data_6UWF # _entry.id 6UWF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.336 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6UWF WWPDB D_1000245298 EMDB EMD-20922 # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'GltPh in complex with L-aspartate and sodium ions in outward-facing state' _pdbx_database_related.db_id EMD-20922 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6UWF _pdbx_database_status.recvd_initial_deposition_date 2019-11-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, X.' 1 0000-0002-8745-8238 'Boudker, O.' 2 0000-0001-6965-0851 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Chem.Biol. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1552-4469 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first 1006 _citation.page_last 1012 _citation.title 'Use of paramagnetic 19 F NMR to monitor domain movement in a glutamate transporter homolog.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41589-020-0561-6 _citation.pdbx_database_id_PubMed 32514183 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huang, Y.' 1 ? primary 'Wang, X.' 2 0000-0002-8745-8238 primary 'Lv, G.' 3 ? primary 'Razavi, A.M.' 4 ? primary 'Huysmans, G.H.M.' 5 0000-0003-4156-8252 primary 'Weinstein, H.' 6 ? primary 'Bracken, C.' 7 ? primary 'Eliezer, D.' 8 0000-0002-1311-7537 primary 'Boudker, O.' 9 0000-0001-6965-0851 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 6UWF _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6UWF _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Glutamate transporter homolog' 44669.957 1 ? ? ? ? 2 non-polymer syn 'ASPARTIC ACID' 133.103 1 ? ? ? ? 3 non-polymer syn '[(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate' 717.996 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Gltph,Glt(Ph),Sodium-aspartate symporter Glt(Ph),Sodium-dependent aspartate transporter' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(FME)GLYRKYIEYPVLQKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPIVFASLVVGAASISPA RLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQQFQPHQAPPLVHILLDIVPTNPFGALANGQVLPTIF FAIILGIAITYLMNSENEKVRKSAETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHVVGELAKVTAAVY VGLTLQILLVYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYSFTLPLGATINMDGTAL YQGVCTFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGAIMLAMVLHSVGLPLTDPNVAAAYAMILGIDAILDMG RTMVNVTGDLTGTAIVAKTEGTLVPR ; _entity_poly.pdbx_seq_one_letter_code_can ;MGLYRKYIEYPVLQKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPIVFASLVVGAASISPARLGR VGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQQFQPHQAPPLVHILLDIVPTNPFGALANGQVLPTIFFAII LGIAITYLMNSENEKVRKSAETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHVVGELAKVTAAVYVGLT LQILLVYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYSFTLPLGATINMDGTALYQGV CTFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGAIMLAMVLHSVGLPLTDPNVAAAYAMILGIDAILDMGRTMV NVTGDLTGTAIVAKTEGTLVPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 FME n 1 2 GLY n 1 3 LEU n 1 4 TYR n 1 5 ARG n 1 6 LYS n 1 7 TYR n 1 8 ILE n 1 9 GLU n 1 10 TYR n 1 11 PRO n 1 12 VAL n 1 13 LEU n 1 14 GLN n 1 15 LYS n 1 16 ILE n 1 17 LEU n 1 18 ILE n 1 19 GLY n 1 20 LEU n 1 21 ILE n 1 22 LEU n 1 23 GLY n 1 24 ALA n 1 25 ILE n 1 26 VAL n 1 27 GLY n 1 28 LEU n 1 29 ILE n 1 30 LEU n 1 31 GLY n 1 32 HIS n 1 33 TYR n 1 34 GLY n 1 35 TYR n 1 36 ALA n 1 37 HIS n 1 38 ALA n 1 39 VAL n 1 40 HIS n 1 41 THR n 1 42 TYR n 1 43 VAL n 1 44 LYS n 1 45 PRO n 1 46 PHE n 1 47 GLY n 1 48 ASP n 1 49 LEU n 1 50 PHE n 1 51 VAL n 1 52 ARG n 1 53 LEU n 1 54 LEU n 1 55 LYS n 1 56 MET n 1 57 LEU n 1 58 VAL n 1 59 MET n 1 60 PRO n 1 61 ILE n 1 62 VAL n 1 63 PHE n 1 64 ALA n 1 65 SER n 1 66 LEU n 1 67 VAL n 1 68 VAL n 1 69 GLY n 1 70 ALA n 1 71 ALA n 1 72 SER n 1 73 ILE n 1 74 SER n 1 75 PRO n 1 76 ALA n 1 77 ARG n 1 78 LEU n 1 79 GLY n 1 80 ARG n 1 81 VAL n 1 82 GLY n 1 83 VAL n 1 84 LYS n 1 85 ILE n 1 86 VAL n 1 87 VAL n 1 88 TYR n 1 89 TYR n 1 90 LEU n 1 91 LEU n 1 92 THR n 1 93 SER n 1 94 ALA n 1 95 PHE n 1 96 ALA n 1 97 VAL n 1 98 THR n 1 99 LEU n 1 100 GLY n 1 101 ILE n 1 102 ILE n 1 103 MET n 1 104 ALA n 1 105 ARG n 1 106 LEU n 1 107 PHE n 1 108 ASN n 1 109 PRO n 1 110 GLY n 1 111 ALA n 1 112 GLY n 1 113 ILE n 1 114 HIS n 1 115 LEU n 1 116 ALA n 1 117 VAL n 1 118 GLY n 1 119 GLY n 1 120 GLN n 1 121 GLN n 1 122 PHE n 1 123 GLN n 1 124 PRO n 1 125 HIS n 1 126 GLN n 1 127 ALA n 1 128 PRO n 1 129 PRO n 1 130 LEU n 1 131 VAL n 1 132 HIS n 1 133 ILE n 1 134 LEU n 1 135 LEU n 1 136 ASP n 1 137 ILE n 1 138 VAL n 1 139 PRO n 1 140 THR n 1 141 ASN n 1 142 PRO n 1 143 PHE n 1 144 GLY n 1 145 ALA n 1 146 LEU n 1 147 ALA n 1 148 ASN n 1 149 GLY n 1 150 GLN n 1 151 VAL n 1 152 LEU n 1 153 PRO n 1 154 THR n 1 155 ILE n 1 156 PHE n 1 157 PHE n 1 158 ALA n 1 159 ILE n 1 160 ILE n 1 161 LEU n 1 162 GLY n 1 163 ILE n 1 164 ALA n 1 165 ILE n 1 166 THR n 1 167 TYR n 1 168 LEU n 1 169 MET n 1 170 ASN n 1 171 SER n 1 172 GLU n 1 173 ASN n 1 174 GLU n 1 175 LYS n 1 176 VAL n 1 177 ARG n 1 178 LYS n 1 179 SER n 1 180 ALA n 1 181 GLU n 1 182 THR n 1 183 LEU n 1 184 LEU n 1 185 ASP n 1 186 ALA n 1 187 ILE n 1 188 ASN n 1 189 GLY n 1 190 LEU n 1 191 ALA n 1 192 GLU n 1 193 ALA n 1 194 MET n 1 195 TYR n 1 196 LYS n 1 197 ILE n 1 198 VAL n 1 199 ASN n 1 200 GLY n 1 201 VAL n 1 202 MET n 1 203 GLN n 1 204 TYR n 1 205 ALA n 1 206 PRO n 1 207 ILE n 1 208 GLY n 1 209 VAL n 1 210 PHE n 1 211 ALA n 1 212 LEU n 1 213 ILE n 1 214 ALA n 1 215 TYR n 1 216 VAL n 1 217 MET n 1 218 ALA n 1 219 GLU n 1 220 GLN n 1 221 GLY n 1 222 VAL n 1 223 HIS n 1 224 VAL n 1 225 VAL n 1 226 GLY n 1 227 GLU n 1 228 LEU n 1 229 ALA n 1 230 LYS n 1 231 VAL n 1 232 THR n 1 233 ALA n 1 234 ALA n 1 235 VAL n 1 236 TYR n 1 237 VAL n 1 238 GLY n 1 239 LEU n 1 240 THR n 1 241 LEU n 1 242 GLN n 1 243 ILE n 1 244 LEU n 1 245 LEU n 1 246 VAL n 1 247 TYR n 1 248 PHE n 1 249 VAL n 1 250 LEU n 1 251 LEU n 1 252 LYS n 1 253 ILE n 1 254 TYR n 1 255 GLY n 1 256 ILE n 1 257 ASP n 1 258 PRO n 1 259 ILE n 1 260 SER n 1 261 PHE n 1 262 ILE n 1 263 LYS n 1 264 HIS n 1 265 ALA n 1 266 LYS n 1 267 ASP n 1 268 ALA n 1 269 MET n 1 270 LEU n 1 271 THR n 1 272 ALA n 1 273 PHE n 1 274 VAL n 1 275 THR n 1 276 ARG n 1 277 SER n 1 278 SER n 1 279 SER n 1 280 GLY n 1 281 THR n 1 282 LEU n 1 283 PRO n 1 284 VAL n 1 285 THR n 1 286 MET n 1 287 ARG n 1 288 VAL n 1 289 ALA n 1 290 LYS n 1 291 GLU n 1 292 MET n 1 293 GLY n 1 294 ILE n 1 295 SER n 1 296 GLU n 1 297 GLY n 1 298 ILE n 1 299 TYR n 1 300 SER n 1 301 PHE n 1 302 THR n 1 303 LEU n 1 304 PRO n 1 305 LEU n 1 306 GLY n 1 307 ALA n 1 308 THR n 1 309 ILE n 1 310 ASN n 1 311 MET n 1 312 ASP n 1 313 GLY n 1 314 THR n 1 315 ALA n 1 316 LEU n 1 317 TYR n 1 318 GLN n 1 319 GLY n 1 320 VAL n 1 321 CYS n 1 322 THR n 1 323 PHE n 1 324 PHE n 1 325 ILE n 1 326 ALA n 1 327 ASN n 1 328 ALA n 1 329 LEU n 1 330 GLY n 1 331 SER n 1 332 HIS n 1 333 LEU n 1 334 THR n 1 335 VAL n 1 336 GLY n 1 337 GLN n 1 338 GLN n 1 339 LEU n 1 340 THR n 1 341 ILE n 1 342 VAL n 1 343 LEU n 1 344 THR n 1 345 ALA n 1 346 VAL n 1 347 LEU n 1 348 ALA n 1 349 SER n 1 350 ILE n 1 351 GLY n 1 352 THR n 1 353 ALA n 1 354 GLY n 1 355 VAL n 1 356 PRO n 1 357 GLY n 1 358 ALA n 1 359 GLY n 1 360 ALA n 1 361 ILE n 1 362 MET n 1 363 LEU n 1 364 ALA n 1 365 MET n 1 366 VAL n 1 367 LEU n 1 368 HIS n 1 369 SER n 1 370 VAL n 1 371 GLY n 1 372 LEU n 1 373 PRO n 1 374 LEU n 1 375 THR n 1 376 ASP n 1 377 PRO n 1 378 ASN n 1 379 VAL n 1 380 ALA n 1 381 ALA n 1 382 ALA n 1 383 TYR n 1 384 ALA n 1 385 MET n 1 386 ILE n 1 387 LEU n 1 388 GLY n 1 389 ILE n 1 390 ASP n 1 391 ALA n 1 392 ILE n 1 393 LEU n 1 394 ASP n 1 395 MET n 1 396 GLY n 1 397 ARG n 1 398 THR n 1 399 MET n 1 400 VAL n 1 401 ASN n 1 402 VAL n 1 403 THR n 1 404 GLY n 1 405 ASP n 1 406 LEU n 1 407 THR n 1 408 GLY n 1 409 THR n 1 410 ALA n 1 411 ILE n 1 412 VAL n 1 413 ALA n 1 414 LYS n 1 415 THR n 1 416 GLU n 1 417 GLY n 1 418 THR n 1 419 LEU n 1 420 VAL n 1 421 PRO n 1 422 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 422 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus horikoshii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 53953 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6UWF _struct_ref.pdbx_db_accession 6UWF _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6UWF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 422 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6UWF _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 422 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 422 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 6OU non-polymer . '[(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate' ? 'C39 H76 N O8 P' 717.996 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FME 'L-peptide linking' n N-FORMYLMETHIONINE ? 'C6 H11 N O3 S' 177.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6UWF _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6UWF _refine.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high . _refine.ls_d_res_low ? _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work ? _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'ELECTRON MICROSCOPY' ? 0.0050 ? 3237 ? f_bond_d ? ? 'ELECTRON MICROSCOPY' ? 0.8137 ? 4394 ? f_angle_d ? ? 'ELECTRON MICROSCOPY' ? 0.0476 ? 541 ? f_chiral_restr ? ? 'ELECTRON MICROSCOPY' ? 0.0076 ? 537 ? f_plane_restr ? ? 'ELECTRON MICROSCOPY' ? 7.3414 ? 1903 ? f_dihedral_angle_d ? ? # _struct.entry_id 6UWF _struct.title 'GltPh in complex with L-aspartate and sodium ions in outward-facing state' _struct.pdbx_descriptor 'Glutamate transporter homolog' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6UWF _struct_keywords.text 'aspartate transporter, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 2 ? GLU A 9 ? GLY A 2 GLU A 9 1 ? 8 HELX_P HELX_P2 AA2 PRO A 11 ? TYR A 33 ? PRO A 11 TYR A 33 1 ? 23 HELX_P HELX_P3 AA3 TYR A 35 ? VAL A 43 ? TYR A 35 VAL A 43 1 ? 9 HELX_P HELX_P4 AA4 LYS A 44 ? LEU A 57 ? LYS A 44 LEU A 57 1 ? 14 HELX_P HELX_P5 AA5 LEU A 57 ? GLY A 69 ? LEU A 57 GLY A 69 1 ? 13 HELX_P HELX_P6 AA6 PRO A 75 ? PHE A 107 ? PRO A 75 PHE A 107 1 ? 33 HELX_P HELX_P7 AA7 LEU A 130 ? ASP A 136 ? LEU A 130 ASP A 136 1 ? 7 HELX_P HELX_P8 AA8 ASN A 141 ? ASN A 148 ? ASN A 141 ASN A 148 1 ? 8 HELX_P HELX_P9 AA9 GLN A 150 ? MET A 169 ? GLN A 150 MET A 169 1 ? 20 HELX_P HELX_P10 AB1 ASN A 173 ? GLY A 221 ? ASN A 173 GLY A 221 1 ? 49 HELX_P HELX_P11 AB2 GLY A 226 ? LEU A 245 ? GLY A 226 LEU A 245 1 ? 20 HELX_P HELX_P12 AB3 VAL A 246 ? ILE A 253 ? VAL A 246 ILE A 253 1 ? 8 HELX_P HELX_P13 AB4 ASP A 257 ? ARG A 276 ? ASP A 257 ARG A 276 1 ? 20 HELX_P HELX_P14 AB5 THR A 281 ? MET A 292 ? THR A 281 MET A 292 1 ? 12 HELX_P HELX_P15 AB6 SER A 295 ? ALA A 307 ? SER A 295 ALA A 307 1 ? 13 HELX_P HELX_P16 AB7 MET A 311 ? LEU A 329 ? MET A 311 LEU A 329 1 ? 19 HELX_P HELX_P17 AB8 THR A 334 ? THR A 352 ? THR A 334 THR A 352 1 ? 19 HELX_P HELX_P18 AB9 GLY A 357 ? GLY A 371 ? GLY A 357 GLY A 371 1 ? 15 HELX_P HELX_P19 AC1 ASP A 376 ? ILE A 389 ? ASP A 376 ILE A 389 1 ? 14 HELX_P HELX_P20 AC2 ILE A 389 ? GLU A 416 ? ILE A 389 GLU A 416 1 ? 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A FME 1 C ? ? ? 1_555 A GLY 2 N ? ? A FME 1 A GLY 2 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale2 covale none ? A LYS 196 CD ? ? ? 1_555 D 6OU . N29 ? ? A LYS 196 A 6OU 503 1_555 ? ? ? ? ? ? ? 1.430 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ASP 501 ? 12 'binding site for residue ASP A 501' AC2 Software A 6OU 502 ? 5 'binding site for residue 6OU A 502' AC3 Software A 6OU 503 ? 4 'binding site for residue 6OU A 503' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 ARG A 276 ? ARG A 276 . ? 1_555 ? 2 AC1 12 SER A 278 ? SER A 278 . ? 1_555 ? 3 AC1 12 THR A 314 ? THR A 314 . ? 1_555 ? 4 AC1 12 GLY A 354 ? GLY A 354 . ? 1_555 ? 5 AC1 12 VAL A 355 ? VAL A 355 . ? 1_555 ? 6 AC1 12 GLY A 357 ? GLY A 357 . ? 1_555 ? 7 AC1 12 ALA A 358 ? ALA A 358 . ? 1_555 ? 8 AC1 12 GLY A 359 ? GLY A 359 . ? 1_555 ? 9 AC1 12 ASP A 394 ? ASP A 394 . ? 1_555 ? 10 AC1 12 ARG A 397 ? ARG A 397 . ? 1_555 ? 11 AC1 12 THR A 398 ? THR A 398 . ? 1_555 ? 12 AC1 12 ASN A 401 ? ASN A 401 . ? 1_555 ? 13 AC2 5 PRO A 128 ? PRO A 128 . ? 1_555 ? 14 AC2 5 ILE A 133 ? ILE A 133 . ? 1_555 ? 15 AC2 5 LEU A 347 ? LEU A 347 . ? 1_555 ? 16 AC2 5 GLY A 351 ? GLY A 351 . ? 1_555 ? 17 AC2 5 MET A 362 ? MET A 362 . ? 1_555 ? 18 AC3 4 TYR A 4 ? TYR A 4 . ? 1_555 ? 19 AC3 4 TYR A 7 ? TYR A 7 . ? 1_555 ? 20 AC3 4 LYS A 196 ? LYS A 196 . ? 1_555 ? 21 AC3 4 GLY A 200 ? GLY A 200 . ? 1_555 ? # _atom_sites.entry_id 6UWF _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 FME 1 1 1 FME FME A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 MET 103 103 103 MET MET A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 GLN 121 121 121 GLN GLN A . n A 1 122 PHE 122 122 122 PHE PHE A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 PRO 124 124 124 PRO PRO A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 GLN 126 126 126 GLN GLN A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 HIS 132 132 132 HIS HIS A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 PRO 142 142 142 PRO PRO A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 PHE 157 157 157 PHE PHE A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 ILE 165 165 165 ILE ILE A . n A 1 166 THR 166 166 166 THR THR A . n A 1 167 TYR 167 167 167 TYR TYR A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 MET 169 169 169 MET MET A . n A 1 170 ASN 170 170 170 ASN ASN A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 LYS 175 175 175 LYS LYS A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 ASP 185 185 185 ASP ASP A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 ASN 188 188 188 ASN ASN A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 MET 194 194 194 MET MET A . n A 1 195 TYR 195 195 195 TYR TYR A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 VAL 198 198 198 VAL VAL A . n A 1 199 ASN 199 199 199 ASN ASN A . n A 1 200 GLY 200 200 200 GLY GLY A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 MET 202 202 202 MET MET A . n A 1 203 GLN 203 203 203 GLN GLN A . n A 1 204 TYR 204 204 204 TYR TYR A . n A 1 205 ALA 205 205 205 ALA ALA A . n A 1 206 PRO 206 206 206 PRO PRO A . n A 1 207 ILE 207 207 207 ILE ILE A . n A 1 208 GLY 208 208 208 GLY GLY A . n A 1 209 VAL 209 209 209 VAL VAL A . n A 1 210 PHE 210 210 210 PHE PHE A . n A 1 211 ALA 211 211 211 ALA ALA A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 ILE 213 213 213 ILE ILE A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 TYR 215 215 215 TYR TYR A . n A 1 216 VAL 216 216 216 VAL VAL A . n A 1 217 MET 217 217 217 MET MET A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 GLN 220 220 220 GLN GLN A . n A 1 221 GLY 221 221 221 GLY GLY A . n A 1 222 VAL 222 222 222 VAL VAL A . n A 1 223 HIS 223 223 223 HIS HIS A . n A 1 224 VAL 224 224 224 VAL VAL A . n A 1 225 VAL 225 225 225 VAL VAL A . n A 1 226 GLY 226 226 226 GLY GLY A . n A 1 227 GLU 227 227 227 GLU GLU A . n A 1 228 LEU 228 228 228 LEU LEU A . n A 1 229 ALA 229 229 229 ALA ALA A . n A 1 230 LYS 230 230 230 LYS LYS A . n A 1 231 VAL 231 231 231 VAL VAL A . n A 1 232 THR 232 232 232 THR THR A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 ALA 234 234 234 ALA ALA A . n A 1 235 VAL 235 235 235 VAL VAL A . n A 1 236 TYR 236 236 236 TYR TYR A . n A 1 237 VAL 237 237 237 VAL VAL A . n A 1 238 GLY 238 238 238 GLY GLY A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 THR 240 240 240 THR THR A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 GLN 242 242 242 GLN GLN A . n A 1 243 ILE 243 243 243 ILE ILE A . n A 1 244 LEU 244 244 244 LEU LEU A . n A 1 245 LEU 245 245 245 LEU LEU A . n A 1 246 VAL 246 246 246 VAL VAL A . n A 1 247 TYR 247 247 247 TYR TYR A . n A 1 248 PHE 248 248 248 PHE PHE A . n A 1 249 VAL 249 249 249 VAL VAL A . n A 1 250 LEU 250 250 250 LEU LEU A . n A 1 251 LEU 251 251 251 LEU LEU A . n A 1 252 LYS 252 252 252 LYS LYS A . n A 1 253 ILE 253 253 253 ILE ILE A . n A 1 254 TYR 254 254 254 TYR TYR A . n A 1 255 GLY 255 255 255 GLY GLY A . n A 1 256 ILE 256 256 256 ILE ILE A . n A 1 257 ASP 257 257 257 ASP ASP A . n A 1 258 PRO 258 258 258 PRO PRO A . n A 1 259 ILE 259 259 259 ILE ILE A . n A 1 260 SER 260 260 260 SER SER A . n A 1 261 PHE 261 261 261 PHE PHE A . n A 1 262 ILE 262 262 262 ILE ILE A . n A 1 263 LYS 263 263 263 LYS LYS A . n A 1 264 HIS 264 264 264 HIS HIS A . n A 1 265 ALA 265 265 265 ALA ALA A . n A 1 266 LYS 266 266 266 LYS LYS A . n A 1 267 ASP 267 267 267 ASP ASP A . n A 1 268 ALA 268 268 268 ALA ALA A . n A 1 269 MET 269 269 269 MET MET A . n A 1 270 LEU 270 270 270 LEU LEU A . n A 1 271 THR 271 271 271 THR THR A . n A 1 272 ALA 272 272 272 ALA ALA A . n A 1 273 PHE 273 273 273 PHE PHE A . n A 1 274 VAL 274 274 274 VAL VAL A . n A 1 275 THR 275 275 275 THR THR A . n A 1 276 ARG 276 276 276 ARG ARG A . n A 1 277 SER 277 277 277 SER SER A . n A 1 278 SER 278 278 278 SER SER A . n A 1 279 SER 279 279 279 SER SER A . n A 1 280 GLY 280 280 280 GLY GLY A . n A 1 281 THR 281 281 281 THR THR A . n A 1 282 LEU 282 282 282 LEU LEU A . n A 1 283 PRO 283 283 283 PRO PRO A . n A 1 284 VAL 284 284 284 VAL VAL A . n A 1 285 THR 285 285 285 THR THR A . n A 1 286 MET 286 286 286 MET MET A . n A 1 287 ARG 287 287 287 ARG ARG A . n A 1 288 VAL 288 288 288 VAL VAL A . n A 1 289 ALA 289 289 289 ALA ALA A . n A 1 290 LYS 290 290 290 LYS LYS A . n A 1 291 GLU 291 291 291 GLU GLU A . n A 1 292 MET 292 292 292 MET MET A . n A 1 293 GLY 293 293 293 GLY GLY A . n A 1 294 ILE 294 294 294 ILE ILE A . n A 1 295 SER 295 295 295 SER SER A . n A 1 296 GLU 296 296 296 GLU GLU A . n A 1 297 GLY 297 297 297 GLY GLY A . n A 1 298 ILE 298 298 298 ILE ILE A . n A 1 299 TYR 299 299 299 TYR TYR A . n A 1 300 SER 300 300 300 SER SER A . n A 1 301 PHE 301 301 301 PHE PHE A . n A 1 302 THR 302 302 302 THR THR A . n A 1 303 LEU 303 303 303 LEU LEU A . n A 1 304 PRO 304 304 304 PRO PRO A . n A 1 305 LEU 305 305 305 LEU LEU A . n A 1 306 GLY 306 306 306 GLY GLY A . n A 1 307 ALA 307 307 307 ALA ALA A . n A 1 308 THR 308 308 308 THR THR A . n A 1 309 ILE 309 309 309 ILE ILE A . n A 1 310 ASN 310 310 310 ASN ASN A . n A 1 311 MET 311 311 311 MET MET A . n A 1 312 ASP 312 312 312 ASP ASP A . n A 1 313 GLY 313 313 313 GLY GLY A . n A 1 314 THR 314 314 314 THR THR A . n A 1 315 ALA 315 315 315 ALA ALA A . n A 1 316 LEU 316 316 316 LEU LEU A . n A 1 317 TYR 317 317 317 TYR TYR A . n A 1 318 GLN 318 318 318 GLN GLN A . n A 1 319 GLY 319 319 319 GLY GLY A . n A 1 320 VAL 320 320 320 VAL VAL A . n A 1 321 CYS 321 321 321 CYS CYS A . n A 1 322 THR 322 322 322 THR THR A . n A 1 323 PHE 323 323 323 PHE PHE A . n A 1 324 PHE 324 324 324 PHE PHE A . n A 1 325 ILE 325 325 325 ILE ILE A . n A 1 326 ALA 326 326 326 ALA ALA A . n A 1 327 ASN 327 327 327 ASN ASN A . n A 1 328 ALA 328 328 328 ALA ALA A . n A 1 329 LEU 329 329 329 LEU LEU A . n A 1 330 GLY 330 330 330 GLY GLY A . n A 1 331 SER 331 331 331 SER SER A . n A 1 332 HIS 332 332 332 HIS HIS A . n A 1 333 LEU 333 333 333 LEU LEU A . n A 1 334 THR 334 334 334 THR THR A . n A 1 335 VAL 335 335 335 VAL VAL A . n A 1 336 GLY 336 336 336 GLY GLY A . n A 1 337 GLN 337 337 337 GLN GLN A . n A 1 338 GLN 338 338 338 GLN GLN A . n A 1 339 LEU 339 339 339 LEU LEU A . n A 1 340 THR 340 340 340 THR THR A . n A 1 341 ILE 341 341 341 ILE ILE A . n A 1 342 VAL 342 342 342 VAL VAL A . n A 1 343 LEU 343 343 343 LEU LEU A . n A 1 344 THR 344 344 344 THR THR A . n A 1 345 ALA 345 345 345 ALA ALA A . n A 1 346 VAL 346 346 346 VAL VAL A . n A 1 347 LEU 347 347 347 LEU LEU A . n A 1 348 ALA 348 348 348 ALA ALA A . n A 1 349 SER 349 349 349 SER SER A . n A 1 350 ILE 350 350 350 ILE ILE A . n A 1 351 GLY 351 351 351 GLY GLY A . n A 1 352 THR 352 352 352 THR THR A . n A 1 353 ALA 353 353 353 ALA ALA A . n A 1 354 GLY 354 354 354 GLY GLY A . n A 1 355 VAL 355 355 355 VAL VAL A . n A 1 356 PRO 356 356 356 PRO PRO A . n A 1 357 GLY 357 357 357 GLY GLY A . n A 1 358 ALA 358 358 358 ALA ALA A . n A 1 359 GLY 359 359 359 GLY GLY A . n A 1 360 ALA 360 360 360 ALA ALA A . n A 1 361 ILE 361 361 361 ILE ILE A . n A 1 362 MET 362 362 362 MET MET A . n A 1 363 LEU 363 363 363 LEU LEU A . n A 1 364 ALA 364 364 364 ALA ALA A . n A 1 365 MET 365 365 365 MET MET A . n A 1 366 VAL 366 366 366 VAL VAL A . n A 1 367 LEU 367 367 367 LEU LEU A . n A 1 368 HIS 368 368 368 HIS HIS A . n A 1 369 SER 369 369 369 SER SER A . n A 1 370 VAL 370 370 370 VAL VAL A . n A 1 371 GLY 371 371 371 GLY GLY A . n A 1 372 LEU 372 372 372 LEU LEU A . n A 1 373 PRO 373 373 373 PRO PRO A . n A 1 374 LEU 374 374 374 LEU LEU A . n A 1 375 THR 375 375 375 THR THR A . n A 1 376 ASP 376 376 376 ASP ASP A . n A 1 377 PRO 377 377 377 PRO PRO A . n A 1 378 ASN 378 378 378 ASN ASN A . n A 1 379 VAL 379 379 379 VAL VAL A . n A 1 380 ALA 380 380 380 ALA ALA A . n A 1 381 ALA 381 381 381 ALA ALA A . n A 1 382 ALA 382 382 382 ALA ALA A . n A 1 383 TYR 383 383 383 TYR TYR A . n A 1 384 ALA 384 384 384 ALA ALA A . n A 1 385 MET 385 385 385 MET MET A . n A 1 386 ILE 386 386 386 ILE ILE A . n A 1 387 LEU 387 387 387 LEU LEU A . n A 1 388 GLY 388 388 388 GLY GLY A . n A 1 389 ILE 389 389 389 ILE ILE A . n A 1 390 ASP 390 390 390 ASP ASP A . n A 1 391 ALA 391 391 391 ALA ALA A . n A 1 392 ILE 392 392 392 ILE ILE A . n A 1 393 LEU 393 393 393 LEU LEU A . n A 1 394 ASP 394 394 394 ASP ASP A . n A 1 395 MET 395 395 395 MET MET A . n A 1 396 GLY 396 396 396 GLY GLY A . n A 1 397 ARG 397 397 397 ARG ARG A . n A 1 398 THR 398 398 398 THR THR A . n A 1 399 MET 399 399 399 MET MET A . n A 1 400 VAL 400 400 400 VAL VAL A . n A 1 401 ASN 401 401 401 ASN ASN A . n A 1 402 VAL 402 402 402 VAL VAL A . n A 1 403 THR 403 403 403 THR THR A . n A 1 404 GLY 404 404 404 GLY GLY A . n A 1 405 ASP 405 405 405 ASP ASP A . n A 1 406 LEU 406 406 406 LEU LEU A . n A 1 407 THR 407 407 407 THR THR A . n A 1 408 GLY 408 408 408 GLY GLY A . n A 1 409 THR 409 409 409 THR THR A . n A 1 410 ALA 410 410 410 ALA ALA A . n A 1 411 ILE 411 411 411 ILE ILE A . n A 1 412 VAL 412 412 412 VAL VAL A . n A 1 413 ALA 413 413 413 ALA ALA A . n A 1 414 LYS 414 414 414 LYS LYS A . n A 1 415 THR 415 415 415 THR THR A . n A 1 416 GLU 416 416 416 GLU GLU A . n A 1 417 GLY 417 417 ? ? ? A . n A 1 418 THR 418 418 ? ? ? A . n A 1 419 LEU 419 419 ? ? ? A . n A 1 420 VAL 420 420 ? ? ? A . n A 1 421 PRO 421 421 ? ? ? A . n A 1 422 ARG 422 422 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ASP 1 501 425 ASP ASP A . C 3 6OU 1 502 501 6OU 6OU A . D 3 6OU 1 503 601 6OU 6OU A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 18170 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-06-03 2 'Structure model' 1 1 2020-11-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? 'Paul D. Adams' pdadams@lbl.gov ? ? ? ? Python/C++ https://www.phenix-online.org/ ? phenix.real_space_refine ? ? program 1.14_3260 1 ? refinement ? ? 'Paul D. Adams' pdadams@lbl.gov ? ? ? ? Python/C++ https://www.phenix-online.org/ ? PHENIX ? ? program 1.14_3260 2 # _pdbx_entry_details.entry_id 6UWF _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _em_3d_fitting.entry_id 6UWF _em_3d_fitting.id 1 _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_protocol ? _em_3d_fitting.ref_space ? _em_3d_fitting.target_criteria ? _em_3d_fitting.method ? # _em_3d_reconstruction.entry_id 6UWF _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.details ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.num_particles 94731 _em_3d_reconstruction.resolution 3.08 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.symmetry_type POINT _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.details ? _em_buffer.pH 7.4 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details ? _em_entity_assembly.name 'Complex of GltPh with L-aspartate and sodium ions in MSP1E3 nanodisc' _em_entity_assembly.source RECOMBINANT _em_entity_assembly.type COMPLEX _em_entity_assembly.entity_id_list 1 _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # _em_imaging.id 1 _em_imaging.entry_id 6UWF _em_imaging.accelerating_voltage 300 _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.calibrated_defocus_max ? _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_magnification ? _em_imaging.cryogen ? _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_max ? _em_imaging.nominal_defocus_min ? _em_imaging.nominal_magnification ? _em_imaging.recording_temperature_maximum ? _em_imaging.recording_temperature_minimum ? _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model ? _em_imaging.specimen_id 1 _em_imaging.citation_id ? _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? _em_imaging.specimen_holder_type ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature ? _em_vitrification.cryogen_name ETHANE _em_vitrification.details ? _em_vitrification.humidity ? _em_vitrification.instrument ? _em_vitrification.entry_id 6UWF _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 6UWF _em_experiment.id 1 _em_experiment.aggregation_state PARTICLE _em_experiment.reconstruction_method 'SINGLE PARTICLE' _em_experiment.entity_assembly_id 1 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 CE _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LYS _pdbx_validate_close_contact.auth_seq_id_1 196 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 N29 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 6OU _pdbx_validate_close_contact.auth_seq_id_2 503 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.88 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 35 ? ? -98.75 35.09 2 1 ALA A 70 ? ? -93.50 55.05 3 1 PHE A 122 ? ? -64.41 -72.49 4 1 LEU A 130 ? ? 71.87 -7.22 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 N 1 A 6OU 502 ? C01 ? C 6OU 1 C01 2 1 N 1 A 6OU 502 ? C02 ? C 6OU 1 C02 3 1 N 1 A 6OU 502 ? C03 ? C 6OU 1 C03 4 1 N 1 A 6OU 502 ? C04 ? C 6OU 1 C04 5 1 N 1 A 6OU 502 ? C05 ? C 6OU 1 C05 6 1 N 1 A 6OU 502 ? C06 ? C 6OU 1 C06 7 1 N 1 A 6OU 502 ? C07 ? C 6OU 1 C07 8 1 N 1 A 6OU 502 ? C08 ? C 6OU 1 C08 9 1 N 1 A 6OU 502 ? C27 ? C 6OU 1 C27 10 1 N 1 A 6OU 502 ? C28 ? C 6OU 1 C28 11 1 N 1 A 6OU 502 ? N29 ? C 6OU 1 N29 12 1 N 1 A 6OU 502 ? C42 ? C 6OU 1 C42 13 1 N 1 A 6OU 502 ? C43 ? C 6OU 1 C43 14 1 N 1 A 6OU 502 ? C44 ? C 6OU 1 C44 15 1 N 1 A 6OU 502 ? C45 ? C 6OU 1 C45 16 1 N 1 A 6OU 502 ? C46 ? C 6OU 1 C46 17 1 N 1 A 6OU 502 ? C47 ? C 6OU 1 C47 18 1 N 1 A 6OU 502 ? C48 ? C 6OU 1 C48 19 1 N 1 A 6OU 502 ? C49 ? C 6OU 1 C49 20 1 N 1 A 6OU 503 ? C01 ? D 6OU 1 C01 21 1 N 1 A 6OU 503 ? C02 ? D 6OU 1 C02 22 1 N 1 A 6OU 503 ? C03 ? D 6OU 1 C03 23 1 N 1 A 6OU 503 ? C47 ? D 6OU 1 C47 24 1 N 1 A 6OU 503 ? C48 ? D 6OU 1 C48 25 1 N 1 A 6OU 503 ? C49 ? D 6OU 1 C49 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 417 ? A GLY 417 2 1 Y 1 A THR 418 ? A THR 418 3 1 Y 1 A LEU 419 ? A LEU 419 4 1 Y 1 A VAL 420 ? A VAL 420 5 1 Y 1 A PRO 421 ? A PRO 421 6 1 Y 1 A ARG 422 ? A ARG 422 # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' _em_ctf_correction.details ? # _em_embedding.id 1 _em_embedding.details ? _em_embedding.specimen_id 1 _em_embedding.material ice # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.experimental_flag NO _em_entity_assembly_molwt.units MEGADALTONS _em_entity_assembly_molwt.value 0.134 # _em_entity_assembly_naturalsource.id 1 _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.ncbi_tax_id 53953 _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organism 'Pyrococcus horikoshii' _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_entity_assembly_recombinant.id 1 _em_entity_assembly_recombinant.entity_assembly_id 1 _em_entity_assembly_recombinant.cell ? _em_entity_assembly_recombinant.ncbi_tax_id 562 _em_entity_assembly_recombinant.organism 'Escherichia coli' _em_entity_assembly_recombinant.plasmid ? _em_entity_assembly_recombinant.strain ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 50.1615 _em_image_recording.average_exposure_time ? _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'GATAN K3 (6k x 4k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'PARTICLE SELECTION' ? ? ? 1 ? ? 2 'IMAGE ACQUISITION' ? ? ? ? ? 1 3 MASKING ? ? ? ? ? ? 4 'CTF CORRECTION' ? ? ? 1 ? ? 5 'LAYERLINE INDEXING' ? ? ? ? ? ? 6 'DIFFRACTION INDEXING' ? ? ? ? ? ? 7 'MODEL FITTING' ? ? ? ? ? ? 8 'MODEL REFINEMENT' ? ? ? ? ? ? 9 OTHER ? ? ? ? ? ? 10 'INITIAL EULER ASSIGNMENT' ? ? ? 1 ? ? 11 'FINAL EULER ASSIGNMENT' ? ? ? 1 ? ? 12 CLASSIFICATION ? ? ? 1 ? ? 13 RECONSTRUCTION ? ? ? 1 ? ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied YES _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Human Genome Research Institute (NIH/NHGRI)' 'United States' R37NS085318 1 'National Institutes of Health/National Human Genome Research Institute (NIH/NHGRI)' 'United States' R01NS064357 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ASPARTIC ACID' ASP 3 '[(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate' 6OU # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support microscopy _pdbx_struct_assembly_auth_evidence.details ? # _space_group.crystal_system triclinic _space_group.name_H-M_alt 'P 1' _space_group.IT_number 1 _space_group.name_Hall 'P 1' _space_group.id 1 # _space_group_symop.id 1 _space_group_symop.operation_xyz x,y,z #