A . n A 1 118 ASN 118 119 119 ASN ASN A . n A 1 119 LYS 119 120 120 LYS LYS A . n A 1 120 GLU 120 121 121 GLU GLU A . n A 1 121 HIS 121 122 122 HIS HIS A . n A 1 122 LEU 122 123 123 LEU LEU A . n A 1 123 THR 123 124 124 THR THR A . n A 1 124 ILE 124 125 125 ILE ILE A . n A 1 125 GLU 125 126 126 GLU GLU A . n A 1 126 GLY 126 127 127 GLY GLY A . n A 1 127 ILE 127 128 128 ILE ILE A . n A 1 128 LYS 128 129 129 LYS LYS A . n A 1 129 GLU 129 130 130 GLU GLU A . n A 1 130 LEU 130 131 131 LEU LEU A . n A 1 131 VAL 131 132 132 VAL VAL A . n A 1 132 ARG 132 133 133 ARG ARG A . n A 1 133 ILE 133 134 134 ILE ILE A . n A 1 134 LYS 134 135 135 LYS LYS A . n A 1 135 ALA 135 136 136 ALA ALA A . n A 1 136 LYS 136 137 137 LYS LYS A . n A 1 137 LEU 137 138 138 LEU LEU A . n A 1 138 ASN 138 139 139 ASN ASN A . n A 1 139 TRP 139 140 140 TRP TRP A . n A 1 140 GLY 140 141 141 GLY GLY A . n A 1 141 LEU 141 142 142 LEU LEU A . n A 1 142 THR 142 143 143 THR THR A . n A 1 143 ASP 143 144 144 ASP ASP A . n A 1 144 GLU 144 145 145 GLU GLU A . n A 1 145 LEU 145 146 146 LEU LEU A . n A 1 146 LYS 146 147 147 LYS LYS A . n A 1 147 LYS 147 148 148 LYS LYS A . n A 1 148 ALA 148 149 149 ALA ALA A . n A 1 149 PHE 149 150 150 PHE PHE A . n A 1 150 PRO 150 151 151 PRO PRO A . n A 1 151 GLU 151 152 152 GLU GLU A . n A 1 152 ILE 152 153 153 ILE ILE A . n A 1 153 ILE 153 154 154 ILE ILE A . n A 1 154 SER 154 155 155 SER SER A . n A 1 155 LYS 155 156 156 LYS LYS A . n A 1 156 GLU 156 157 157 GLU GLU A . n A 1 157 ARG 157 158 158 ARG ARG A . n A 1 158 SER 158 159 159 SER SER A . n A 1 159 LEU 159 160 160 LEU LEU A . n A 1 160 ILE 160 161 161 ILE ILE A . n A 1 161 ASN 161 162 162 ASN ASN A . n A 1 162 LYS 162 163 163 LYS LYS A . n A 1 163 ASN 163 164 164 ASN ASN A . n A 1 164 ILE 164 165 165 ILE ILE A . n A 1 165 PRO 165 166 166 PRO PRO A . n A 1 166 ASN 166 167 167 ASN ASN A . n A 1 167 PHE 167 168 168 PHE PHE A . n A 1 168 LYS 168 169 169 LYS LYS A . n A 1 169 TRP 169 170 170 TRP TRP A . n A 1 170 LEU 170 171 171 LEU LEU A . n A 1 171 ALA 171 172 172 ALA ALA A . n A 1 172 GLY 172 173 173 GLY GLY A . n A 1 173 PHE 173 174 174 PHE PHE A . n A 1 174 THR 174 175 175 THR THR A . n A 1 175 SER 175 176 176 SER SER A . n A 1 176 GLY 176 177 177 GLY GLY A . n A 1 177 GLU 177 178 178 GLU GLU A . n A 1 178 GLY 178 179 179 GLY GLY A . n A 1 179 CYS 179 180 180 CYS CYS A . n A 1 180 PHE 180 181 181 PHE PHE A . n A 1 181 PHE 181 182 182 PHE PHE A . n A 1 182 VAL 182 183 183 VAL VAL A . n A 1 183 ASN 183 184 184 ASN ASN A . n A 1 184 LEU 184 185 185 LEU LEU A . n A 1 185 ILE 185 186 186 ILE ILE A . n A 1 186 LYS 186 187 187 LYS LYS A . n A 1 187 SER 187 188 188 SER SER A . n A 1 188 LYS 188 189 189 LYS LYS A . n A 1 189 SER 189 190 190 SER SER A . n A 1 190 LYS 190 191 191 LYS LYS A . n A 1 191 LEU 191 192 192 LEU LEU A . n A 1 192 GLY 192 193 193 GLY GLY A . n A 1 193 VAL 193 194 194 VAL VAL A . n A 1 194 GLN 194 195 195 GLN GLN A . n A 1 195 VAL 195 196 196 VAL VAL A . n A 1 196 GLN 196 197 197 GLN GLN A . n A 1 197 LEU 197 198 198 LEU LEU A . n A 1 198 VAL 198 199 199 VAL VAL A . n A 1 199 PHE 199 200 200 PHE PHE A . n A 1 200 SER 200 201 201 SER SER A . n A 1 201 ILE 201 202 202 ILE ILE A . n A 1 202 THR 202 203 203 THR THR A . n A 1 203 GLN 203 204 204 GLN GLN A . n A 1 204 HIS 204 205 205 HIS HIS A . n A 1 205 ILE 205 206 206 ILE ILE A . n A 1 206 ARG 206 207 207 ARG ARG A . n A 1 207 ASP 207 208 208 ASP ASP A . n A 1 208 LYS 208 209 209 LYS LYS A . n A 1 209 ASN 209 210 210 ASN ASN A . n A 1 210 LEU 210 211 211 LEU LEU A . n A 1 211 MET 211 212 212 MET MET A . n A 1 212 ASN 212 213 213 ASN ASN A . n A 1 213 SER 213 214 214 SER SER A . n A 1 214 LEU 214 215 215 LEU LEU A . n A 1 215 ILE 215 216 216 ILE ILE A . n A 1 216 THR 216 217 217 THR THR A . n A 1 217 TYR 217 218 218 TYR TYR A . n A 1 218 LEU 218 219 219 LEU LEU A . n A 1 219 GLY 219 220 220 GLY GLY A . n A 1 220 CYS 220 221 221 CYS CYS A . n A 1 221 GLY 221 222 222 GLY GLY A . n A 1 222 TYR 222 223 223 TYR TYR A . n A 1 223 ILE 223 224 224 ILE ILE A . n A 1 224 LYS 224 225 225 LYS LYS A . n A 1 225 LYS 225 226 226 LYS LYS A . n A 1 226 LYS 226 227 227 LYS LYS A . n A 1 227 ASN 227 228 228 ASN ASN A . n A 1 228 LYS 228 229 229 LYS LYS A . n A 1 229 SER 229 230 230 SER SER A . n A 1 230 GLU 230 231 231 GLU GLU A . n A 1 231 PHE 231 232 232 PHE PHE A . n A 1 232 SER 232 233 233 SER SER A . n A 1 233 TRP 233 234 234 TRP TRP A . n A 1 234 LEU 234 235 235 LEU LEU A . n A 1 235 ASP 235 236 236 ASP ASP A . n A 1 236 PHE 236 237 237 PHE PHE A . n A 1 237 VAL 237 238 238 VAL VAL A . n A 1 238 VAL 238 239 239 VAL VAL A . n A 1 239 THR 239 240 240 THR THR A . n A 1 240 LYS 240 241 241 LYS LYS A . n A 1 241 PHE 241 242 242 PHE PHE A . n A 1 242 SER 242 243 243 SER SER A . n A 1 243 ASP 243 244 244 ASP ASP A . n A 1 244 ILE 244 245 245 ILE ILE A . n A 1 245 ARG 245 246 246 ARG ARG A . n A 1 246 ASP 246 247 247 ASP ASP A . n A 1 247 LYS 247 248 248 LYS LYS A . n A 1 248 ILE 248 249 249 ILE ILE A . n A 1 249 ILE 249 250 250 ILE ILE A . n A 1 250 PRO 250 251 251 PRO PRO A . n A 1 251 PHE 251 252 252 PHE PHE A . n A 1 252 PHE 252 253 253 PHE PHE A . n A 1 253 GLN 253 254 254 GLN GLN A . n A 1 254 GLU 254 255 255 GLU GLU A . n A 1 255 TYR 255 256 256 TYR TYR A . n A 1 256 THR 256 257 257 THR THR A . n A 1 257 LEU 257 258 258 LEU LEU A . n A 1 258 ILE 258 259 259 ILE ILE A . n A 1 259 GLY 259 260 260 GLY GLY A . n A 1 260 THR 260 261 261 THR THR A . n A 1 261 LYS 261 262 262 LYS LYS A . n A 1 262 LEU 262 263 263 LEU LEU A . n A 1 263 LYS 263 264 264 LYS LYS A . n A 1 264 ASP 264 265 265 ASP ASP A . n A 1 265 PHE 265 266 266 PHE PHE A . n A 1 266 GLU 266 267 267 GLU GLU A . n A 1 267 ASP 267 268 268 ASP ASP A . n A 1 268 TRP 268 269 269 TRP TRP A . n A 1 269 CYS 269 270 270 CYS CYS A . n A 1 270 LYS 270 271 271 LYS LYS A . n A 1 271 VAL 271 272 272 VAL VAL A . n A 1 272 ALA 272 273 273 ALA ALA A . n A 1 273 LYS 273 274 274 LYS LYS A . n A 1 274 LEU 274 275 275 LEU LEU A . n A 1 275 ILE 275 276 276 ILE ILE A . n A 1 276 GLU 276 277 277 GLU GLU A . n A 1 277 GLU 277 278 278 GLU GLU A . n A 1 278 LYS 278 279 279 LYS LYS A . n A 1 279 LYS 279 280 280 LYS LYS A . n A 1 280 HIS 280 281 281 HIS HIS A . n A 1 281 LEU 281 282 282 LEU LEU A . n A 1 282 THR 282 283 283 THR THR A . n A 1 283 GLU 283 284 284 GLU GLU A . n A 1 284 GLU 284 285 285 GLU GLU A . n A 1 285 GLY 285 286 286 GLY GLY A . n A 1 286 LEU 286 287 287 LEU LEU A . n A 1 287 ASP 287 288 288 ASP ASP A . n A 1 288 GLU 288 289 289 GLU GLU A . n A 1 289 ILE 289 290 290 ILE ILE A . n A 1 290 LYS 290 291 291 LYS LYS A . n A 1 291 LYS 291 292 292 LYS LYS A . n A 1 292 ILE 292 293 293 ILE ILE A . n A 1 293 LYS 293 294 294 LYS LYS A . n A 1 294 LEU 294 295 295 LEU LEU A . n A 1 295 ASN 295 296 296 ASN ASN A . n A 1 296 MET 296 297 297 MET MET A . n A 1 297 ASN 297 298 298 ASN ASN A . n A 1 298 LYS 298 299 299 LYS LYS A . n A 1 299 GLY 299 300 300 GLY GLY A . n A 1 300 ARG 300 301 301 ARG ARG A . n A 1 301 VAL 301 302 302 VAL VAL A . n A 1 302 PHE 302 303 303 PHE PHE A . n B 2 1 DG 1 -1 -1 DG DG B . n B 2 2 DG 2 0 0 DG DG B . n B 2 3 DG 3 1 1 DG DG B . n B 2 4 DT 4 2 2 DT DT B . n B 2 5 DT 5 3 3 DT DT B . n B 2 6 DT 6 4 4 DT DT B . n B 2 7 DC 7 5 5 DC DC B . n B 2 8 DC 8 6 6 DC DC B . n B 2 9 DA 9 7 7 DA DA B . n B 2 10 DC 10 8 8 DC DC B . n B 2 11 DT 11 9 9 DT DT B . n B 2 12 DT 12 10 10 DT DT B . n B 2 13 DA 13 11 11 DA DA B . n B 2 14 DT 14 12 12 DT DT B . n B 2 15 DT 15 13 13 DT DT B . n B 2 16 DC 16 14 14 DC DC B . n B 2 17 DA 17 15 15 DA DA B . n B 2 18 DA 18 16 16 DA DA B . n B 2 19 DC 19 17 17 DC DC B . n B 2 20 DC 20 18 18 DC DC B . n B 2 21 DT 21 19 19 DT DT B . n B 2 22 DT 22 20 20 DT DT B . n B 2 23 DT 23 21 21 DT DT B . n B 2 24 DT 24 22 22 DT DT B . n B 2 25 DA 25 23 23 DA DA B . n B 2 26 DG 26 24 24 DG DG B . n B 2 27 DG 27 25 25 DG DG B . n C 3 1 DC 1 0 0 DC DC C . n C 3 2 DC 2 1 1 DC DC C . n C 3 3 DC 3 2 2 DC DC C . n C 3 4 DT 4 3 3 DT DT C . n C 3 5 DA 5 4 4 DA DA C . n C 3 6 DA 6 5 5 DA DA C . n C 3 7 DA 7 6 6 DA DA C . n C 3 8 DA 8 7 7 DA DA C . n C 3 9 DG 9 8 8 DG DG C . n C 3 10 DG 10 9 9 DG DG C . n C 3 11 DT 11 10 10 DT DT C . n C 3 12 DT 12 11 11 DT DT C . n C 3 13 DG 13 12 12 DG DG C . n C 3 14 DA 14 13 13 DA DA C . n C 3 15 DA 15 14 14 DA DA C . n C 3 16 DT 16 15 15 DT DT C . n C 3 17 DA 17 16 16 DA DA C . n C 3 18 DA 18 17 17 DA DA C . n C 3 19 DG 19 18 18 DG DG C . n C 3 20 DT 20 19 19 DT DT C . n C 3 21 DG 21 20 20 DG DG C . n C 3 22 DG 22 21 21 DG DG C . n C 3 23 DA 23 22 22 DA DA C . n C 3 24 DA 24 23 23 DA DA C . n C 3 25 DA 25 24 24 DA DA C . n C 3 26 DC 26 25 25 DC DC C . n C 3 27 DC 27 26 26 DC DC C . n D 1 1 MET 1 2 ? ? ? D . n D 1 2 ALA 2 3 ? ? ? D . n D 1 3 SER 3 4 ? ? ? D . n D 1 4 SER 4 5 ? ? ? D . n D 1 5 ARG 5 6 ? ? ? D . n D 1 6 ARG 6 7 7 ARG ARG D . n D 1 7 GLU 7 8 8 GLU GLU D . n D 1 8 SER 8 9 9 SER SER D . n D 1 9 ILE 9 10 10 ILE ILE D . n D 1 10 ASN 10 11 11 ASN ASN D . n D 1 11 PRO 11 12 12 PRO PRO D . n D 1 12 TRP 12 13 13 TRP TRP D . n D 1 13 ILE 13 14 14 ILE ILE D . n D 1 14 LEU 14 15 15 LEU LEU D . n D 1 15 THR 15 16 16 THR THR D . n D 1 16 GLY 16 17 17 GLY GLY D . n D 1 17 PHE 17 18 18 PHE PHE D . n D 1 18 ALA 18 19 19 ALA ALA D . n D 1 19 ASP 19 20 20 ASP ASP D . n D 1 20 ALA 20 21 21 ALA ALA D . n D 1 21 GLU 21 22 22 GLU GLU D . n D 1 22 GLY 22 23 23 GLY GLY D . n D 1 23 SER 23 24 24 SER SER D . n D 1 24 PHE 24 25 25 PHE PHE D . n D 1 25 LEU 25 26 26 LEU LEU D . n D 1 26 LEU 26 27 27 LEU LEU D . n D 1 27 ARG 27 28 28 ARG ARG D . n D 1 28 ILE 28 29 29 ILE ILE D . n D 1 29 ARG 29 30 30 ARG ARG D . n D 1 30 LYS 30 31 31 LYS LYS D . n D 1 31 ASN 31 32 32 ASN ASN D . n D 1 32 ASN 32 33 33 ASN ASN D . n D 1 33 LYS 33 34 34 LYS LYS D . n D 1 34 SER 34 35 35 SER SER D . n D 1 35 SER 35 36 36 SER SER D . n D 1 36 VAL 36 37 37 VAL VAL D . n D 1 37 GLY 37 38 38 GLY GLY D . n D 1 38 TYR 38 39 39 TYR TYR D . n D 1 39 SER 39 40 40 SER SER D . n D 1 40 THR 40 41 41 THR THR D . n D 1 41 GLU 41 42 42 GLU GLU D . n D 1 42 LEU 42 43 43 LEU LEU D . n D 1 43 GLY 43 44 44 GLY GLY D . n D 1 44 PHE 44 45 45 PHE PHE D . n D 1 45 GLN 45 46 46 GLN GLN D . n D 1 46 ILE 46 47 47 ILE ILE D . n D 1 47 THR 47 48 48 THR THR D . n D 1 48 LEU 48 49 49 LEU LEU D . n D 1 49 HIS 49 50 50 HIS HIS D . n D 1 50 ASN 50 51 51 ASN ASN D . n D 1 51 LYS 51 52 52 LYS LYS D . n D 1 52 ASP 52 53 53 ASP ASP D . n D 1 53 LYS 53 54 54 LYS LYS D . n D 1 54 SER 54 55 55 SER SER D . n D 1 55 ILE 55 56 56 ILE ILE D . n D 1 56 LEU 56 57 57 LEU LEU D . n D 1 57 GLU 57 58 58 GLU GLU D . n D 1 58 ASN 58 59 59 ASN ASN D . n D 1 59 ILE 59 60 60 ILE ILE D . n D 1 60 GLN 60 61 61 GLN GLN D . n D 1 61 SER 61 62 62 SER SER D . n D 1 62 THR 62 63 63 THR THR D . n D 1 63 TRP 63 64 64 TRP TRP D . n D 1 64 GLY 64 65 65 GLY GLY D . n D 1 65 VAL 65 66 66 VAL VAL D . n D 1 66 GLY 66 67 67 GLY GLY D . n D 1 67 VAL 67 68 68 VAL VAL D . n D 1 68 ILE 68 69 69 ILE ILE D . n D 1 69 ALA 69 70 70 ALA ALA D . n D 1 70 ASN 70 71 71 ASN ASN D . n D 1 71 SER 71 72 72 SER SER D . n D 1 72 GLY 72 73 73 GLY GLY D . n D 1 73 ASP 73 74 74 ASP ASP D . n D 1 74 ASN 74 75 75 ASN ASN D . n D 1 75 ALA 75 76 76 ALA ALA D . n D 1 76 VAL 76 77 77 VAL VAL D . n D 1 77 SER 77 78 78 SER SER D . n D 1 78 LEU 78 79 79 LEU LEU D . n D 1 79 LYS 79 80 80 LYS LYS D . n D 1 80 VAL 80 81 81 VAL VAL D . n D 1 81 THR 81 82 82 THR THR D . n D 1 82 ARG 82 83 83 ARG ARG D . n D 1 83 PHE 83 84 84 PHE PHE D . n D 1 84 GLU 84 85 85 GLU GLU D . n D 1 85 ASP 85 86 86 ASP ASP D . n D 1 86 LEU 86 87 87 LEU LEU D . n D 1 87 LYS 87 88 88 LYS LYS D . n D 1 88 VAL 88 89 89 VAL VAL D . n D 1 89 ILE 89 90 90 ILE ILE D . n D 1 90 ILE 90 91 91 ILE ILE D . n D 1 91 ASP 91 92 92 ASP ASP D . n D 1 92 HIS 92 93 93 HIS HIS D . n D 1 93 PHE 93 94 94 PHE PHE D . n D 1 94 GLU 94 95 95 GLU GLU D . n D 1 95 LYS 95 96 96 LYS LYS D . n D 1 96 TYR 96 97 97 TYR TYR D . n D 1 97 PRO 97 98 98 PRO PRO D . n D 1 98 LEU 98 99 99 LEU LEU D . n D 1 99 ILE 99 100 100 ILE ILE D . n D 1 100 THR 100 101 101 THR THR D . n D 1 101 GLN 101 102 102 GLN GLN D . n D 1 102 LYS 102 103 103 LYS LYS D . n D 1 103 TYR 103 104 104 TYR TYR D . n D 1 104 ALA 104 105 105 ALA ALA D . n D 1 105 ASP 105 106 106 ASP ASP D . n D 1 106 TYR 106 107 107 TYR TYR D . n D 1 107 MET 107 108 108 MET MET D . n D 1 108 LEU 108 109 109 LEU LEU D . n D 1 109 PHE 109 110 110 PHE PHE D . n D 1 110 LYS 110 111 111 LYS LYS D . n D 1 111 GLN 111 112 112 GLN GLN D . n D 1 112 ALA 112 113 113 ALA ALA D . n D 1 113 PHE 113 114 114 PHE PHE D . n D 1 114 ASN 114 115 115 ASN ASN D . n D 1 115 VAL 115 116 116 VAL VAL D . n D 1 116 MET 116 117 117 MET MET D . n D 1 117 GLU 117 118 118 GLU GLU D . n D 1 118 ASN 118 119 119 ASN ASN D . n D 1 119 LYS 119 120 120 LYS LYS D . n D 1 120 GLU 120 121 121 GLU GLU D . n D 1 121 HIS 121 122 122 HIS HIS D . n D 1 122 LEU 122 123 123 LEU LEU D . n D 1 123 THR 123 124 124 THR THR D . n D 1 124 ILE 124 125 125 ILE ILE D . n D 1 125 GLU 125 126 126 GLU GLU D . n D 1 126 GLY 126 127 127 GLY GLY D . n D 1 127 ILE 127 128 128 ILE ILE D . n D 1 128 LYS 128 129 129 LYS LYS D . n D 1 129 GLU 129 130 130 GLU GLU D . n D 1 130 LEU 130 131 131 LEU LEU D . n D 1 131 VAL 131 132 132 VAL VAL D . n D 1 132 ARG 132 133 133 ARG ARG D . n D 1 133 ILE 133 134 134 ILE ILE D . n D 1 134 LYS 134 135 135 LYS LYS D . n D 1 135 ALA 135 136 136 ALA ALA D . n D 1 136 LYS 136 137 137 LYS LYS D . n D 1 137 LEU 137 138 138 LEU LEU D . n D 1 138 ASN 138 139 139 ASN ASN D . n D 1 139 TRP 139 140 140 TRP TRP D . n D 1 140 GLY 140 141 141 GLY GLY D . n D 1 141 LEU 141 142 142 LEU LEU D . n D 1 142 THR 142 143 143 THR THR D . n D 1 143 ASP 143 144 144 ASP ASP D . n D 1 144 GLU 144 145 145 GLU GLU D . n D 1 145 LEU 145 146 146 LEU LEU D . n D 1 146 LYS 146 147 147 LYS LYS D . n D 1 147 LYS 147 148 148 LYS LYS D . n D 1 148 ALA 148 149 149 ALA ALA D . n D 1 149 PHE 149 150 150 PHE PHE D . n D 1 150 PRO 150 151 151 PRO PRO D . n D 1 151 GLU 151 152 152 GLU GLU D . n D 1 152 ILE 152 153 153 ILE ILE D . n D 1 153 ILE 153 154 ? ? ? D . n D 1 154 SER 154 155 155 SER SER D . n D 1 155 LYS 155 156 156 LYS LYS D . n D 1 156 GLU 156 157 157 GLU GLU D . n D 1 157 ARG 157 158 158 ARG ARG D . n D 1 158 SER 158 159 159 SER SER D . n D 1 159 LEU 159 160 160 LEU LEU D . n D 1 160 ILE 160 161 161 ILE ILE D . n D 1 161 ASN 161 162 162 ASN ASN D . n D 1 162 LYS 162 163 163 LYS LYS D . n D 1 163 ASN 163 164 164 ASN ASN D . n D 1 164 ILE 164 165 165 ILE ILE D . n D 1 165 PRO 165 166 166 PRO PRO D . n D 1 166 ASN 166 167 167 ASN ASN D . n D 1 167 PHE 167 168 168 PHE PHE D . n D 1 168 LYS 168 169 169 LYS LYS D . n D 1 169 TRP 169 170 170 TRP TRP D . n D 1 170 LEU 170 171 171 LEU LEU D . n D 1 171 ALA 171 172 172 ALA ALA D . n D 1 172 GLY 172 173 173 GLY GLY D . n D 1 173 PHE 173 174 174 PHE PHE D . n D 1 174 THR 174 175 175 THR THR D . n D 1 175 SER 175 176 176 SER SER D . n D 1 176 GLY 176 177 177 GLY GLY D . n D 1 177 GLU 177 178 178 GLU GLU D . n D 1 178 GLY 178 179 179 GLY GLY D . n D 1 179 CYS 179 180 180 CYS CYS D . n D 1 180 PHE 180 181 181 PHE PHE D . n D 1 181 PHE 181 182 182 PHE PHE D . n D 1 182 VAL 182 183 183 VAL VAL D . n D 1 183 ASN 183 184 184 ASN ASN D . n D 1 184 LEU 184 185 185 LEU LEU D . n D 1 185 ILE 185 186 186 ILE ILE D . n D 1 186 LYS 186 187 187 LYS LYS D . n D 1 187 SER 187 188 188 SER SER D . n D 1 188 LYS 188 189 189 LYS LYS D . n D 1 189 SER 189 190 190 SER SER D . n D 1 190 LYS 190 191 191 LYS LYS D . n D 1 191 LEU 191 192 192 LEU LEU D . n D 1 192 GLY 192 193 193 GLY GLY D . n D 1 193 VAL 193 194 194 VAL VAL D . n D 1 194 GLN 194 195 195 GLN GLN D . n D 1 195 VAL 195 196 196 VAL VAL D . n D 1 196 GLN 196 197 197 GLN GLN D . n D 1 197 LEU 197 198 198 LEU LEU D . n D 1 198 VAL 198 199 199 VAL VAL D . n D 1 199 PHE 199 200 200 PHE PHE D . n D 1 200 SER 200 201 201 SER SER D . n D 1 201 ILE 201 202 202 ILE ILE D . n D 1 202 THR 202 203 203 THR THR D . n D 1 203 GLN 203 204 204 GLN GLN D . n D 1 204 HIS 204 205 205 HIS HIS D . n D 1 205 ILE 205 206 206 ILE ILE D . n D 1 206 ARG 206 207 207 ARG ARG D . n D 1 207 ASP 207 208 208 ASP ASP D . n D 1 208 LYS 208 209 209 LYS LYS D . n D 1 209 ASN 209 210 210 ASN ASN D . n D 1 210 LEU 210 211 211 LEU LEU D . n D 1 211 MET 211 212 212 MET MET D . n D 1 212 ASN 212 213 213 ASN ASN D . n D 1 213 SER 213 214 214 SER SER D . n D 1 214 LEU 214 215 215 LEU LEU D . n D 1 215 ILE 215 216 216 ILE ILE D . n D 1 216 THR 216 217 217 THR THR D . n D 1 217 TYR 217 218 218 TYR TYR D . n D 1 218 LEU 218 219 219 LEU LEU D . n D 1 219 GLY 219 220 220 GLY GLY D . n D 1 220 CYS 220 221 221 CYS CYS D . n D 1 221 GLY 221 222 222 GLY GLY D . n D 1 222 TYR 222 223 223 TYR TYR D . n D 1 223 ILE 223 224 224 ILE ILE D . n D 1 224 LYS 224 225 225 LYS LYS D . n D 1 225 LYS 225 226 226 LYS LYS D . n D 1 226 LYS 226 227 227 LYS LYS D . n D 1 227 ASN 227 228 228 ASN ASN D . n D 1 228 LYS 228 229 229 LYS LYS D . n D 1 229 SER 229 230 230 SER SER D . n D 1 230 GLU 230 231 231 GLU GLU D . n D 1 231 PHE 231 232 232 PHE PHE D . n D 1 232 SER 232 233 233 SER SER D . n D 1 233 TRP 233 234 234 TRP TRP D . n D 1 234 LEU 234 235 235 LEU LEU D . n D 1 235 ASP 235 236 236 ASP ASP D . n D 1 236 PHE 236 237 237 PHE PHE D . n D 1 237 VAL 237 238 238 VAL VAL D . n D 1 238 VAL 238 239 239 VAL VAL D . n D 1 239 THR 239 240 240 THR THR D . n D 1 240 LYS 240 241 241 LYS LYS D . n D 1 241 PHE 241 242 242 PHE PHE D . n D 1 242 SER 242 243 243 SER SER D . n D 1 243 ASP 243 244 244 ASP ASP D . n D 1 244 ILE 244 245 245 ILE ILE D . n D 1 245 ARG 245 246 246 ARG ARG D . n D 1 246 ASP 246 247 247 ASP ASP D . n D 1 247 LYS 247 248 248 LYS LYS D . n D 1 248 ILE 248 249 249 ILE ILE D . n D 1 249 ILE 249 250 250 ILE ILE D . n D 1 250 PRO 250 251 251 PRO PRO D . n D 1 251 PHE 251 252 252 PHE PHE D . n D 1 252 PHE 252 253 253 PHE PHE D . n D 1 253 GLN 253 254 254 GLN GLN D . n D 1 254 GLU 254 255 255 GLU GLU D . n D 1 255 TYR 255 256 256 TYR TYR D . n D 1 256 THR 256 257 257 THR THR D . n D 1 257 LEU 257 258 258 LEU LEU D . n D 1 258 ILE 258 259 259 ILE ILE D . n D 1 259 GLY 259 260 260 GLY GLY D . n D 1 260 THR 260 261 261 THR THR D . n D 1 261 LYS 261 262 262 LYS LYS D . n D 1 262 LEU 262 263 263 LEU LEU D . n D 1 263 LYS 263 264 264 LYS LYS D . n D 1 264 ASP 264 265 265 ASP ASP D . n D 1 265 PHE 265 266 266 PHE PHE D . n D 1 266 GLU 266 267 267 GLU GLU D . n D 1 267 ASP 267 268 268 ASP ASP D . n D 1 268 TRP 268 269 269 TRP TRP D . n D 1 269 CYS 269 270 270 CYS CYS D . n D 1 270 LYS 270 271 271 LYS LYS D . n D 1 271 VAL 271 272 272 VAL VAL D . n D 1 272 ALA 272 273 273 ALA ALA D . n D 1 273 LYS 273 274 274 LYS LYS D . n D 1 274 LEU 274 275 275 LEU LEU D . n D 1 275 ILE 275 276 276 ILE ILE D . n D 1 276 GLU 276 277 277 GLU GLU D . n D 1 277 GLU 277 278 278 GLU GLU D . n D 1 278 LYS 278 279 279 LYS LYS D . n D 1 279 LYS 279 280 280 LYS LYS D . n D 1 280 HIS 280 281 281 HIS HIS D . n D 1 281 LEU 281 282 282 LEU LEU D . n D 1 282 THR 282 283 283 THR THR D . n D 1 283 GLU 283 284 284 GLU GLU D . n D 1 284 GLU 284 285 285 GLU GLU D . n D 1 285 GLY 285 286 286 GLY GLY D . n D 1 286 LEU 286 287 287 LEU LEU D . n D 1 287 ASP 287 288 288 ASP ASP D . n D 1 288 GLU 288 289 289 GLU GLU D . n D 1 289 ILE 289 290 290 ILE ILE D . n D 1 290 LYS 290 291 291 LYS LYS D . n D 1 291 LYS 291 292 292 LYS LYS D . n D 1 292 ILE 292 293 293 ILE ILE D . n D 1 293 LYS 293 294 294 LYS LYS D . n D 1 294 LEU 294 295 295 LEU LEU D . n D 1 295 ASN 295 296 296 ASN ASN D . n D 1 296 MET 296 297 297 MET MET D . n D 1 297 ASN 297 298 298 ASN ASN D . n D 1 298 LYS 298 299 299 LYS LYS D . n D 1 299 GLY 299 300 300 GLY GLY D . n D 1 300 ARG 300 301 301 ARG ARG D . n D 1 301 VAL 301 302 302 VAL VAL D . n D 1 302 PHE 302 303 303 PHE PHE D . n E 2 1 DG 1 -1 -1 DG DG E . n E 2 2 DG 2 0 0 DG DG E . n E 2 3 DG 3 1 1 DG DG E . n E 2 4 DT 4 2 2 DT DT E . n E 2 5 DT 5 3 3 DT DT E . n E 2 6 DT 6 4 4 DT DT E . n E 2 7 DC 7 5 5 DC DC E . n E 2 8 DC 8 6 6 DC DC E . n E 2 9 DA 9 7 7 DA DA E . n E 2 10 DC 10 8 8 DC DC E . n E 2 11 DT 11 9 9 DT DT E . n E 2 12 DT 12 10 10 DT DT E . n E 2 13 DA 13 11 11 DA DA E . n E 2 14 DT 14 12 12 DT DT E . n E 2 15 DT 15 13 13 DT DT E . n E 2 16 DC 16 14 14 DC DC E . n E 2 17 DA 17 15 15 DA DA E . n E 2 18 DA 18 16 16 DA DA E . n E 2 19 DC 19 17 17 DC DC E . n E 2 20 DC 20 18 18 DC DC E . n E 2 21 DT 21 19 19 DT DT E . n E 2 22 DT 22 20 20 DT DT E . n E 2 23 DT 23 21 21 DT DT E . n E 2 24 DT 24 22 22 DT DT E . n E 2 25 DA 25 23 23 DA DA E . n E 2 26 DG 26 24 24 DG DG E . n E 2 27 DG 27 25 25 DG DG E . n F 3 1 DC 1 0 0 DC DC F . n F 3 2 DC 2 1 1 DC DC F . n F 3 3 DC 3 2 2 DC DC F . n F 3 4 DT 4 3 3 DT DT F . n F 3 5 DA 5 4 4 DA DA F . n F 3 6 DA 6 5 5 DA DA F . n F 3 7 DA 7 6 6 DA DA F . n F 3 8 DA 8 7 7 DA DA F . n F 3 9 DG 9 8 8 DG DG F . n F 3 10 DG 10 9 9 DG DG F . n F 3 11 DT 11 10 10 DT DT F . n F 3 12 DT 12 11 11 DT DT F . n F 3 13 DG 13 12 12 DG DG F . n F 3 14 DA 14 13 13 DA DA F . n F 3 15 DA 15 14 14 DA DA F . n F 3 16 DT 16 15 15 DT DT F . n F 3 17 DA 17 16 16 DA DA F . n F 3 18 DA 18 17 17 DA DA F . n F 3 19 DG 19 18 18 DG DG F . n F 3 20 DT 20 19 19 DT DT F . n F 3 21 DG 21 20 20 DG DG F . n F 3 22 DG 22 21 21 DG DG F . n F 3 23 DA 23 22 22 DA DA F . n F 3 24 DA 24 23 23 DA DA F . n F 3 25 DA 25 24 24 DA DA F . n F 3 26 DC 26 25 25 DC DC F . n F 3 27 DC 27 26 26 DC DC F . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code G 4 CA 1 401 2 CA CA A . H 4 CA 1 402 3 CA CA A . I 4 CA 1 403 5 CA CA A . J 4 CA 1 401 1 CA CA D . K 4 CA 1 402 4 CA CA D . L 5 HOH 1 501 4 HOH HOH A . L 5 HOH 2 502 12 HOH HOH A . L 5 HOH 3 503 19 HOH HOH A . L 5 HOH 4 504 6 HOH HOH A . L 5 HOH 5 505 25 HOH HOH A . L 5 HOH 6 506 7 HOH HOH A . L 5 HOH 7 507 20 HOH HOH A . L 5 HOH 8 508 10 HOH HOH A . M 5 HOH 1 101 11 HOH HOH B . M 5 HOH 2 102 13 HOH HOH B . N 5 HOH 1 101 17 HOH HOH C . O 5 HOH 1 501 1 HOH HOH D . O 5 HOH 2 502 8 HOH HOH D . O 5 HOH 3 503 24 HOH HOH D . O 5 HOH 4 504 26 HOH HOH D . O 5 HOH 5 505 9 HOH HOH D . O 5 HOH 6 506 22 HOH HOH D . O 5 HOH 7 507 21 HOH HOH D . O 5 HOH 8 508 15 HOH HOH D . O 5 HOH 9 509 27 HOH HOH D . P 5 HOH 1 101 5 HOH HOH E . Q 5 HOH 1 101 3 HOH HOH F . Q 5 HOH 2 102 23 HOH HOH F . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA trimeric 3 2 author_and_software_defined_assembly PISA trimeric 3 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,G,H,I,L,M,N 2 1 D,E,F,J,K,O,P,Q # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 8930 ? 1 MORE -99 ? 1 'SSA (A^2)' 18320 ? 2 'ABSA (A^2)' 8460 ? 2 MORE -89 ? 2 'SSA (A^2)' 18330 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A ALA 20 ? A ALA 21 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 OE1 ? A GLU 177 ? A GLU 178 ? 1_555 80.8 ? 2 O ? A ALA 20 ? A ALA 21 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 O ? L HOH . ? A HOH 504 ? 1_555 83.7 ? 3 OE1 ? A GLU 177 ? A GLU 178 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 O ? L HOH . ? A HOH 504 ? 1_555 84.0 ? 4 O ? A ALA 20 ? A ALA 21 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 OP1 ? B DC 16 ? B DC 14 ? 1_555 161.9 ? 5 OE1 ? A GLU 177 ? A GLU 178 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 OP1 ? B DC 16 ? B DC 14 ? 1_555 81.8 ? 6 O ? L HOH . ? A HOH 504 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 OP1 ? B DC 16 ? B DC 14 ? 1_555 89.3 ? 7 O ? A ALA 20 ? A ALA 21 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 OP2 ? C DA 17 ? C DA 16 ? 1_555 81.5 ? 8 OE1 ? A GLU 177 ? A GLU 178 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 OP2 ? C DA 17 ? C DA 16 ? 1_555 82.6 ? 9 O ? L HOH . ? A HOH 504 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 OP2 ? C DA 17 ? C DA 16 ? 1_555 161.4 ? 10 OP1 ? B DC 16 ? B DC 14 ? 1_555 CA ? G CA . ? A CA 401 ? 1_555 OP2 ? C DA 17 ? C DA 16 ? 1_555 101.5 ? 11 OE1 ? A GLU 21 ? A GLU 22 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O ? A GLY 176 ? A GLY 177 ? 1_555 89.9 ? 12 OE1 ? A GLU 21 ? A GLU 22 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O ? L HOH . ? A HOH 505 ? 1_555 79.8 ? 13 O ? A GLY 176 ? A GLY 177 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 O ? L HOH . ? A HOH 505 ? 1_555 91.1 ? 14 OE1 ? A GLU 21 ? A GLU 22 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 OP2 ? B DA 17 ? B DA 15 ? 1_555 92.6 ? 15 O ? A GLY 176 ? A GLY 177 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 OP2 ? B DA 17 ? B DA 15 ? 1_555 79.6 ? 16 O ? L HOH . ? A HOH 505 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 OP2 ? B DA 17 ? B DA 15 ? 1_555 168.1 ? 17 OE1 ? A GLU 21 ? A GLU 22 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 OP1 ? C DT 16 ? C DT 15 ? 1_555 89.2 ? 18 O ? A GLY 176 ? A GLY 177 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 OP1 ? C DT 16 ? C DT 15 ? 1_555 175.3 ? 19 O ? L HOH . ? A HOH 505 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 OP1 ? C DT 16 ? C DT 15 ? 1_555 93.2 ? 20 OP2 ? B DA 17 ? B DA 15 ? 1_555 CA ? H CA . ? A CA 402 ? 1_555 OP1 ? C DT 16 ? C DT 15 ? 1_555 95.9 ? 21 OE2 ? A GLU 21 ? A GLU 22 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 OE1 ? A GLU 177 ? A GLU 178 ? 1_555 105.3 ? 22 OE2 ? A GLU 21 ? A GLU 22 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 OE2 ? A GLU 177 ? A GLU 178 ? 1_555 131.7 ? 23 OE1 ? A GLU 177 ? A GLU 178 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 OE2 ? A GLU 177 ? A GLU 178 ? 1_555 44.4 ? 24 OE2 ? A GLU 21 ? A GLU 22 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 "O3'" ? B DC 16 ? B DC 14 ? 1_555 147.8 ? 25 OE1 ? A GLU 177 ? A GLU 178 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 "O3'" ? B DC 16 ? B DC 14 ? 1_555 106.6 ? 26 OE2 ? A GLU 177 ? A GLU 178 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 "O3'" ? B DC 16 ? B DC 14 ? 1_555 76.8 ? 27 OE2 ? A GLU 21 ? A GLU 22 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 OP2 ? B DA 17 ? B DA 15 ? 1_555 103.2 ? 28 OE1 ? A GLU 177 ? A GLU 178 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 OP2 ? B DA 17 ? B DA 15 ? 1_555 136.0 ? 29 OE2 ? A GLU 177 ? A GLU 178 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 OP2 ? B DA 17 ? B DA 15 ? 1_555 91.8 ? 30 "O3'" ? B DC 16 ? B DC 14 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 OP2 ? B DA 17 ? B DA 15 ? 1_555 54.8 ? 31 OE2 ? A GLU 21 ? A GLU 22 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 "O3'" ? C DT 16 ? C DT 15 ? 1_555 75.5 ? 32 OE1 ? A GLU 177 ? A GLU 178 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 "O3'" ? C DT 16 ? C DT 15 ? 1_555 123.5 ? 33 OE2 ? A GLU 177 ? A GLU 178 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 "O3'" ? C DT 16 ? C DT 15 ? 1_555 149.1 ? 34 "O3'" ? B DC 16 ? B DC 14 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 "O3'" ? C DT 16 ? C DT 15 ? 1_555 83.1 ? 35 OP2 ? B DA 17 ? B DA 15 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 "O3'" ? C DT 16 ? C DT 15 ? 1_555 95.6 ? 36 OE2 ? A GLU 21 ? A GLU 22 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 OP2 ? C DA 17 ? C DA 16 ? 1_555 86.3 ? 37 OE1 ? A GLU 177 ? A GLU 178 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 OP2 ? C DA 17 ? C DA 16 ? 1_555 66.4 ? 38 OE2 ? A GLU 177 ? A GLU 178 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 OP2 ? C DA 17 ? C DA 16 ? 1_555 104.2 ? 39 "O3'" ? B DC 16 ? B DC 14 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 OP2 ? C DA 17 ? C DA 16 ? 1_555 102.3 ? 40 OP2 ? B DA 17 ? B DA 15 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 OP2 ? C DA 17 ? C DA 16 ? 1_555 148.5 ? 41 "O3'" ? C DT 16 ? C DT 15 ? 1_555 CA ? I CA . ? A CA 403 ? 1_555 OP2 ? C DA 17 ? C DA 16 ? 1_555 57.3 ? 42 O ? D ALA 20 ? D ALA 21 ? 1_555 CA ? J CA . ? D CA 401 ? 1_555 OE1 ? D GLU 177 ? D GLU 178 ? 1_555 95.6 ? 43 O ? D ALA 20 ? D ALA 21 ? 1_555 CA ? J CA . ? D CA 401 ? 1_555 O ? O HOH . ? D HOH 503 ? 1_555 79.2 ? 44 OE1 ? D GLU 177 ? D GLU 178 ? 1_555 CA ? J CA . ? D CA 401 ? 1_555 O ? O HOH . ? D HOH 503 ? 1_555 77.0 ? 45 O ? D ALA 20 ? D ALA 21 ? 1_555 CA ? J CA . ? D CA 401 ? 1_555 OP1 ? E DC 16 ? E DC 14 ? 1_555 173.1 ? 46 OE1 ? D GLU 177 ? D GLU 178 ? 1_555 CA ? J CA . ? D CA 401 ? 1_555 OP1 ? E DC 16 ? E DC 14 ? 1_555 82.3 ? 47 O ? O HOH . ? D HOH 503 ? 1_555 CA ? J CA . ? D CA 401 ? 1_555 OP1 ? E DC 16 ? E DC 14 ? 1_555 94.0 ? 48 O ? D ALA 20 ? D ALA 21 ? 1_555 CA ? J CA . ? D CA 401 ? 1_555 O ? P HOH . ? E HOH 101 ? 1_555 105.4 ? 49 OE1 ? D GLU 177 ? D GLU 178 ? 1_555 CA ? J CA . ? D CA 401 ? 1_555 O ? P HOH . ? E HOH 101 ? 1_555 158.8 ? 50 O ? O HOH . ? D HOH 503 ? 1_555 CA ? J CA . ? D CA 401 ? 1_555 O ? P HOH . ? E HOH 101 ? 1_555 104.2 ? 51 OP1 ? E DC 16 ? E DC 14 ? 1_555 CA ? J CA . ? D CA 401 ? 1_555 O ? P HOH . ? E HOH 101 ? 1_555 76.5 ? 52 O ? D ALA 20 ? D ALA 21 ? 1_555 CA ? J CA . ? D CA 401 ? 1_555 OP2 ? F DA 17 ? F DA 16 ? 1_555 82.6 ? 53 OE1 ? D GLU 177 ? D GLU 178 ? 1_555 CA ? J CA . ? D CA 401 ? 1_555 OP2 ? F DA 17 ? F DA 16 ? 1_555 97.7 ? 54 O ? O HOH . ? D HOH 503 ? 1_555 CA ? J CA . ? D CA 401 ? 1_555 OP2 ? F DA 17 ? F DA 16 ? 1_555 160.4 ? 55 OP1 ? E DC 16 ? E DC 14 ? 1_555 CA ? J CA . ? D CA 401 ? 1_555 OP2 ? F DA 17 ? F DA 16 ? 1_555 104.1 ? 56 O ? P HOH . ? E HOH 101 ? 1_555 CA ? J CA . ? D CA 401 ? 1_555 OP2 ? F DA 17 ? F DA 16 ? 1_555 87.6 ? 57 OE2 ? D GLU 21 ? D GLU 22 ? 1_555 CA ? K CA . ? D CA 402 ? 1_555 O ? D GLY 176 ? D GLY 177 ? 1_555 85.3 ? 58 OE2 ? D GLU 21 ? D GLU 22 ? 1_555 CA ? K CA . ? D CA 402 ? 1_555 O ? O HOH . ? D HOH 504 ? 1_555 85.0 ? 59 O ? D GLY 176 ? D GLY 177 ? 1_555 CA ? K CA . ? D CA 402 ? 1_555 O ? O HOH . ? D HOH 504 ? 1_555 81.7 ? 60 OE2 ? D GLU 21 ? D GLU 22 ? 1_555 CA ? K CA . ? D CA 402 ? 1_555 O ? O HOH . ? D HOH 509 ? 1_555 163.6 ? 61 O ? D GLY 176 ? D GLY 177 ? 1_555 CA ? K CA . ? D CA 402 ? 1_555 O ? O HOH . ? D HOH 509 ? 1_555 92.8 ? 62 O ? O HOH . ? D HOH 504 ? 1_555 CA ? K CA . ? D CA 402 ? 1_555 O ? O HOH . ? D HOH 509 ? 1_555 78.6 ? 63 OE2 ? D GLU 21 ? D GLU 22 ? 1_555 CA ? K CA . ? D CA 402 ? 1_555 OP2 ? E DA 17 ? E DA 15 ? 1_555 86.3 ? 64 O ? D GLY 176 ? D GLY 177 ? 1_555 CA ? K CA . ? D CA 402 ? 1_555 OP2 ? E DA 17 ? E DA 15 ? 1_555 78.2 ? 65 O ? O HOH . ? D HOH 504 ? 1_555 CA ? K CA . ? D CA 402 ? 1_555 OP2 ? E DA 17 ? E DA 15 ? 1_555 158.6 ? 66 O ? O HOH . ? D HOH 509 ? 1_555 CA ? K CA . ? D CA 402 ? 1_555 OP2 ? E DA 17 ? E DA 15 ? 1_555 109.3 ? 67 OE2 ? D GLU 21 ? D GLU 22 ? 1_555 CA ? K CA . ? D CA 402 ? 1_555 OP1 ? F DT 16 ? F DT 15 ? 1_555 87.1 ? 68 O ? D GLY 176 ? D GLY 177 ? 1_555 CA ? K CA . ? D CA 402 ? 1_555 OP1 ? F DT 16 ? F DT 15 ? 1_555 167.4 ? 69 O ? O HOH . ? D HOH 504 ? 1_555 CA ? K CA . ? D CA 402 ? 1_555 OP1 ? F DT 16 ? F DT 15 ? 1_555 87.6 ? 70 O ? O HOH . ? D HOH 509 ? 1_555 CA ? K CA . ? D CA 402 ? 1_555 OP1 ? F DT 16 ? F DT 15 ? 1_555 91.6 ? 71 OP2 ? E DA 17 ? E DA 15 ? 1_555 CA ? K CA . ? D CA 402 ? 1_555 OP1 ? F DT 16 ? F DT 15 ? 1_555 111.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2019-12-18 2 'Structure model' 1 1 2020-05-13 3 'Structure model' 1 2 2020-07-22 4 'Structure model' 1 3 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model 8 4 'Structure model' pdbx_struct_conn_angle 9 4 'Structure model' struct_conn 10 4 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 4 'Structure model' '_database_2.pdbx_DOI' 14 4 'Structure model' '_database_2.pdbx_database_accession' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id' 23 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 24 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 25 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 26 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 27 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 28 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 29 4 'Structure model' '_pdbx_struct_conn_angle.value' 30 4 'Structure model' '_struct_conn.pdbx_dist_value' 31 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 32 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 33 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 34 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 35 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 36 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 37 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 38 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 39 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 40 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 41 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 42 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 43 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 44 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 45 4 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 46 4 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 47 4 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 48 4 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 49 4 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 50 4 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 51 4 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 52 4 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_phasing_MR.entry_id 6UVW _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 5.460 _pdbx_phasing_MR.d_res_low_rotation 46.310 _pdbx_phasing_MR.d_res_high_translation 5.460 _pdbx_phasing_MR.d_res_low_translation 46.310 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.7.16 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 5 # _pdbx_entry_details.entry_id 6UVW _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 D GLU 178 ? ? O D HOH 501 ? ? 2.15 2 1 OP2 F DA 16 ? ? O D HOH 501 ? ? 2.15 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 "O4'" B DG -1 ? ? "C4'" B DG -1 ? ? "C3'" B DG -1 ? ? 102.05 104.50 -2.45 0.40 N 2 1 "O4'" F DG 18 ? ? "C1'" F DG 18 ? ? N9 F DG 18 ? ? 110.47 108.30 2.17 0.30 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 21 ? ? -72.39 -73.30 2 1 GLU A 22 ? ? -87.64 -153.79 3 1 SER A 72 ? ? -107.26 43.29 4 1 LYS A 120 ? ? 56.37 19.17 5 1 ASN A 139 ? ? 50.67 -125.47 6 1 LYS A 189 ? ? -86.29 33.27 7 1 SER A 230 ? ? 61.57 -125.49 8 1 LYS A 279 ? ? 59.31 15.59 9 1 ASN A 298 ? ? 60.06 -128.60 10 1 GLU D 8 ? ? -169.91 101.95 11 1 ALA D 21 ? ? -72.96 -76.67 12 1 SER D 72 ? ? -103.76 41.47 13 1 LYS D 120 ? ? 56.98 19.57 14 1 ASN D 139 ? ? 50.75 -128.06 15 1 GLU D 157 ? ? -155.36 43.24 16 1 SER D 159 ? ? 179.00 65.16 17 1 LYS D 189 ? ? -86.29 34.43 18 1 SER D 230 ? ? 59.39 -124.39 19 1 LYS D 279 ? ? 59.70 15.00 20 1 ASN D 298 ? ? 57.28 -126.59 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 54 ? CG ? A LYS 53 CG 2 1 Y 1 A LYS 54 ? CD ? A LYS 53 CD 3 1 Y 1 A LYS 54 ? CE ? A LYS 53 CE 4 1 Y 1 A LYS 54 ? NZ ? A LYS 53 NZ 5 1 Y 1 A ASN 59 ? CG ? A ASN 58 CG 6 1 Y 1 A ASN 59 ? OD1 ? A ASN 58 OD1 7 1 Y 1 A ASN 59 ? ND2 ? A ASN 58 ND2 8 1 Y 1 A LYS 96 ? CG ? A LYS 95 CG 9 1 Y 1 A LYS 96 ? CD ? A LYS 95 CD 10 1 Y 1 A LYS 96 ? CE ? A LYS 95 CE 11 1 Y 1 A LYS 96 ? NZ ? A LYS 95 NZ 12 1 Y 1 A GLU 126 ? CG ? A GLU 125 CG 13 1 Y 1 A GLU 126 ? CD ? A GLU 125 CD 14 1 Y 1 A GLU 126 ? OE1 ? A GLU 125 OE1 15 1 Y 1 A GLU 126 ? OE2 ? A GLU 125 OE2 16 1 Y 1 A GLU 145 ? CG ? A GLU 144 CG 17 1 Y 1 A GLU 145 ? CD ? A GLU 144 CD 18 1 Y 1 A GLU 145 ? OE1 ? A GLU 144 OE1 19 1 Y 1 A GLU 145 ? OE2 ? A GLU 144 OE2 20 1 Y 1 A LYS 148 ? CG ? A LYS 147 CG 21 1 Y 1 A LYS 148 ? CD ? A LYS 147 CD 22 1 Y 1 A LYS 148 ? CE ? A LYS 147 CE 23 1 Y 1 A LYS 148 ? NZ ? A LYS 147 NZ 24 1 Y 1 A GLU 152 ? CG ? A GLU 151 CG 25 1 Y 1 A GLU 152 ? CD ? A GLU 151 CD 26 1 Y 1 A GLU 152 ? OE1 ? A GLU 151 OE1 27 1 Y 1 A GLU 152 ? OE2 ? A GLU 151 OE2 28 1 Y 1 A ILE 153 ? CG1 ? A ILE 152 CG1 29 1 Y 1 A ILE 153 ? CG2 ? A ILE 152 CG2 30 1 Y 1 A ILE 153 ? CD1 ? A ILE 152 CD1 31 1 Y 1 A ILE 154 ? CG1 ? A ILE 153 CG1 32 1 Y 1 A ILE 154 ? CG2 ? A ILE 153 CG2 33 1 Y 1 A ILE 154 ? CD1 ? A ILE 153 CD1 34 1 Y 1 A SER 155 ? OG ? A SER 154 OG 35 1 Y 1 A LYS 156 ? CG ? A LYS 155 CG 36 1 Y 1 A LYS 156 ? CD ? A LYS 155 CD 37 1 Y 1 A LYS 156 ? CE ? A LYS 155 CE 38 1 Y 1 A LYS 156 ? NZ ? A LYS 155 NZ 39 1 Y 1 A GLU 157 ? CG ? A GLU 156 CG 40 1 Y 1 A GLU 157 ? CD ? A GLU 156 CD 41 1 Y 1 A GLU 157 ? OE1 ? A GLU 156 OE1 42 1 Y 1 A GLU 157 ? OE2 ? A GLU 156 OE2 43 1 Y 1 A LYS 169 ? CG ? A LYS 168 CG 44 1 Y 1 A LYS 169 ? CD ? A LYS 168 CD 45 1 Y 1 A LYS 169 ? CE ? A LYS 168 CE 46 1 Y 1 A LYS 169 ? NZ ? A LYS 168 NZ 47 1 Y 1 A LYS 187 ? CG ? A LYS 186 CG 48 1 Y 1 A LYS 187 ? CD ? A LYS 186 CD 49 1 Y 1 A LYS 187 ? CE ? A LYS 186 CE 50 1 Y 1 A LYS 187 ? NZ ? A LYS 186 NZ 51 1 Y 1 A SER 188 ? OG ? A SER 187 OG 52 1 Y 1 A LYS 189 ? CG ? A LYS 188 CG 53 1 Y 1 A LYS 189 ? CD ? A LYS 188 CD 54 1 Y 1 A LYS 189 ? CE ? A LYS 188 CE 55 1 Y 1 A LYS 189 ? NZ ? A LYS 188 NZ 56 1 Y 1 A SER 190 ? OG ? A SER 189 OG 57 1 Y 1 A LYS 191 ? CG ? A LYS 190 CG 58 1 Y 1 A LYS 191 ? CD ? A LYS 190 CD 59 1 Y 1 A LYS 191 ? CE ? A LYS 190 CE 60 1 Y 1 A LYS 191 ? NZ ? A LYS 190 NZ 61 1 Y 1 A LYS 209 ? CG ? A LYS 208 CG 62 1 Y 1 A LYS 209 ? CD ? A LYS 208 CD 63 1 Y 1 A LYS 209 ? CE ? A LYS 208 CE 64 1 Y 1 A LYS 209 ? NZ ? A LYS 208 NZ 65 1 Y 1 A LYS 226 ? CG ? A LYS 225 CG 66 1 Y 1 A LYS 226 ? CD ? A LYS 225 CD 67 1 Y 1 A LYS 226 ? CE ? A LYS 225 CE 68 1 Y 1 A LYS 226 ? NZ ? A LYS 225 NZ 69 1 Y 1 A GLN 254 ? CG ? A GLN 253 CG 70 1 Y 1 A GLN 254 ? CD ? A GLN 253 CD 71 1 Y 1 A GLN 254 ? OE1 ? A GLN 253 OE1 72 1 Y 1 A GLN 254 ? NE2 ? A GLN 253 NE2 73 1 Y 1 A THR 257 ? OG1 ? A THR 256 OG1 74 1 Y 1 A THR 257 ? CG2 ? A THR 256 CG2 75 1 Y 1 A LYS 271 ? CG ? A LYS 270 CG 76 1 Y 1 A LYS 271 ? CD ? A LYS 270 CD 77 1 Y 1 A LYS 271 ? CE ? A LYS 270 CE 78 1 Y 1 A LYS 271 ? NZ ? A LYS 270 NZ 79 1 Y 1 A LYS 274 ? CG ? A LYS 273 CG 80 1 Y 1 A LYS 274 ? CD ? A LYS 273 CD 81 1 Y 1 A LYS 274 ? CE ? A LYS 273 CE 82 1 Y 1 A LYS 274 ? NZ ? A LYS 273 NZ 83 1 Y 1 A GLU 277 ? CG ? A GLU 276 CG 84 1 Y 1 A GLU 277 ? CD ? A GLU 276 CD 85 1 Y 1 A GLU 277 ? OE1 ? A GLU 276 OE1 86 1 Y 1 A GLU 277 ? OE2 ? A GLU 276 OE2 87 1 Y 1 A LYS 279 ? CG ? A LYS 278 CG 88 1 Y 1 A LYS 279 ? CD ? A LYS 278 CD 89 1 Y 1 A LYS 279 ? CE ? A LYS 278 CE 90 1 Y 1 A LYS 279 ? NZ ? A LYS 278 NZ 91 1 Y 1 A LYS 280 ? CG ? A LYS 279 CG 92 1 Y 1 A LYS 280 ? CD ? A LYS 279 CD 93 1 Y 1 A LYS 280 ? CE ? A LYS 279 CE 94 1 Y 1 A LYS 280 ? NZ ? A LYS 279 NZ 95 1 Y 1 A GLU 284 ? CG ? A GLU 283 CG 96 1 Y 1 A GLU 284 ? CD ? A GLU 283 CD 97 1 Y 1 A GLU 284 ? OE1 ? A GLU 283 OE1 98 1 Y 1 A GLU 284 ? OE2 ? A GLU 283 OE2 99 1 Y 1 A GLU 285 ? CG ? A GLU 284 CG 100 1 Y 1 A GLU 285 ? CD ? A GLU 284 CD 101 1 Y 1 A GLU 285 ? OE1 ? A GLU 284 OE1 102 1 Y 1 A GLU 285 ? OE2 ? A GLU 284 OE2 103 1 Y 1 A GLU 289 ? CG ? A GLU 288 CG 104 1 Y 1 A GLU 289 ? CD ? A GLU 288 CD 105 1 Y 1 A GLU 289 ? OE1 ? A GLU 288 OE1 106 1 Y 1 A GLU 289 ? OE2 ? A GLU 288 OE2 107 1 Y 1 A LYS 292 ? CG ? A LYS 291 CG 108 1 Y 1 A LYS 292 ? CD ? A LYS 291 CD 109 1 Y 1 A LYS 292 ? CE ? A LYS 291 CE 110 1 Y 1 A LYS 292 ? NZ ? A LYS 291 NZ 111 1 Y 1 A LEU 295 ? CG ? A LEU 294 CG 112 1 Y 1 A LEU 295 ? CD1 ? A LEU 294 CD1 113 1 Y 1 A LEU 295 ? CD2 ? A LEU 294 CD2 114 1 Y 1 A ASN 296 ? CG ? A ASN 295 CG 115 1 Y 1 A ASN 296 ? OD1 ? A ASN 295 OD1 116 1 Y 1 A ASN 296 ? ND2 ? A ASN 295 ND2 117 1 Y 1 A VAL 302 ? CG1 ? A VAL 301 CG1 118 1 Y 1 A VAL 302 ? CG2 ? A VAL 301 CG2 119 1 Y 1 A PHE 303 ? CG ? A PHE 302 CG 120 1 Y 1 A PHE 303 ? CD1 ? A PHE 302 CD1 121 1 Y 1 A PHE 303 ? CD2 ? A PHE 302 CD2 122 1 Y 1 A PHE 303 ? CE1 ? A PHE 302 CE1 123 1 Y 1 A PHE 303 ? CE2 ? A PHE 302 CE2 124 1 Y 1 A PHE 303 ? CZ ? A PHE 302 CZ 125 1 Y 1 B DG -1 ? "O5'" ? B DG 1 "O5'" 126 1 Y 1 B DG -1 ? "C5'" ? B DG 1 "C5'" 127 1 Y 1 D ARG 7 ? CG ? D ARG 6 CG 128 1 Y 1 D ARG 7 ? CD ? D ARG 6 CD 129 1 Y 1 D ARG 7 ? NE ? D ARG 6 NE 130 1 Y 1 D ARG 7 ? CZ ? D ARG 6 CZ 131 1 Y 1 D ARG 7 ? NH1 ? D ARG 6 NH1 132 1 Y 1 D ARG 7 ? NH2 ? D ARG 6 NH2 133 1 Y 1 D GLU 8 ? CG ? D GLU 7 CG 134 1 Y 1 D GLU 8 ? CD ? D GLU 7 CD 135 1 Y 1 D GLU 8 ? OE1 ? D GLU 7 OE1 136 1 Y 1 D GLU 8 ? OE2 ? D GLU 7 OE2 137 1 Y 1 D LYS 31 ? CG ? D LYS 30 CG 138 1 Y 1 D LYS 31 ? CD ? D LYS 30 CD 139 1 Y 1 D LYS 31 ? CE ? D LYS 30 CE 140 1 Y 1 D LYS 31 ? NZ ? D LYS 30 NZ 141 1 Y 1 D LYS 34 ? CG ? D LYS 33 CG 142 1 Y 1 D LYS 34 ? CD ? D LYS 33 CD 143 1 Y 1 D LYS 34 ? CE ? D LYS 33 CE 144 1 Y 1 D LYS 34 ? NZ ? D LYS 33 NZ 145 1 Y 1 D LYS 54 ? CG ? D LYS 53 CG 146 1 Y 1 D LYS 54 ? CD ? D LYS 53 CD 147 1 Y 1 D LYS 54 ? CE ? D LYS 53 CE 148 1 Y 1 D LYS 54 ? NZ ? D LYS 53 NZ 149 1 Y 1 D ARG 83 ? CG ? D ARG 82 CG 150 1 Y 1 D ARG 83 ? CD ? D ARG 82 CD 151 1 Y 1 D ARG 83 ? NE ? D ARG 82 NE 152 1 Y 1 D ARG 83 ? CZ ? D ARG 82 CZ 153 1 Y 1 D ARG 83 ? NH1 ? D ARG 82 NH1 154 1 Y 1 D ARG 83 ? NH2 ? D ARG 82 NH2 155 1 Y 1 D LYS 96 ? CG ? D LYS 95 CG 156 1 Y 1 D LYS 96 ? CD ? D LYS 95 CD 157 1 Y 1 D LYS 96 ? CE ? D LYS 95 CE 158 1 Y 1 D LYS 96 ? NZ ? D LYS 95 NZ 159 1 Y 1 D LYS 120 ? CG ? D LYS 119 CG 160 1 Y 1 D LYS 120 ? CD ? D LYS 119 CD 161 1 Y 1 D LYS 120 ? CE ? D LYS 119 CE 162 1 Y 1 D LYS 120 ? NZ ? D LYS 119 NZ 163 1 Y 1 D LEU 123 ? CG ? D LEU 122 CG 164 1 Y 1 D LEU 123 ? CD1 ? D LEU 122 CD1 165 1 Y 1 D LEU 123 ? CD2 ? D LEU 122 CD2 166 1 Y 1 D GLU 126 ? CG ? D GLU 125 CG 167 1 Y 1 D GLU 126 ? CD ? D GLU 125 CD 168 1 Y 1 D GLU 126 ? OE1 ? D GLU 125 OE1 169 1 Y 1 D GLU 126 ? OE2 ? D GLU 125 OE2 170 1 Y 1 D ASP 144 ? CG ? D ASP 143 CG 171 1 Y 1 D ASP 144 ? OD1 ? D ASP 143 OD1 172 1 Y 1 D ASP 144 ? OD2 ? D ASP 143 OD2 173 1 Y 1 D GLU 145 ? CG ? D GLU 144 CG 174 1 Y 1 D GLU 145 ? CD ? D GLU 144 CD 175 1 Y 1 D GLU 145 ? OE1 ? D GLU 144 OE1 176 1 Y 1 D GLU 145 ? OE2 ? D GLU 144 OE2 177 1 Y 1 D LYS 147 ? CG ? D LYS 146 CG 178 1 Y 1 D LYS 147 ? CD ? D LYS 146 CD 179 1 Y 1 D LYS 147 ? CE ? D LYS 146 CE 180 1 Y 1 D LYS 147 ? NZ ? D LYS 146 NZ 181 1 Y 1 D LYS 148 ? CG ? D LYS 147 CG 182 1 Y 1 D LYS 148 ? CD ? D LYS 147 CD 183 1 Y 1 D LYS 148 ? CE ? D LYS 147 CE 184 1 Y 1 D LYS 148 ? NZ ? D LYS 147 NZ 185 1 Y 1 D GLU 152 ? CG ? D GLU 151 CG 186 1 Y 1 D GLU 152 ? CD ? D GLU 151 CD 187 1 Y 1 D GLU 152 ? OE1 ? D GLU 151 OE1 188 1 Y 1 D GLU 152 ? OE2 ? D GLU 151 OE2 189 1 Y 1 D ILE 153 ? CG1 ? D ILE 152 CG1 190 1 Y 1 D ILE 153 ? CG2 ? D ILE 152 CG2 191 1 Y 1 D ILE 153 ? CD1 ? D ILE 152 CD1 192 1 Y 1 D SER 155 ? OG ? D SER 154 OG 193 1 Y 1 D GLU 157 ? CG ? D GLU 156 CG 194 1 Y 1 D GLU 157 ? CD ? D GLU 156 CD 195 1 Y 1 D GLU 157 ? OE1 ? D GLU 156 OE1 196 1 Y 1 D GLU 157 ? OE2 ? D GLU 156 OE2 197 1 Y 1 D ARG 158 ? CG ? D ARG 157 CG 198 1 Y 1 D ARG 158 ? CD ? D ARG 157 CD 199 1 Y 1 D ARG 158 ? NE ? D ARG 157 NE 200 1 Y 1 D ARG 158 ? CZ ? D ARG 157 CZ 201 1 Y 1 D ARG 158 ? NH1 ? D ARG 157 NH1 202 1 Y 1 D ARG 158 ? NH2 ? D ARG 157 NH2 203 1 Y 1 D LYS 169 ? CG ? D LYS 168 CG 204 1 Y 1 D LYS 169 ? CD ? D LYS 168 CD 205 1 Y 1 D LYS 169 ? CE ? D LYS 168 CE 206 1 Y 1 D LYS 169 ? NZ ? D LYS 168 NZ 207 1 Y 1 D ILE 186 ? CG1 ? D ILE 185 CG1 208 1 Y 1 D ILE 186 ? CG2 ? D ILE 185 CG2 209 1 Y 1 D ILE 186 ? CD1 ? D ILE 185 CD1 210 1 Y 1 D LYS 189 ? CG ? D LYS 188 CG 211 1 Y 1 D LYS 189 ? CD ? D LYS 188 CD 212 1 Y 1 D LYS 189 ? CE ? D LYS 188 CE 213 1 Y 1 D LYS 189 ? NZ ? D LYS 188 NZ 214 1 Y 1 D LYS 191 ? CG ? D LYS 190 CG 215 1 Y 1 D LYS 191 ? CD ? D LYS 190 CD 216 1 Y 1 D LYS 191 ? CE ? D LYS 190 CE 217 1 Y 1 D LYS 191 ? NZ ? D LYS 190 NZ 218 1 Y 1 D LYS 209 ? CG ? D LYS 208 CG 219 1 Y 1 D LYS 209 ? CD ? D LYS 208 CD 220 1 Y 1 D LYS 209 ? CE ? D LYS 208 CE 221 1 Y 1 D LYS 209 ? NZ ? D LYS 208 NZ 222 1 Y 1 D LYS 226 ? CG ? D LYS 225 CG 223 1 Y 1 D LYS 226 ? CD ? D LYS 225 CD 224 1 Y 1 D LYS 226 ? CE ? D LYS 225 CE 225 1 Y 1 D LYS 226 ? NZ ? D LYS 225 NZ 226 1 Y 1 D LYS 229 ? CG ? D LYS 228 CG 227 1 Y 1 D LYS 229 ? CD ? D LYS 228 CD 228 1 Y 1 D LYS 229 ? CE ? D LYS 228 CE 229 1 Y 1 D LYS 229 ? NZ ? D LYS 228 NZ 230 1 Y 1 D SER 230 ? OG ? D SER 229 OG 231 1 Y 1 D GLU 231 ? CG ? D GLU 230 CG 232 1 Y 1 D GLU 231 ? CD ? D GLU 230 CD 233 1 Y 1 D GLU 231 ? OE1 ? D GLU 230 OE1 234 1 Y 1 D GLU 231 ? OE2 ? D GLU 230 OE2 235 1 Y 1 D LYS 241 ? CG ? D LYS 240 CG 236 1 Y 1 D LYS 241 ? CD ? D LYS 240 CD 237 1 Y 1 D LYS 241 ? CE ? D LYS 240 CE 238 1 Y 1 D LYS 241 ? NZ ? D LYS 240 NZ 239 1 Y 1 D LYS 264 ? CG ? D LYS 263 CG 240 1 Y 1 D LYS 264 ? CD ? D LYS 263 CD 241 1 Y 1 D LYS 264 ? CE ? D LYS 263 CE 242 1 Y 1 D LYS 264 ? NZ ? D LYS 263 NZ 243 1 Y 1 D LYS 271 ? CG ? D LYS 270 CG 244 1 Y 1 D LYS 271 ? CD ? D LYS 270 CD 245 1 Y 1 D LYS 271 ? CE ? D LYS 270 CE 246 1 Y 1 D LYS 271 ? NZ ? D LYS 270 NZ 247 1 Y 1 D LYS 274 ? CG ? D LYS 273 CG 248 1 Y 1 D LYS 274 ? CD ? D LYS 273 CD 249 1 Y 1 D LYS 274 ? CE ? D LYS 273 CE 250 1 Y 1 D LYS 274 ? NZ ? D LYS 273 NZ 251 1 Y 1 D LEU 275 ? CG ? D LEU 274 CG 252 1 Y 1 D LEU 275 ? CD1 ? D LEU 274 CD1 253 1 Y 1 D LEU 275 ? CD2 ? D LEU 274 CD2 254 1 Y 1 D LYS 279 ? CG ? D LYS 278 CG 255 1 Y 1 D LYS 279 ? CD ? D LYS 278 CD 256 1 Y 1 D LYS 279 ? CE ? D LYS 278 CE 257 1 Y 1 D LYS 279 ? NZ ? D LYS 278 NZ 258 1 Y 1 D LYS 280 ? CG ? D LYS 279 CG 259 1 Y 1 D LYS 280 ? CD ? D LYS 279 CD 260 1 Y 1 D LYS 280 ? CE ? D LYS 279 CE 261 1 Y 1 D LYS 280 ? NZ ? D LYS 279 NZ 262 1 Y 1 D LEU 282 ? CG ? D LEU 281 CG 263 1 Y 1 D LEU 282 ? CD1 ? D LEU 281 CD1 264 1 Y 1 D LEU 282 ? CD2 ? D LEU 281 CD2 265 1 Y 1 D GLU 284 ? CG ? D GLU 283 CG 266 1 Y 1 D GLU 284 ? CD ? D GLU 283 CD 267 1 Y 1 D GLU 284 ? OE1 ? D GLU 283 OE1 268 1 Y 1 D GLU 284 ? OE2 ? D GLU 283 OE2 269 1 Y 1 D GLU 285 ? CG ? D GLU 284 CG 270 1 Y 1 D GLU 285 ? CD ? D GLU 284 CD 271 1 Y 1 D GLU 285 ? OE1 ? D GLU 284 OE1 272 1 Y 1 D GLU 285 ? OE2 ? D GLU 284 OE2 273 1 Y 1 D ILE 290 ? CG1 ? D ILE 289 CG1 274 1 Y 1 D ILE 290 ? CG2 ? D ILE 289 CG2 275 1 Y 1 D ILE 290 ? CD1 ? D ILE 289 CD1 276 1 Y 1 D LYS 291 ? CG ? D LYS 290 CG 277 1 Y 1 D LYS 291 ? CD ? D LYS 290 CD 278 1 Y 1 D LYS 291 ? CE ? D LYS 290 CE 279 1 Y 1 D LYS 291 ? NZ ? D LYS 290 NZ 280 1 Y 1 D LYS 292 ? CG ? D LYS 291 CG 281 1 Y 1 D LYS 292 ? CD ? D LYS 291 CD 282 1 Y 1 D LYS 292 ? CE ? D LYS 291 CE 283 1 Y 1 D LYS 292 ? NZ ? D LYS 291 NZ 284 1 Y 1 D LEU 295 ? CG ? D LEU 294 CG 285 1 Y 1 D LEU 295 ? CD1 ? D LEU 294 CD1 286 1 Y 1 D LEU 295 ? CD2 ? D LEU 294 CD2 287 1 Y 1 D LYS 299 ? CG ? D LYS 298 CG 288 1 Y 1 D LYS 299 ? CD ? D LYS 298 CD 289 1 Y 1 D LYS 299 ? CE ? D LYS 298 CE 290 1 Y 1 D LYS 299 ? NZ ? D LYS 298 NZ 291 1 Y 1 D VAL 302 ? CG1 ? D VAL 301 CG1 292 1 Y 1 D VAL 302 ? CG2 ? D VAL 301 CG2 293 1 Y 1 D PHE 303 ? CG ? D PHE 302 CG 294 1 Y 1 D PHE 303 ? CD1 ? D PHE 302 CD1 295 1 Y 1 D PHE 303 ? CD2 ? D PHE 302 CD2 296 1 Y 1 D PHE 303 ? CE1 ? D PHE 302 CE1 297 1 Y 1 D PHE 303 ? CE2 ? D PHE 302 CE2 298 1 Y 1 D PHE 303 ? CZ ? D PHE 302 CZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 2 ? A MET 1 2 1 Y 1 A ALA 3 ? A ALA 2 3 1 Y 1 A SER 4 ? A SER 3 4 1 Y 1 A SER 5 ? A SER 4 5 1 Y 1 A ARG 6 ? A ARG 5 6 1 Y 1 A ARG 7 ? A ARG 6 7 1 Y 1 A GLU 8 ? A GLU 7 8 1 Y 1 D MET 2 ? D MET 1 9 1 Y 1 D ALA 3 ? D ALA 2 10 1 Y 1 D SER 4 ? D SER 3 11 1 Y 1 D SER 5 ? D SER 4 12 1 Y 1 D ARG 6 ? D ARG 5 13 1 Y 1 D ILE 154 ? D ILE 153 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 DA OP3 O N N 89 DA P P N N 90 DA OP1 O N N 91 DA OP2 O N N 92 DA "O5'" O N N 93 DA "C5'" C N N 94 DA "C4'" C N R 95 DA "O4'" O N N 96 DA "C3'" C N S 97 DA "O3'" O N N 98 DA "C2'" C N N 99 DA "C1'" C N R 100 DA N9 N Y N 101 DA C8 C Y N 102 DA N7 N Y N 103 DA C5 C Y N 104 DA C6 C Y N 105 DA N6 N N N 106 DA N1 N Y N 107 DA C2 C Y N 108 DA N3 N Y N 109 DA C4 C Y N 110 DA HOP3 H N N 111 DA HOP2 H N N 112 DA "H5'" H N N 113 DA "H5''" H N N 114 DA "H4'" H N N 115 DA "H3'" H N N 116 DA "HO3'" H N N 117 DA "H2'" H N N 118 DA "H2''" H N N 119 DA "H1'" H N N 120 DA H8 H N N 121 DA H61 H N N 122 DA H62 H N N 123 DA H2 H N N 124 DC OP3 O N N 125 DC P P N N 126 DC OP1 O N N 127 DC OP2 O N N 128 DC "O5'" O N N 129 DC "C5'" C N N 130 DC "C4'" C N R 131 DC "O4'" O N N 132 DC "C3'" C N S 133 DC "O3'" O N N 134 DC "C2'" C N N 135 DC "C1'" C N R 136 DC N1 N N N 137 DC C2 C N N 138 DC O2 O N N 139 DC N3 N N N 140 DC C4 C N N 141 DC N4 N N N 142 DC C5 C N N 143 DC C6 C N N 144 DC HOP3 H N N 145 DC HOP2 H N N 146 DC "H5'" H N N 147 DC "H5''" H N N 148 DC "H4'" H N N 149 DC "H3'" H N N 150 DC "HO3'" H N N 151 DC "H2'" H N N 152 DC "H2''" H N N 153 DC "H1'" H N N 154 DC H41 H N N 155 DC H42 H N N 156 DC H5 H N N 157 DC H6 H N N 158 DG OP3 O N N 159 DG P P N N 160 DG OP1 O N N 161 DG OP2 O N N 162 DG "O5'" O N N 163 DG "C5'" C N N 164 DG "C4'" C N R 165 DG "O4'" O N N 166 DG "C3'" C N S 167 DG "O3'" O N N 168 DG "C2'" C N N 169 DG "C1'" C N R 170 DG N9 N Y N 171 DG C8 C Y N 172 DG N7 N Y N 173 DG C5 C Y N 174 DG C6 C N N 175 DG O6 O N N 176 DG N1 N N N 177 DG C2 C N N 178 DG N2 N N N 179 DG N3 N N N 180 DG C4 C Y N 181 DG HOP3 H N N 182 DG HOP2 H N N 183 DG "H5'" H N N 184 DG "H5''" H N N 185 DG "H4'" H N N 186 DG "H3'" H N N 187 DG "HO3'" H N N 188 DG "H2'" H N N 189 DG "H2''" H N N 190 DG "H1'" H N N 191 DG H8 H N N 192 DG H1 H N N 193 DG H21 H N N 194 DG H22 H N N 195 DT OP3 O N N 196 DT P P N N 197 DT OP1 O N N 198 DT OP2 O N N 199 DT "O5'" O N N 200 DT "C5'" C N N 201 DT "C4'" C N R 202 DT "O4'" O N N 203 DT "C3'" C N S 204 DT "O3'" O N N 205 DT "C2'" C N N 206 DT "C1'" C N R 207 DT N1 N N N 208 DT C2 C N N 209 DT O2 O N N 210 DT N3 N N N 211 DT C4 C N N 212 DT O4 O N N 213 DT C5 C N N 214 DT C7 C N N 215 DT C6 C N N 216 DT HOP3 H N N 217 DT HOP2 H N N 218 DT "H5'" H N N 219 DT "H5''" H N N 220 DT "H4'" H N N 221 DT "H3'" H N N 222 DT "HO3'" H N N 223 DT "H2'" H N N 224 DT "H2''" H N N 225 DT "H1'" H N N 226 DT H3 H N N 227 DT H71 H N N 228 DT H72 H N N 229 DT H73 H N N 230 DT H6 H N N 231 GLN N N N N 232 GLN CA C N S 233 GLN C C N N 234 GLN O O N N 235 GLN CB C N N 236 GLN CG C N N 237 GLN CD C N N 238 GLN OE1 O N N 239 GLN NE2 N N N 240 GLN OXT O N N 241 GLN H H N N 242 GLN H2 H N N 243 GLN HA H N N 244 GLN HB2 H N N 245 GLN HB3 H N N 246 GLN HG2 H N N 247 GLN HG3 H N N 248 GLN HE21 H N N 249 GLN HE22 H N N 250 GLN HXT H N N 251 GLU N N N N 252 GLU CA C N S 253 GLU C C N N 254 GLU O O N N 255 GLU CB C N N 256 GLU CG C N N 257 GLU CD C N N 258 GLU OE1 O N N 259 GLU OE2 O N N 260 GLU OXT O N N 261 GLU H H N N 262 GLU H2 H N N 263 GLU HA H N N 264 GLU HB2 H N N 265 GLU HB3 H N N 266 GLU HG2 H N N 267 GLU HG3 H N N 268 GLU HE2 H N N 269 GLU HXT H N N 270 GLY N N N N 271 GLY CA C N N 272 GLY C C N N 273 GLY O O N N 274 GLY OXT O N N 275 GLY H H N N 276 GLY H2 H N N 277 GLY HA2 H N N 278 GLY HA3 H N N 279 GLY HXT H N N 280 HIS N N N N 281 HIS CA C N S 282 HIS C C N N 283 HIS O O N N 284 HIS CB C N N 285 HIS CG C Y N 286 HIS ND1 N Y N 287 HIS CD2 C Y N 288 HIS CE1 C Y N 289 HIS NE2 N Y N 290 HIS OXT O N N 291 HIS H H N N 292 HIS H2 H N N 293 HIS HA H N N 294 HIS HB2 H N N 295 HIS HB3 H N N 296 HIS HD1 H N N 297 HIS HD2 H N N 298 HIS HE1 H N N 299 HIS HE2 H N N 300 HIS HXT H N N 301 HOH O O N N 302 HOH H1 H N N 303 HOH H2 H N N 304 ILE N N N N 305 ILE CA C N S 306 ILE C C N N 307 ILE O O N N 308 ILE CB C N S 309 ILE CG1 C N N 310 ILE CG2 C N N 311 ILE CD1 C N N 312 ILE OXT O N N 313 ILE H H N N 314 ILE H2 H N N 315 ILE HA H N N 316 ILE HB H N N 317 ILE HG12 H N N 318 ILE HG13 H N N 319 ILE HG21 H N N 320 ILE HG22 H N N 321 ILE HG23 H N N 322 ILE HD11 H N N 323 ILE HD12 H N N 324 ILE HD13 H N N 325 ILE HXT H N N 326 LEU N N N N 327 LEU CA C N S 328 LEU C C N N 329 LEU O O N N 330 LEU CB C N N 331 LEU CG C N N 332 LEU CD1 C N N 333 LEU CD2 C N N 334 LEU OXT O N N 335 LEU H H N N 336 LEU H2 H N N 337 LEU HA H N N 338 LEU HB2 H N N 339 LEU HB3 H N N 340 LEU HG H N N 341 LEU HD11 H N N 342 LEU HD12 H N N 343 LEU HD13 H N N 344 LEU HD21 H N N 345 LEU HD22 H N N 346 LEU HD23 H N N 347 LEU HXT H N N 348 LYS N N N N 349 LYS CA C N S 350 LYS C C N N 351 LYS O O N N 352 LYS CB C N N 353 LYS CG C N N 354 LYS CD C N N 355 LYS CE C N N 356 LYS NZ N N N 357 LYS OXT O N N 358 LYS H H N N 359 LYS H2 H N N 360 LYS HA H N N 361 LYS HB2 H N N 362 LYS HB3 H N N 363 LYS HG2 H N N 364 LYS HG3 H N N 365 LYS HD2 H N N 366 LYS HD3 H N N 367 LYS HE2 H N N 368 LYS HE3 H N N 369 LYS HZ1 H N N 370 LYS HZ2 H N N 371 LYS HZ3 H N N 372 LYS HXT H N N 373 MET N N N N 374 MET CA C N S 375 MET C C N N 376 MET O O N N 377 MET CB C N N 378 MET CG C N N 379 MET SD S N N 380 MET CE C N N 381 MET OXT O N N 382 MET H H N N 383 MET H2 H N N 384 MET HA H N N 385 MET HB2 H N N 386 MET HB3 H N N 387 MET HG2 H N N 388 MET HG3 H N N 389 MET HE1 H N N 390 MET HE2 H N N 391 MET HE3 H N N 392 MET HXT H N N 393 PHE N N N N 394 PHE CA C N S 395 PHE C C N N 396 PHE O O N N 397 PHE CB C N N 398 PHE CG C Y N 399 PHE CD1 C Y N 400 PHE CD2 C Y N 401 PHE CE1 C Y N 402 PHE CE2 C Y N 403 PHE CZ C Y N 404 PHE OXT O N N 405 PHE H H N N 406 PHE H2 H N N 407 PHE HA H N N 408 PHE HB2 H N N 409 PHE HB3 H N N 410 PHE HD1 H N N 411 PHE HD2 H N N 412 PHE HE1 H N N 413 PHE HE2 H N N 414 PHE HZ H N N 415 PHE HXT H N N 416 PRO N N N N 417 PRO CA C N S 418 PRO C C N N 419 PRO O O N N 420 PRO CB C N N 421 PRO CG C N N 422 PRO CD C N N 423 PRO OXT O N N 424 PRO H H N N 425 PRO HA H N N 426 PRO HB2 H N N 427 PRO HB3 H N N 428 PRO HG2 H N N 429 PRO HG3 H N N 430 PRO HD2 H N N 431 PRO HD3 H N N 432 PRO HXT H N N 433 SER N N N N 434 SER CA C N S 435 SER C C N N 436 SER O O N N 437 SER CB C N N 438 SER OG O N N 439 SER OXT O N N 440 SER H H N N 441 SER H2 H N N 442 SER HA H N N 443 SER HB2 H N N 444 SER HB3 H N N 445 SER HG H N N 446 SER HXT H N N 447 THR N N N N 448 THR CA C N S 449 THR C C N N 450 THR O O N N 451 THR CB C N R 452 THR OG1 O N N 453 THR CG2 C N N 454 THR OXT O N N 455 THR H H N N 456 THR H2 H N N 457 THR HA H N N 458 THR HB H N N 459 THR HG1 H N N 460 THR HG21 H N N 461 THR HG22 H N N 462 THR HG23 H N N 463 THR HXT H N N 464 TRP N N N N 465 TRP CA C N S 466 TRP C C N N 467 TRP O O N N 468 TRP CB C N N 469 TRP CG C Y N 470 TRP CD1 C Y N 471 TRP CD2 C Y N 472 TRP NE1 N Y N 473 TRP CE2 C Y N 474 TRP CE3 C Y N 475 TRP CZ2 C Y N 476 TRP CZ3 C Y N 477 TRP CH2 C Y N 478 TRP OXT O N N 479 TRP H H N N 480 TRP H2 H N N 481 TRP HA H N N 482 TRP HB2 H N N 483 TRP HB3 H N N 484 TRP HD1 H N N 485 TRP HE1 H N N 486 TRP HE3 H N N 487 TRP HZ2 H N N 488 TRP HZ3 H N N 489 TRP HH2 H N N 490 TRP HXT H N N 491 TYR N N N N 492 TYR CA C N S 493 TYR C C N N 494 TYR O O N N 495 TYR CB C N N 496 TYR CG C Y N 497 TYR CD1 C Y N 498 TYR CD2 C Y N 499 TYR CE1 C Y N 500 TYR CE2 C Y N 501 TYR CZ C Y N 502 TYR OH O N N 503 TYR OXT O N N 504 TYR H H N N 505 TYR H2 H N N 506 TYR HA H N N 507 TYR HB2 H N N 508 TYR HB3 H N N 509 TYR HD1 H N N 510 TYR HD2 H N N 511 TYR HE1 H N N 512 TYR HE2 H N N 513 TYR HH H N N 514 TYR HXT H N N 515 VAL N N N N 516 VAL CA C N S 517 VAL C C N N 518 VAL O O N N 519 VAL CB C N N 520 VAL CG1 C N N 521 VAL CG2 C N N 522 VAL OXT O N N 523 VAL H H N N 524 VAL H2 H N N 525 VAL HA H N N 526 VAL HB H N N 527 VAL HG11 H N N 528 VAL HG12 H N N 529 VAL HG13 H N N 530 VAL HG21 H N N 531 VAL HG22 H N N 532 VAL HG23 H N N 533 VAL HXT H N N 534 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DA OP3 P sing N N 83 DA OP3 HOP3 sing N N 84 DA P OP1 doub N N 85 DA P OP2 sing N N 86 DA P "O5'" sing N N 87 DA OP2 HOP2 sing N N 88 DA "O5'" "C5'" sing N N 89 DA "C5'" "C4'" sing N N 90 DA "C5'" "H5'" sing N N 91 DA "C5'" "H5''" sing N N 92 DA "C4'" "O4'" sing N N 93 DA "C4'" "C3'" sing N N 94 DA "C4'" "H4'" sing N N 95 DA "O4'" "C1'" sing N N 96 DA "C3'" "O3'" sing N N 97 DA "C3'" "C2'" sing N N 98 DA "C3'" "H3'" sing N N 99 DA "O3'" "HO3'" sing N N 100 DA "C2'" "C1'" sing N N 101 DA "C2'" "H2'" sing N N 102 DA "C2'" "H2''" sing N N 103 DA "C1'" N9 sing N N 104 DA "C1'" "H1'" sing N N 105 DA N9 C8 sing Y N 106 DA N9 C4 sing Y N 107 DA C8 N7 doub Y N 108 DA C8 H8 sing N N 109 DA N7 C5 sing Y N 110 DA C5 C6 sing Y N 111 DA C5 C4 doub Y N 112 DA C6 N6 sing N N 113 DA C6 N1 doub Y N 114 DA N6 H61 sing N N 115 DA N6 H62 sing N N 116 DA N1 C2 sing Y N 117 DA C2 N3 doub Y N 118 DA C2 H2 sing N N 119 DA N3 C4 sing Y N 120 DC OP3 P sing N N 121 DC OP3 HOP3 sing N N 122 DC P OP1 doub N N 123 DC P OP2 sing N N 124 DC P "O5'" sing N N 125 DC OP2 HOP2 sing N N 126 DC "O5'" "C5'" sing N N 127 DC "C5'" "C4'" sing N N 128 DC "C5'" "H5'" sing N N 129 DC "C5'" "H5''" sing N N 130 DC "C4'" "O4'" sing N N 131 DC "C4'" "C3'" sing N N 132 DC "C4'" "H4'" sing N N 133 DC "O4'" "C1'" sing N N 134 DC "C3'" "O3'" sing N N 135 DC "C3'" "C2'" sing N N 136 DC "C3'" "H3'" sing N N 137 DC "O3'" "HO3'" sing N N 138 DC "C2'" "C1'" sing N N 139 DC "C2'" "H2'" sing N N 140 DC "C2'" "H2''" sing N N 141 DC "C1'" N1 sing N N 142 DC "C1'" "H1'" sing N N 143 DC N1 C2 sing N N 144 DC N1 C6 sing N N 145 DC C2 O2 doub N N 146 DC C2 N3 sing N N 147 DC N3 C4 doub N N 148 DC C4 N4 sing N N 149 DC C4 C5 sing N N 150 DC N4 H41 sing N N 151 DC N4 H42 sing N N 152 DC C5 C6 doub N N 153 DC C5 H5 sing N N 154 DC C6 H6 sing N N 155 DG OP3 P sing N N 156 DG OP3 HOP3 sing N N 157 DG P OP1 doub N N 158 DG P OP2 sing N N 159 DG P "O5'" sing N N 160 DG OP2 HOP2 sing N N 161 DG "O5'" "C5'" sing N N 162 DG "C5'" "C4'" sing N N 163 DG "C5'" "H5'" sing N N 164 DG "C5'" "H5''" sing N N 165 DG "C4'" "O4'" sing N N 166 DG "C4'" "C3'" sing N N 167 DG "C4'" "H4'" sing N N 168 DG "O4'" "C1'" sing N N 169 DG "C3'" "O3'" sing N N 170 DG "C3'" "C2'" sing N N 171 DG "C3'" "H3'" sing N N 172 DG "O3'" "HO3'" sing N N 173 DG "C2'" "C1'" sing N N 174 DG "C2'" "H2'" sing N N 175 DG "C2'" "H2''" sing N N 176 DG "C1'" N9 sing N N 177 DG "C1'" "H1'" sing N N 178 DG N9 C8 sing Y N 179 DG N9 C4 sing Y N 180 DG C8 N7 doub Y N 181 DG C8 H8 sing N N 182 DG N7 C5 sing Y N 183 DG C5 C6 sing N N 184 DG C5 C4 doub Y N 185 DG C6 O6 doub N N 186 DG C6 N1 sing N N 187 DG N1 C2 sing N N 188 DG N1 H1 sing N N 189 DG C2 N2 sing N N 190 DG C2 N3 doub N N 191 DG N2 H21 sing N N 192 DG N2 H22 sing N N 193 DG N3 C4 sing N N 194 DT OP3 P sing N N 195 DT OP3 HOP3 sing N N 196 DT P OP1 doub N N 197 DT P OP2 sing N N 198 DT P "O5'" sing N N 199 DT OP2 HOP2 sing N N 200 DT "O5'" "C5'" sing N N 201 DT "C5'" "C4'" sing N N 202 DT "C5'" "H5'" sing N N 203 DT "C5'" "H5''" sing N N 204 DT "C4'" "O4'" sing N N 205 DT "C4'" "C3'" sing N N 206 DT "C4'" "H4'" sing N N 207 DT "O4'" "C1'" sing N N 208 DT "C3'" "O3'" sing N N 209 DT "C3'" "C2'" sing N N 210 DT "C3'" "H3'" sing N N 211 DT "O3'" "HO3'" sing N N 212 DT "C2'" "C1'" sing N N 213 DT "C2'" "H2'" sing N N 214 DT "C2'" "H2''" sing N N 215 DT "C1'" N1 sing N N 216 DT "C1'" "H1'" sing N N 217 DT N1 C2 sing N N 218 DT N1 C6 sing N N 219 DT C2 O2 doub N N 220 DT C2 N3 sing N N 221 DT N3 C4 sing N N 222 DT N3 H3 sing N N 223 DT C4 O4 doub N N 224 DT C4 C5 sing N N 225 DT C5 C7 sing N N 226 DT C5 C6 doub N N 227 DT C7 H71 sing N N 228 DT C7 H72 sing N N 229 DT C7 H73 sing N N 230 DT C6 H6 sing N N 231 GLN N CA sing N N 232 GLN N H sing N N 233 GLN N H2 sing N N 234 GLN CA C sing N N 235 GLN CA CB sing N N 236 GLN CA HA sing N N 237 GLN C O doub N N 238 GLN C OXT sing N N 239 GLN CB CG sing N N 240 GLN CB HB2 sing N N 241 GLN CB HB3 sing N N 242 GLN CG CD sing N N 243 GLN CG HG2 sing N N 244 GLN CG HG3 sing N N 245 GLN CD OE1 doub N N 246 GLN CD NE2 sing N N 247 GLN NE2 HE21 sing N N 248 GLN NE2 HE22 sing N N 249 GLN OXT HXT sing N N 250 GLU N CA sing N N 251 GLU N H sing N N 252 GLU N H2 sing N N 253 GLU CA C sing N N 254 GLU CA CB sing N N 255 GLU CA HA sing N N 256 GLU C O doub N N 257 GLU C OXT sing N N 258 GLU CB CG sing N N 259 GLU CB HB2 sing N N 260 GLU CB HB3 sing N N 261 GLU CG CD sing N N 262 GLU CG HG2 sing N N 263 GLU CG HG3 sing N N 264 GLU CD OE1 doub N N 265 GLU CD OE2 sing N N 266 GLU OE2 HE2 sing N N 267 GLU OXT HXT sing N N 268 GLY N CA sing N N 269 GLY N H sing N N 270 GLY N H2 sing N N 271 GLY CA C sing N N 272 GLY CA HA2 sing N N 273 GLY CA HA3 sing N N 274 GLY C O doub N N 275 GLY C OXT sing N N 276 GLY OXT HXT sing N N 277 HIS N CA sing N N 278 HIS N H sing N N 279 HIS N H2 sing N N 280 HIS CA C sing N N 281 HIS CA CB sing N N 282 HIS CA HA sing N N 283 HIS C O doub N N 284 HIS C OXT sing N N 285 HIS CB CG sing N N 286 HIS CB HB2 sing N N 287 HIS CB HB3 sing N N 288 HIS CG ND1 sing Y N 289 HIS CG CD2 doub Y N 290 HIS ND1 CE1 doub Y N 291 HIS ND1 HD1 sing N N 292 HIS CD2 NE2 sing Y N 293 HIS CD2 HD2 sing N N 294 HIS CE1 NE2 sing Y N 295 HIS CE1 HE1 sing N N 296 HIS NE2 HE2 sing N N 297 HIS OXT HXT sing N N 298 HOH O H1 sing N N 299 HOH O H2 sing N N 300 ILE N CA sing N N 301 ILE N H sing N N 302 ILE N H2 sing N N 303 ILE CA C sing N N 304 ILE CA CB sing N N 305 ILE CA HA sing N N 306 ILE C O doub N N 307 ILE C OXT sing N N 308 ILE CB CG1 sing N N 309 ILE CB CG2 sing N N 310 ILE CB HB sing N N 311 ILE CG1 CD1 sing N N 312 ILE CG1 HG12 sing N N 313 ILE CG1 HG13 sing N N 314 ILE CG2 HG21 sing N N 315 ILE CG2 HG22 sing N N 316 ILE CG2 HG23 sing N N 317 ILE CD1 HD11 sing N N 318 ILE CD1 HD12 sing N N 319 ILE CD1 HD13 sing N N 320 ILE OXT HXT sing N N 321 LEU N CA sing N N 322 LEU N H sing N N 323 LEU N H2 sing N N 324 LEU CA C sing N N 325 LEU CA CB sing N N 326 LEU CA HA sing N N 327 LEU C O doub N N 328 LEU C OXT sing N N 329 LEU CB CG sing N N 330 LEU CB HB2 sing N N 331 LEU CB HB3 sing N N 332 LEU CG CD1 sing N N 333 LEU CG CD2 sing N N 334 LEU CG HG sing N N 335 LEU CD1 HD11 sing N N 336 LEU CD1 HD12 sing N N 337 LEU CD1 HD13 sing N N 338 LEU CD2 HD21 sing N N 339 LEU CD2 HD22 sing N N 340 LEU CD2 HD23 sing N N 341 LEU OXT HXT sing N N 342 LYS N CA sing N N 343 LYS N H sing N N 344 LYS N H2 sing N N 345 LYS CA C sing N N 346 LYS CA CB sing N N 347 LYS CA HA sing N N 348 LYS C O doub N N 349 LYS C OXT sing N N 350 LYS CB CG sing N N 351 LYS CB HB2 sing N N 352 LYS CB HB3 sing N N 353 LYS CG CD sing N N 354 LYS CG HG2 sing N N 355 LYS CG HG3 sing N N 356 LYS CD CE sing N N 357 LYS CD HD2 sing N N 358 LYS CD HD3 sing N N 359 LYS CE NZ sing N N 360 LYS CE HE2 sing N N 361 LYS CE HE3 sing N N 362 LYS NZ HZ1 sing N N 363 LYS NZ HZ2 sing N N 364 LYS NZ HZ3 sing N N 365 LYS OXT HXT sing N N 366 MET N CA sing N N 367 MET N H sing N N 368 MET N H2 sing N N 369 MET CA C sing N N 370 MET CA CB sing N N 371 MET CA HA sing N N 372 MET C O doub N N 373 MET C OXT sing N N 374 MET CB CG sing N N 375 MET CB HB2 sing N N 376 MET CB HB3 sing N N 377 MET CG SD sing N N 378 MET CG HG2 sing N N 379 MET CG HG3 sing N N 380 MET SD CE sing N N 381 MET CE HE1 sing N N 382 MET CE HE2 sing N N 383 MET CE HE3 sing N N 384 MET OXT HXT sing N N 385 PHE N CA sing N N 386 PHE N H sing N N 387 PHE N H2 sing N N 388 PHE CA C sing N N 389 PHE CA CB sing N N 390 PHE CA HA sing N N 391 PHE C O doub N N 392 PHE C OXT sing N N 393 PHE CB CG sing N N 394 PHE CB HB2 sing N N 395 PHE CB HB3 sing N N 396 PHE CG CD1 doub Y N 397 PHE CG CD2 sing Y N 398 PHE CD1 CE1 sing Y N 399 PHE CD1 HD1 sing N N 400 PHE CD2 CE2 doub Y N 401 PHE CD2 HD2 sing N N 402 PHE CE1 CZ doub Y N 403 PHE CE1 HE1 sing N N 404 PHE CE2 CZ sing Y N 405 PHE CE2 HE2 sing N N 406 PHE CZ HZ sing N N 407 PHE OXT HXT sing N N 408 PRO N CA sing N N 409 PRO N CD sing N N 410 PRO N H sing N N 411 PRO CA C sing N N 412 PRO CA CB sing N N 413 PRO CA HA sing N N 414 PRO C O doub N N 415 PRO C OXT sing N N 416 PRO CB CG sing N N 417 PRO CB HB2 sing N N 418 PRO CB HB3 sing N N 419 PRO CG CD sing N N 420 PRO CG HG2 sing N N 421 PRO CG HG3 sing N N 422 PRO CD HD2 sing N N 423 PRO CD HD3 sing N N 424 PRO OXT HXT sing N N 425 SER N CA sing N N 426 SER N H sing N N 427 SER N H2 sing N N 428 SER CA C sing N N 429 SER CA CB sing N N 430 SER CA HA sing N N 431 SER C O doub N N 432 SER C OXT sing N N 433 SER CB OG sing N N 434 SER CB HB2 sing N N 435 SER CB HB3 sing N N 436 SER OG HG sing N N 437 SER OXT HXT sing N N 438 THR N CA sing N N 439 THR N H sing N N 440 THR N H2 sing N N 441 THR CA C sing N N 442 THR CA CB sing N N 443 THR CA HA sing N N 444 THR C O doub N N 445 THR C OXT sing N N 446 THR CB OG1 sing N N 447 THR CB CG2 sing N N 448 THR CB HB sing N N 449 THR OG1 HG1 sing N N 450 THR CG2 HG21 sing N N 451 THR CG2 HG22 sing N N 452 THR CG2 HG23 sing N N 453 THR OXT HXT sing N N 454 TRP N CA sing N N 455 TRP N H sing N N 456 TRP N H2 sing N N 457 TRP CA C sing N N 458 TRP CA CB sing N N 459 TRP CA HA sing N N 460 TRP C O doub N N 461 TRP C OXT sing N N 462 TRP CB CG sing N N 463 TRP CB HB2 sing N N 464 TRP CB HB3 sing N N 465 TRP CG CD1 doub Y N 466 TRP CG CD2 sing Y N 467 TRP CD1 NE1 sing Y N 468 TRP CD1 HD1 sing N N 469 TRP CD2 CE2 doub Y N 470 TRP CD2 CE3 sing Y N 471 TRP NE1 CE2 sing Y N 472 TRP NE1 HE1 sing N N 473 TRP CE2 CZ2 sing Y N 474 TRP CE3 CZ3 doub Y N 475 TRP CE3 HE3 sing N N 476 TRP CZ2 CH2 doub Y N 477 TRP CZ2 HZ2 sing N N 478 TRP CZ3 CH2 sing Y N 479 TRP CZ3 HZ3 sing N N 480 TRP CH2 HH2 sing N N 481 TRP OXT HXT sing N N 482 TYR N CA sing N N 483 TYR N H sing N N 484 TYR N H2 sing N N 485 TYR CA C sing N N 486 TYR CA CB sing N N 487 TYR CA HA sing N N 488 TYR C O doub N N 489 TYR C OXT sing N N 490 TYR CB CG sing N N 491 TYR CB HB2 sing N N 492 TYR CB HB3 sing N N 493 TYR CG CD1 doub Y N 494 TYR CG CD2 sing Y N 495 TYR CD1 CE1 sing Y N 496 TYR CD1 HD1 sing N N 497 TYR CD2 CE2 doub Y N 498 TYR CD2 HD2 sing N N 499 TYR CE1 CZ doub Y N 500 TYR CE1 HE1 sing N N 501 TYR CE2 CZ sing Y N 502 TYR CE2 HE2 sing N N 503 TYR CZ OH sing N N 504 TYR OH HH sing N N 505 TYR OXT HXT sing N N 506 VAL N CA sing N N 507 VAL N H sing N N 508 VAL N H2 sing N N 509 VAL CA C sing N N 510 VAL CA CB sing N N 511 VAL CA HA sing N N 512 VAL C O doub N N 513 VAL C OXT sing N N 514 VAL CB CG1 sing N N 515 VAL CB CG2 sing N N 516 VAL CB HB sing N N 517 VAL CG1 HG11 sing N N 518 VAL CG1 HG12 sing N N 519 VAL CG1 HG13 sing N N 520 VAL CG2 HG21 sing N N 521 VAL CG2 HG22 sing N N 522 VAL CG2 HG23 sing N N 523 VAL OXT HXT sing N N 524 # loop_ _ndb_struct_conf_na.entry_id _ndb_struct_conf_na.feature 6UVW 'double helix' 6UVW 'b-form double helix' # loop_ _ndb_struct_na_base_pair.model_number _ndb_struct_na_base_pair.i_label_asym_id _ndb_struct_na_base_pair.i_label_comp_id _ndb_struct_na_base_pair.i_label_seq_id _ndb_struct_na_base_pair.i_symmetry _ndb_struct_na_base_pair.j_label_asym_id _ndb_struct_na_base_pair.j_label_comp_id _ndb_struct_na_base_pair.j_label_seq_id _ndb_struct_na_base_pair.j_symmetry _ndb_struct_na_base_pair.shear _ndb_struct_na_base_pair.stretch _ndb_struct_na_base_pair.stagger _ndb_struct_na_base_pair.buckle _ndb_struct_na_base_pair.propeller _ndb_struct_na_base_pair.opening _ndb_struct_na_base_pair.pair_number _ndb_struct_na_base_pair.pair_name _ndb_struct_na_base_pair.i_auth_asym_id _ndb_struct_na_base_pair.i_auth_seq_id _ndb_struct_na_base_pair.i_PDB_ins_code _ndb_struct_na_base_pair.j_auth_asym_id _ndb_struct_na_base_pair.j_auth_seq_id _ndb_struct_na_base_pair.j_PDB_ins_code _ndb_struct_na_base_pair.hbond_type_28 _ndb_struct_na_base_pair.hbond_type_12 1 B DG 2 1_555 C DC 27 1_555 -0.688 -0.075 -0.232 -2.195 -11.844 3.180 1 B_DG0:DC26_C B 0 ? C 26 ? 19 1 1 B DG 3 1_555 C DC 26 1_555 -0.448 -0.225 0.360 -3.287 -18.022 8.008 2 B_DG1:DC25_C B 1 ? C 25 ? 19 1 1 B DT 4 1_555 C DA 25 1_555 -0.258 -0.229 0.383 -10.506 -15.822 4.890 3 B_DT2:DA24_C B 2 ? C 24 ? 20 1 1 B DT 5 1_555 C DA 24 1_555 -0.034 0.084 0.580 -17.619 -19.774 0.024 4 B_DT3:DA23_C B 3 ? C 23 ? 20 1 1 B DT 6 1_555 C DA 23 1_555 -0.768 -0.063 0.546 -16.095 -4.962 4.423 5 B_DT4:DA22_C B 4 ? C 22 ? 20 1 1 B DC 7 1_555 C DG 22 1_555 0.462 -0.173 0.404 -12.295 -9.277 3.359 6 B_DC5:DG21_C B 5 ? C 21 ? 19 1 1 B DC 8 1_555 C DG 21 1_555 0.666 -0.264 0.335 0.271 -4.259 1.046 7 B_DC6:DG20_C B 6 ? C 20 ? 19 1 1 B DA 9 1_555 C DT 20 1_555 -0.385 -0.147 0.228 2.329 -2.876 2.121 8 B_DA7:DT19_C B 7 ? C 19 ? 20 1 1 B DC 10 1_555 C DG 19 1_555 0.600 -0.142 -0.061 0.395 -4.244 6.809 9 B_DC8:DG18_C B 8 ? C 18 ? 19 1 1 B DT 11 1_555 C DA 18 1_555 -0.340 -0.209 0.345 -6.628 -11.276 0.181 10 B_DT9:DA17_C B 9 ? C 17 ? 20 1 1 B DT 12 1_555 C DA 17 1_555 0.416 0.003 -0.015 1.611 -19.194 6.919 11 B_DT10:DA16_C B 10 ? C 16 ? 20 1 1 B DA 13 1_555 C DT 16 1_555 0.346 -0.169 0.785 0.848 -20.711 6.411 12 B_DA11:DT15_C B 11 ? C 15 ? 20 1 1 B DT 14 1_555 C DA 15 1_555 0.150 -0.237 0.189 -1.943 -22.429 0.262 13 B_DT12:DA14_C B 12 ? C 14 ? 20 1 1 B DT 15 1_555 C DA 14 1_555 -0.371 -0.197 0.200 -11.388 -30.557 2.722 14 B_DT13:DA13_C B 13 ? C 13 ? 20 1 1 B DC 16 1_555 C DG 13 1_555 0.099 -0.303 0.345 -21.106 -19.889 1.138 15 B_DC14:DG12_C B 14 ? C 12 ? 19 1 1 B DA 17 1_555 C DT 12 1_555 0.173 -0.186 0.086 -6.578 -13.516 1.573 16 B_DA15:DT11_C B 15 ? C 11 ? 20 1 1 B DA 18 1_555 C DT 11 1_555 -0.026 0.010 0.206 3.200 -15.721 1.356 17 B_DA16:DT10_C B 16 ? C 10 ? 20 1 1 B DC 19 1_555 C DG 10 1_555 0.460 -0.157 0.259 5.322 -15.266 -2.462 18 B_DC17:DG9_C B 17 ? C 9 ? 19 1 1 B DC 20 1_555 C DG 9 1_555 0.104 -0.197 0.249 -8.842 -8.003 6.627 19 B_DC18:DG8_C B 18 ? C 8 ? 19 1 1 B DT 21 1_555 C DA 8 1_555 -0.444 -0.091 -0.185 -0.073 -17.328 6.310 20 B_DT19:DA7_C B 19 ? C 7 ? 20 1 1 B DT 22 1_555 C DA 7 1_555 -0.487 -0.085 0.322 -0.651 -16.675 1.961 21 B_DT20:DA6_C B 20 ? C 6 ? 20 1 1 B DT 23 1_555 C DA 6 1_555 0.203 -0.118 0.527 -6.596 -12.088 7.170 22 B_DT21:DA5_C B 21 ? C 5 ? 20 1 1 B DT 24 1_555 C DA 5 1_555 -0.292 -0.400 0.310 -0.460 -6.099 1.975 23 B_DT22:DA4_C B 22 ? C 4 ? 20 1 1 B DA 25 1_555 C DT 4 1_555 0.002 -0.174 0.268 -9.283 -2.761 -3.429 24 B_DA23:DT3_C B 23 ? C 3 ? 20 1 1 B DG 26 1_555 C DC 3 1_555 -0.442 0.021 0.372 14.458 -4.913 8.478 25 B_DG24:DC2_C B 24 ? C 2 ? 19 1 1 B DG 27 1_555 C DC 2 1_555 0.446 0.051 0.344 9.436 -10.135 0.456 26 B_DG25:DC1_C B 25 ? C 1 ? 19 1 1 E DG 2 1_555 F DC 27 1_555 -0.241 0.011 0.802 1.050 -9.366 7.088 27 E_DG0:DC26_F E 0 ? F 26 ? 19 1 1 E DG 3 1_555 F DC 26 1_555 -0.480 -0.439 0.808 11.368 -18.920 -0.945 28 E_DG1:DC25_F E 1 ? F 25 ? 19 1 1 E DT 4 1_555 F DA 25 1_555 -0.025 -0.148 0.316 -0.657 -23.248 3.658 29 E_DT2:DA24_F E 2 ? F 24 ? 20 1 1 E DT 5 1_555 F DA 24 1_555 0.082 -0.117 0.809 -16.889 -18.798 -4.996 30 E_DT3:DA23_F E 3 ? F 23 ? 20 1 1 E DT 6 1_555 F DA 23 1_555 -0.902 -0.055 0.440 -14.720 -5.257 5.257 31 E_DT4:DA22_F E 4 ? F 22 ? 20 1 1 E DC 7 1_555 F DG 22 1_555 0.193 -0.132 0.554 -5.950 -7.786 5.051 32 E_DC5:DG21_F E 5 ? F 21 ? 19 1 1 E DC 8 1_555 F DG 21 1_555 0.580 -0.274 0.404 1.641 -3.810 1.234 33 E_DC6:DG20_F E 6 ? F 20 ? 19 1 1 E DA 9 1_555 F DT 20 1_555 -0.015 0.027 0.558 7.623 -2.848 4.787 34 E_DA7:DT19_F E 7 ? F 19 ? 20 1 1 E DC 10 1_555 F DG 19 1_555 0.744 -0.006 0.212 -0.842 -6.200 8.071 35 E_DC8:DG18_F E 8 ? F 18 ? 19 1 1 E DT 11 1_555 F DA 18 1_555 -0.168 -0.149 0.261 -7.169 -6.954 -0.578 36 E_DT9:DA17_F E 9 ? F 17 ? 20 1 1 E DT 12 1_555 F DA 17 1_555 0.378 -0.040 -0.191 5.148 -14.022 5.699 37 E_DT10:DA16_F E 10 ? F 16 ? 20 1 1 E DA 13 1_555 F DT 16 1_555 0.019 -0.401 0.571 2.662 -21.859 4.270 38 E_DA11:DT15_F E 11 ? F 15 ? 20 1 1 E DT 14 1_555 F DA 15 1_555 -0.176 -0.348 0.121 -4.229 -20.390 -1.640 39 E_DT12:DA14_F E 12 ? F 14 ? 20 1 1 E DT 15 1_555 F DA 14 1_555 -0.498 0.151 0.456 -13.034 -29.090 7.275 40 E_DT13:DA13_F E 13 ? F 13 ? 20 1 1 E DC 16 1_555 F DG 13 1_555 0.123 -0.095 0.365 -20.585 -18.622 2.090 41 E_DC14:DG12_F E 14 ? F 12 ? 19 1 1 E DA 17 1_555 F DT 12 1_555 -0.401 -0.040 0.344 -4.318 -16.308 4.296 42 E_DA15:DT11_F E 15 ? F 11 ? 20 1 1 E DA 18 1_555 F DT 11 1_555 0.419 -0.072 0.474 4.758 -11.623 0.914 43 E_DA16:DT10_F E 16 ? F 10 ? 20 1 1 E DC 19 1_555 F DG 10 1_555 0.553 -0.140 0.215 4.973 -14.799 0.842 44 E_DC17:DG9_F E 17 ? F 9 ? 19 1 1 E DC 20 1_555 F DG 9 1_555 0.295 -0.388 0.193 -8.945 -7.878 4.278 45 E_DC18:DG8_F E 18 ? F 8 ? 19 1 1 E DT 21 1_555 F DA 8 1_555 -0.248 -0.019 0.042 -1.433 -14.807 5.896 46 E_DT19:DA7_F E 19 ? F 7 ? 20 1 1 E DT 22 1_555 F DA 7 1_555 -0.246 -0.186 0.383 -1.006 -15.763 -1.561 47 E_DT20:DA6_F E 20 ? F 6 ? 20 1 1 E DT 23 1_555 F DA 6 1_555 -0.286 -0.139 0.428 -3.318 -10.162 2.782 48 E_DT21:DA5_F E 21 ? F 5 ? 20 1 1 E DT 24 1_555 F DA 5 1_555 -0.076 -0.115 0.455 0.243 -8.929 4.413 49 E_DT22:DA4_F E 22 ? F 4 ? 20 1 1 E DA 25 1_555 F DT 4 1_555 0.392 -0.184 0.044 -10.479 -3.041 -2.745 50 E_DA23:DT3_F E 23 ? F 3 ? 20 1 1 E DG 26 1_555 F DC 3 1_555 0.174 -0.385 0.113 4.915 -9.169 0.088 51 E_DG24:DC2_F E 24 ? F 2 ? 19 1 1 E DG 27 1_555 F DC 2 1_555 0.124 -0.081 0.746 17.037 -14.820 -2.965 52 E_DG25:DC1_F E 25 ? F 1 ? 19 1 # loop_ _ndb_struct_na_base_pair_step.model_number _ndb_struct_na_base_pair_step.i_label_asym_id_1 _ndb_struct_na_base_pair_step.i_label_comp_id_1 _ndb_struct_na_base_pair_step.i_label_seq_id_1 _ndb_struct_na_base_pair_step.i_symmetry_1 _ndb_struct_na_base_pair_step.j_label_asym_id_1 _ndb_struct_na_base_pair_step.j_label_comp_id_1 _ndb_struct_na_base_pair_step.j_label_seq_id_1 _ndb_struct_na_base_pair_step.j_symmetry_1 _ndb_struct_na_base_pair_step.i_label_asym_id_2 _ndb_struct_na_base_pair_step.i_label_comp_id_2 _ndb_struct_na_base_pair_step.i_label_seq_id_2 _ndb_struct_na_base_pair_step.i_symmetry_2 _ndb_struct_na_base_pair_step.j_label_asym_id_2 _ndb_struct_na_base_pair_step.j_label_comp_id_2 _ndb_struct_na_base_pair_step.j_label_seq_id_2 _ndb_struct_na_base_pair_step.j_symmetry_2 _ndb_struct_na_base_pair_step.shift _ndb_struct_na_base_pair_step.slide _ndb_struct_na_base_pair_step.rise _ndb_struct_na_base_pair_step.tilt _ndb_struct_na_base_pair_step.roll _ndb_struct_na_base_pair_step.twist _ndb_struct_na_base_pair_step.x_displacement _ndb_struct_na_base_pair_step.y_displacement _ndb_struct_na_base_pair_step.helical_rise _ndb_struct_na_base_pair_step.inclination _ndb_struct_na_base_pair_step.tip _ndb_struct_na_base_pair_step.helical_twist _ndb_struct_na_base_pair_step.step_number _ndb_struct_na_base_pair_step.step_name _ndb_struct_na_base_pair_step.i_auth_asym_id_1 _ndb_struct_na_base_pair_step.i_auth_seq_id_1 _ndb_struct_na_base_pair_step.i_PDB_ins_code_1 _ndb_struct_na_base_pair_step.j_auth_asym_id_1 _ndb_struct_na_base_pair_step.j_auth_seq_id_1 _ndb_struct_na_base_pair_step.j_PDB_ins_code_1 _ndb_struct_na_base_pair_step.i_auth_asym_id_2 _ndb_struct_na_base_pair_step.i_auth_seq_id_2 _ndb_struct_na_base_pair_step.i_PDB_ins_code_2 _ndb_struct_na_base_pair_step.j_auth_asym_id_2 _ndb_struct_na_base_pair_step.j_auth_seq_id_2 _ndb_struct_na_base_pair_step.j_PDB_ins_code_2 1 B DG 2 1_555 C DC 27 1_555 B DG 3 1_555 C DC 26 1_555 0.906 -1.168 3.334 -1.194 4.578 31.677 -2.935 -1.856 3.104 8.329 2.172 32.019 1 BB_DG0DG1:DC25DC26_CC B 0 ? C 26 ? B 1 ? C 25 ? 1 B DG 3 1_555 C DC 26 1_555 B DT 4 1_555 C DA 25 1_555 -0.491 -1.202 3.358 1.990 0.526 34.047 -2.135 1.159 3.306 0.898 -3.395 34.107 2 BB_DG1DT2:DA24DC25_CC B 1 ? C 25 ? B 2 ? C 24 ? 1 B DT 4 1_555 C DA 25 1_555 B DT 5 1_555 C DA 24 1_555 -0.385 -0.688 3.332 0.584 -5.155 37.362 -0.376 0.674 3.387 -8.000 -0.906 37.707 3 BB_DT2DT3:DA23DA24_CC B 2 ? C 24 ? B 3 ? C 23 ? 1 B DT 5 1_555 C DA 24 1_555 B DT 6 1_555 C DA 23 1_555 0.660 -0.169 3.241 0.947 -8.695 36.780 0.862 -0.897 3.212 -13.546 -1.476 37.770 4 BB_DT3DT4:DA22DA23_CC B 3 ? C 23 ? B 4 ? C 22 ? 1 B DT 6 1_555 C DA 23 1_555 B DC 7 1_555 C DG 22 1_555 -0.495 -0.435 3.282 -0.321 -2.676 34.275 -0.315 0.787 3.310 -4.532 0.544 34.377 5 BB_DT4DC5:DG21DA22_CC B 4 ? C 22 ? B 5 ? C 21 ? 1 B DC 7 1_555 C DG 22 1_555 B DC 8 1_555 C DG 21 1_555 -0.440 -0.677 2.931 0.454 2.957 29.228 -1.896 0.953 2.843 5.840 -0.897 29.377 6 BB_DC5DC6:DG20DG21_CC B 5 ? C 21 ? B 6 ? C 20 ? 1 B DC 8 1_555 C DG 21 1_555 B DA 9 1_555 C DT 20 1_555 0.074 -0.102 3.172 -2.499 0.595 35.203 -0.254 -0.480 3.157 0.981 4.125 35.294 7 BB_DC6DA7:DT19DG20_CC B 6 ? C 20 ? B 7 ? C 19 ? 1 B DA 9 1_555 C DT 20 1_555 B DC 10 1_555 C DG 19 1_555 0.864 -1.458 3.464 1.164 -2.565 33.871 -2.052 -1.277 3.588 -4.394 -1.994 33.985 8 BB_DA7DC8:DG18DT19_CC B 7 ? C 19 ? B 8 ? C 18 ? 1 B DC 10 1_555 C DG 19 1_555 B DT 11 1_555 C DA 18 1_555 -1.049 -1.428 3.558 -2.449 -1.948 25.855 -2.571 1.578 3.735 -4.334 5.448 26.040 9 BB_DC8DT9:DA17DG18_CC B 8 ? C 18 ? B 9 ? C 17 ? 1 B DT 11 1_555 C DA 18 1_555 B DT 12 1_555 C DA 17 1_555 -0.370 -0.652 2.961 2.347 1.219 36.483 -1.190 0.880 2.910 1.943 -3.743 36.575 10 BB_DT9DT10:DA16DA17_CC B 9 ? C 17 ? B 10 ? C 16 ? 1 B DT 12 1_555 C DA 17 1_555 B DA 13 1_555 C DT 16 1_555 -0.089 0.496 3.210 -9.631 4.920 39.028 0.167 -0.947 3.181 7.198 14.089 40.442 11 BB_DT10DA11:DT15DA16_CC B 10 ? C 16 ? B 11 ? C 15 ? 1 B DA 13 1_555 C DT 16 1_555 B DT 14 1_555 C DA 15 1_555 -0.874 -0.543 3.268 4.233 -6.767 31.299 0.225 2.324 3.171 -12.295 -7.690 32.276 12 BB_DA11DT12:DA14DT15_CC B 11 ? C 15 ? B 12 ? C 14 ? 1 B DT 14 1_555 C DA 15 1_555 B DT 15 1_555 C DA 14 1_555 0.261 2.172 3.438 2.121 -19.553 49.506 3.614 -0.164 2.483 -22.357 -2.426 53.040 13 BB_DT12DT13:DA13DA14_CC B 12 ? C 14 ? B 13 ? C 13 ? 1 B DT 15 1_555 C DA 14 1_555 B DC 16 1_555 C DG 13 1_555 0.569 0.716 3.612 -0.461 -9.276 37.847 2.288 -0.915 3.345 -14.043 0.699 38.930 14 BB_DT13DC14:DG12DA13_CC B 13 ? C 13 ? B 14 ? C 12 ? 1 B DC 16 1_555 C DG 13 1_555 B DA 17 1_555 C DT 12 1_555 0.172 1.010 3.273 5.840 3.082 34.952 1.197 0.585 3.332 5.075 -9.617 35.551 15 BB_DC14DA15:DT11DG12_CC B 14 ? C 12 ? B 15 ? C 11 ? 1 B DA 17 1_555 C DT 12 1_555 B DA 18 1_555 C DT 11 1_555 0.325 -0.539 3.033 1.877 -0.022 30.015 -1.035 -0.268 3.048 -0.043 -3.620 30.073 16 BB_DA15DA16:DT10DT11_CC B 15 ? C 11 ? B 16 ? C 10 ? 1 B DA 18 1_555 C DT 11 1_555 B DC 19 1_555 C DG 10 1_555 0.664 -0.865 3.265 -2.362 -0.055 36.853 -1.358 -1.364 3.219 -0.087 3.731 36.926 17 BB_DA16DC17:DG9DT10_CC B 16 ? C 10 ? B 17 ? C 9 ? 1 B DC 19 1_555 C DG 10 1_555 B DC 20 1_555 C DG 9 1_555 0.176 -1.354 3.692 1.969 2.433 23.915 -4.105 0.277 3.541 5.840 -4.726 24.117 18 BB_DC17DC18:DG8DG9_CC B 17 ? C 9 ? B 18 ? C 8 ? 1 B DC 20 1_555 C DG 9 1_555 B DT 21 1_555 C DA 8 1_555 -0.376 -1.119 3.013 6.723 8.929 26.589 -3.957 2.042 2.359 18.413 -13.864 28.804 19 BB_DC18DT19:DA7DG8_CC B 18 ? C 8 ? B 19 ? C 7 ? 1 B DT 21 1_555 C DA 8 1_555 B DT 22 1_555 C DA 7 1_555 -0.031 -0.439 3.361 -3.387 -3.436 37.427 -0.219 -0.405 3.377 -5.328 5.251 37.725 20 BB_DT19DT20:DA6DA7_CC B 19 ? C 7 ? B 20 ? C 6 ? 1 B DT 22 1_555 C DA 7 1_555 B DT 23 1_555 C DA 6 1_555 0.177 -0.564 3.605 -1.695 -8.776 36.757 0.398 -0.518 3.629 -13.670 2.640 37.791 21 BB_DT20DT21:DA5DA6_CC B 20 ? C 6 ? B 21 ? C 5 ? 1 B DT 23 1_555 C DA 6 1_555 B DT 24 1_555 C DA 5 1_555 -0.269 -0.637 3.160 0.441 -9.129 33.113 0.342 0.524 3.213 -15.651 -0.756 34.317 22 BB_DT21DT22:DA4DA5_CC B 21 ? C 5 ? B 22 ? C 4 ? 1 B DT 24 1_555 C DA 5 1_555 B DA 25 1_555 C DT 4 1_555 -0.112 -0.444 3.425 0.674 -6.652 43.066 0.079 0.219 3.451 -8.996 -0.911 43.558 23 BB_DT22DA23:DT3DA4_CC B 22 ? C 4 ? B 23 ? C 3 ? 1 B DA 25 1_555 C DT 4 1_555 B DG 26 1_555 C DC 3 1_555 0.660 -0.548 2.881 -2.470 1.443 26.045 -1.547 -2.036 2.773 3.191 5.459 26.199 24 BB_DA23DG24:DC2DT3_CC B 23 ? C 3 ? B 24 ? C 2 ? 1 B DG 26 1_555 C DC 3 1_555 B DG 27 1_555 C DC 2 1_555 -0.583 -0.492 3.320 -2.449 6.192 37.972 -1.519 0.577 3.234 9.428 3.729 38.531 25 BB_DG24DG25:DC1DC2_CC B 24 ? C 2 ? B 25 ? C 1 ? 1 E DG 2 1_555 F DC 27 1_555 E DG 3 1_555 F DC 26 1_555 0.510 -0.826 3.018 2.862 3.382 27.930 -2.410 -0.436 2.936 6.951 -5.883 28.273 26 EE_DG0DG1:DC25DC26_FF E 0 ? F 26 ? E 1 ? F 25 ? 1 E DG 3 1_555 F DC 26 1_555 E DT 4 1_555 F DA 25 1_555 0.276 -0.972 3.499 6.280 0.852 35.928 -1.680 0.493 3.473 1.368 -10.084 36.464 27 EE_DG1DT2:DA24DC25_FF E 1 ? F 25 ? E 2 ? F 24 ? 1 E DT 4 1_555 F DA 25 1_555 E DT 5 1_555 F DA 24 1_555 -0.367 -0.795 3.588 -2.128 -3.656 37.413 -0.705 0.261 3.661 -5.677 3.304 37.643 28 EE_DT2DT3:DA23DA24_FF E 2 ? F 24 ? E 3 ? F 23 ? 1 E DT 5 1_555 F DA 24 1_555 E DT 6 1_555 F DA 23 1_555 0.898 -0.149 3.321 3.928 -11.798 35.794 1.347 -0.860 3.284 -18.521 -6.166 37.826 29 EE_DT3DT4:DA22DA23_FF E 3 ? F 23 ? E 4 ? F 22 ? 1 E DT 6 1_555 F DA 23 1_555 E DC 7 1_555 F DG 22 1_555 -0.363 -0.388 3.108 -1.674 -3.496 33.638 -0.127 0.365 3.145 -6.017 2.881 33.854 30 EE_DT4DC5:DG21DA22_FF E 4 ? F 22 ? E 5 ? F 21 ? 1 E DC 7 1_555 F DG 22 1_555 E DC 8 1_555 F DG 21 1_555 -0.520 -0.710 3.140 0.477 5.894 30.178 -2.424 1.069 2.944 11.185 -0.905 30.739 31 EE_DC5DC6:DG20DG21_FF E 5 ? F 21 ? E 6 ? F 20 ? 1 E DC 8 1_555 F DG 21 1_555 E DA 9 1_555 F DT 20 1_555 0.078 0.000 3.061 -3.828 -2.186 36.109 0.284 -0.624 3.032 -3.510 6.147 36.368 32 EE_DC6DA7:DT19DG20_FF E 6 ? F 20 ? E 7 ? F 19 ? 1 E DA 9 1_555 F DT 20 1_555 E DC 10 1_555 F DG 19 1_555 0.828 -1.559 3.688 1.797 -1.052 33.569 -2.499 -1.097 3.772 -1.818 -3.108 33.632 33 EE_DA7DC8:DG18DT19_FF E 7 ? F 19 ? E 8 ? F 18 ? 1 E DC 10 1_555 F DG 19 1_555 E DT 11 1_555 F DA 18 1_555 -1.211 -1.497 3.499 -2.160 -1.943 24.984 -2.807 2.081 3.692 -4.472 4.971 25.150 34 EE_DC8DT9:DA17DG18_FF E 8 ? F 18 ? E 9 ? F 17 ? 1 E DT 11 1_555 F DA 18 1_555 E DT 12 1_555 F DA 17 1_555 -0.361 -0.687 2.850 2.847 1.302 34.517 -1.325 0.983 2.785 2.189 -4.786 34.654 35 EE_DT9DT10:DA16DA17_FF E 9 ? F 17 ? E 10 ? F 16 ? 1 E DT 12 1_555 F DA 17 1_555 E DA 13 1_555 F DT 16 1_555 -0.117 0.511 3.379 -8.996 3.566 38.702 0.318 -0.916 3.355 5.280 13.322 39.849 36 EE_DT10DA11:DT15DA16_FF E 10 ? F 16 ? E 11 ? F 15 ? 1 E DA 13 1_555 F DT 16 1_555 E DT 14 1_555 F DA 15 1_555 -0.870 -0.518 3.377 2.439 -6.325 31.736 0.228 2.002 3.341 -11.404 -4.397 32.434 37 EE_DA11DT12:DA14DT15_FF E 11 ? F 15 ? E 12 ? F 14 ? 1 E DT 14 1_555 F DA 15 1_555 E DT 15 1_555 F DA 14 1_555 0.565 2.175 3.454 2.580 -19.694 49.611 3.620 -0.475 2.508 -22.461 -2.942 53.205 38 EE_DT12DT13:DA13DA14_FF E 12 ? F 14 ? E 13 ? F 13 ? 1 E DT 15 1_555 F DA 14 1_555 E DC 16 1_555 F DG 13 1_555 0.375 0.867 3.637 0.649 -9.947 38.441 2.535 -0.471 3.326 -14.805 -0.967 39.665 39 EE_DT13DC14:DG12DA13_FF E 13 ? F 13 ? E 14 ? F 12 ? 1 E DC 16 1_555 F DG 13 1_555 E DA 17 1_555 F DT 12 1_555 0.381 0.909 3.240 5.879 1.257 32.628 1.380 0.327 3.288 2.213 -10.356 33.162 40 EE_DC14DA15:DT11DG12_FF E 14 ? F 12 ? E 15 ? F 11 ? 1 E DA 17 1_555 F DT 12 1_555 E DA 18 1_555 F DT 11 1_555 0.277 -0.331 3.075 0.015 1.324 34.393 -0.753 -0.466 3.061 2.237 -0.026 34.418 41 EE_DA15DA16:DT10DT11_FF E 15 ? F 11 ? E 16 ? F 10 ? 1 E DA 18 1_555 F DT 11 1_555 E DC 19 1_555 F DG 10 1_555 0.780 -1.001 3.382 -0.960 2.082 34.926 -1.984 -1.445 3.297 3.464 1.597 34.999 42 EE_DA16DC17:DG9DT10_FF E 16 ? F 10 ? E 17 ? F 9 ? 1 E DC 19 1_555 F DG 10 1_555 E DC 20 1_555 F DG 9 1_555 -0.287 -1.207 3.761 1.291 -0.511 25.491 -2.565 1.073 3.765 -1.157 -2.924 25.528 43 EE_DC17DC18:DG8DG9_FF E 17 ? F 9 ? E 18 ? F 8 ? 1 E DC 20 1_555 F DG 9 1_555 E DT 21 1_555 F DA 8 1_555 -0.209 -1.125 3.045 5.727 10.117 26.428 -4.212 1.525 2.367 20.890 -11.826 28.830 44 EE_DC18DT19:DA7DG8_FF E 18 ? F 8 ? E 19 ? F 7 ? 1 E DT 21 1_555 F DA 8 1_555 E DT 22 1_555 F DA 7 1_555 -0.347 -0.581 3.350 -2.531 -7.104 37.625 0.043 0.198 3.416 -10.881 3.876 38.346 45 EE_DT19DT20:DA6DA7_FF E 19 ? F 7 ? E 20 ? F 6 ? 1 E DT 22 1_555 F DA 7 1_555 E DT 23 1_555 F DA 6 1_555 0.244 -0.826 3.388 -0.183 -8.187 32.854 -0.009 -0.450 3.486 -14.202 0.318 33.832 46 EE_DT20DT21:DA5DA6_FF E 20 ? F 6 ? E 21 ? F 5 ? 1 E DT 23 1_555 F DA 6 1_555 E DT 24 1_555 F DA 5 1_555 0.130 -0.598 3.243 0.113 -7.607 35.316 0.123 -0.193 3.298 -12.362 -0.184 36.100 47 EE_DT21DT22:DA4DA5_FF E 21 ? F 5 ? E 22 ? F 4 ? 1 E DT 24 1_555 F DA 5 1_555 E DA 25 1_555 F DT 4 1_555 -0.205 -0.413 3.642 2.779 -9.874 43.465 0.478 0.557 3.629 -13.116 -3.692 44.602 48 EE_DT22DA23:DT3DA4_FF E 22 ? F 4 ? E 23 ? F 3 ? 1 E DA 25 1_555 F DT 4 1_555 E DG 26 1_555 F DC 3 1_555 0.015 -0.712 3.034 -1.970 5.209 28.053 -2.515 -0.436 2.851 10.614 4.014 28.590 49 EE_DA23DG24:DC2DT3_FF E 23 ? F 3 ? E 24 ? F 2 ? 1 E DG 26 1_555 F DC 3 1_555 E DG 27 1_555 F DC 2 1_555 -1.093 -0.915 2.891 -9.858 1.766 31.510 -1.887 0.373 3.032 3.154 17.604 33.025 50 EE_DG24DG25:DC1DC2_FF E 24 ? F 2 ? E 25 ? F 1 ? # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'R01 GM105691' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 4 'CALCIUM ION' CA 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3QQY _pdbx_initial_refinement_model.details ? # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 none ? 2 2 none ? #