data_6UZ5 # _entry.id 6UZ5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.336 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 6UZ5 WWPDB D_1000245462 BMRB 30687 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB . 30390 unspecified PDB . 6BZK unspecified BMRB 'Solution structure of KTI55-Kringle 2 complex' 30687 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6UZ5 _pdbx_database_status.recvd_initial_deposition_date 2019-11-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Qiu, C.' 1 ? 'Yuan, Y.' 2 0000-0003-1003-379X 'Castellino, F.J.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Structural evolution of the A-domain in plasminogen-binding Group A streptococcal M-protein reflects improved adaptability of the pathogen to the host ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qiu, C.' 1 ? primary 'Yuan, Y.' 2 ? primary 'Ploplis, V.A.' 3 ? primary 'Castellino, F.J.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Plasminogen 10166.340 1 3.4.21.7 'C11G, E63D, L79Y' ? 'The terminal residues, YVEFSEE and AA, are not derived from kringle 2 domain of human plasminogen.' 2 polymer man 'M protein' 6799.461 1 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name KTI55 # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;YVEFSEECMHGSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRDLRPWCFTTDPNKRWEYC DIPRCAA ; ;YVEFSEECMHGSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRDLRPWCFTTDPNKRWEYC DIPRCAA ; A ? 2 'polypeptide(L)' no no GSKTIQEKEQELKNLKDNVELERLKNERHDHDEEAERKALEDKLADKQEHLDGALRY GSKTIQEKEQELKNLKDNVELERLKNERHDHDEEAERKALEDKLADKQEHLDGALRY B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TYR n 1 2 VAL n 1 3 GLU n 1 4 PHE n 1 5 SER n 1 6 GLU n 1 7 GLU n 1 8 CYS n 1 9 MET n 1 10 HIS n 1 11 GLY n 1 12 SER n 1 13 GLY n 1 14 GLU n 1 15 ASN n 1 16 TYR n 1 17 ASP n 1 18 GLY n 1 19 LYS n 1 20 ILE n 1 21 SER n 1 22 LYS n 1 23 THR n 1 24 MET n 1 25 SER n 1 26 GLY n 1 27 LEU n 1 28 GLU n 1 29 CYS n 1 30 GLN n 1 31 ALA n 1 32 TRP n 1 33 ASP n 1 34 SER n 1 35 GLN n 1 36 SER n 1 37 PRO n 1 38 HIS n 1 39 ALA n 1 40 HIS n 1 41 GLY n 1 42 TYR n 1 43 ILE n 1 44 PRO n 1 45 SER n 1 46 LYS n 1 47 PHE n 1 48 PRO n 1 49 ASN n 1 50 LYS n 1 51 ASN n 1 52 LEU n 1 53 LYS n 1 54 LYS n 1 55 ASN n 1 56 TYR n 1 57 CYS n 1 58 ARG n 1 59 ASN n 1 60 PRO n 1 61 ASP n 1 62 ARG n 1 63 ASP n 1 64 LEU n 1 65 ARG n 1 66 PRO n 1 67 TRP n 1 68 CYS n 1 69 PHE n 1 70 THR n 1 71 THR n 1 72 ASP n 1 73 PRO n 1 74 ASN n 1 75 LYS n 1 76 ARG n 1 77 TRP n 1 78 GLU n 1 79 TYR n 1 80 CYS n 1 81 ASP n 1 82 ILE n 1 83 PRO n 1 84 ARG n 1 85 CYS n 1 86 ALA n 1 87 ALA n 2 1 GLY n 2 2 SER n 2 3 LYS n 2 4 THR n 2 5 ILE n 2 6 GLN n 2 7 GLU n 2 8 LYS n 2 9 GLU n 2 10 GLN n 2 11 GLU n 2 12 LEU n 2 13 LYS n 2 14 ASN n 2 15 LEU n 2 16 LYS n 2 17 ASP n 2 18 ASN n 2 19 VAL n 2 20 GLU n 2 21 LEU n 2 22 GLU n 2 23 ARG n 2 24 LEU n 2 25 LYS n 2 26 ASN n 2 27 GLU n 2 28 ARG n 2 29 HIS n 2 30 ASP n 2 31 HIS n 2 32 ASP n 2 33 GLU n 2 34 GLU n 2 35 ALA n 2 36 GLU n 2 37 ARG n 2 38 LYS n 2 39 ALA n 2 40 LEU n 2 41 GLU n 2 42 ASP n 2 43 LYS n 2 44 LEU n 2 45 ALA n 2 46 ASP n 2 47 LYS n 2 48 GLN n 2 49 GLU n 2 50 HIS n 2 51 LEU n 2 52 ASP n 2 53 GLY n 2 54 ALA n 2 55 LEU n 2 56 ARG n 2 57 TYR n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 87 Human ? PLG ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Komagataella pastoris' 4922 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 57 ? ? emm ? SS1448 ? ? ? ? 'Streptococcus pyogenes' 1314 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? pET15b ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PLMN_HUMAN P00747 ? 1 CMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRC 185 2 UNP M4I070_STRPY M4I070 ? 2 KTIQEKEQELKNLKDNVELEQLKNERHDHDEEAERKALEDKLADKQEHLDGALRY 44 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6UZ5 A 8 ? 85 ? P00747 185 ? 262 ? 166 243 2 2 6UZ5 B 3 ? 57 ? M4I070 44 ? 98 ? 85 139 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6UZ5 TYR A 1 ? UNP P00747 ? ? 'expression tag' -7 1 1 6UZ5 VAL A 2 ? UNP P00747 ? ? 'expression tag' -6 2 1 6UZ5 GLU A 3 ? UNP P00747 ? ? 'expression tag' -5 3 1 6UZ5 PHE A 4 ? UNP P00747 ? ? 'expression tag' -4 4 1 6UZ5 SER A 5 ? UNP P00747 ? ? 'expression tag' -3 5 1 6UZ5 GLU A 6 ? UNP P00747 ? ? 'expression tag' -2 6 1 6UZ5 GLU A 7 ? UNP P00747 ? ? 'expression tag' -1 7 1 6UZ5 GLY A 11 ? UNP P00747 CYS 188 'engineered mutation' 169 8 1 6UZ5 ASP A 63 ? UNP P00747 GLU 240 'engineered mutation' 221 9 1 6UZ5 TYR A 79 ? UNP P00747 LEU 256 'engineered mutation' 237 10 1 6UZ5 ALA A 86 ? UNP P00747 ? ? 'expression tag' 244 11 1 6UZ5 ALA A 87 ? UNP P00747 ? ? 'expression tag' 245 12 2 6UZ5 GLY B 1 ? UNP M4I070 ? ? 'expression tag' -2 13 2 6UZ5 SER B 2 ? UNP M4I070 ? ? 'expression tag' -1 14 2 6UZ5 ARG B 23 ? UNP M4I070 GLN 64 variant 105 15 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D TROSY-[1H-15N] HSQC' 1 isotropic 2 1 1 '3D TROSY-HNCO' 1 isotropic 3 1 1 '3D TROSY-HN(CA)CO' 1 isotropic 4 1 1 '3D TROSY-HNCACB' 1 isotropic 5 1 1 '3D TROSY-C(CO)NH' 1 isotropic 6 1 1 '3D TROSY-HBHA(CBCA)NH' 1 isotropic 7 1 1 '3D TROSY-H(CCO)NH' 1 isotropic 8 1 1 '2D NOESY' 1 isotropic 9 1 1 '3D NOESY' 1 isotropic 10 1 1 '2D IPAP' 1 anisotropic 11 1 2 '2D 1H-15N HSQC' 1 isotropic 12 1 2 '3D NOESY' 1 isotropic 13 1 2 '2D IPAP' 1 anisotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '1.0 mM [U-99% 13C; U-99% 15N] KTI55, 1.2 mM Kringle 2, 20 mM [U-2H] Bis-Tris-d19, 2 ug/mL DSS, 2 ug/mL sodium azide, 95% H2O/5% D2O' '95% H2O/5% D2O' '13C, 15N_sample_1' solution ? 2 '1.0 mM [U-99% 13C; U-99% 15N] Kringle 2, 1.2 mM KTI55, 20 mM [U-2H] Bis-Tris-d19, 2 ug/mL DSS, 2 ug/mL sodium azide, 95% H2O/5% D2O' '95% H2O/5% D2O' '13C, 15N_sample_2' solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 6UZ5 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 6 # _pdbx_nmr_ensemble.entry_id 6UZ5 _pdbx_nmr_ensemble.conformers_calculated_total_number 2000 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6UZ5 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 processing TopSpin ? 'Bruker Biospin' 3 'data analysis' Sparky ? Goddard 4 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 5 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 6 refinement HADDOCK ? Bonvin # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6UZ5 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6UZ5 _struct.title 'Solution structure of KTI55-Kringle 2 complex' _struct.pdbx_descriptor 'M protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6UZ5 _struct_keywords.text 'Plasminogen binding peptide, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PHE A 47 ? ASN A 51 ? PHE A 205 ASN A 209 5 ? 5 HELX_P HELX_P2 AA2 ASN B 14 ? GLU B 22 ? ASN B 96 GLU B 104 1 ? 9 HELX_P HELX_P3 AA3 ASN B 26 ? HIS B 31 ? ASN B 108 HIS B 113 1 ? 6 HELX_P HELX_P4 AA4 ASP B 32 ? LEU B 40 ? ASP B 114 LEU B 122 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 85 SG ? ? A CYS 166 A CYS 243 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf2 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 68 SG ? ? A CYS 187 A CYS 226 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf3 disulf ? ? A CYS 57 SG ? ? ? 1_555 A CYS 80 SG ? ? A CYS 215 A CYS 238 1_555 ? ? ? ? ? ? ? 2.030 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 36 A . ? SER 194 A PRO 37 A ? PRO 195 A 1 0.04 2 SER 36 A . ? SER 194 A PRO 37 A ? PRO 195 A 2 0.43 3 SER 36 A . ? SER 194 A PRO 37 A ? PRO 195 A 3 0.64 4 SER 36 A . ? SER 194 A PRO 37 A ? PRO 195 A 4 0.25 5 SER 36 A . ? SER 194 A PRO 37 A ? PRO 195 A 5 0.47 6 SER 36 A . ? SER 194 A PRO 37 A ? PRO 195 A 6 0.39 7 SER 36 A . ? SER 194 A PRO 37 A ? PRO 195 A 7 0.25 8 SER 36 A . ? SER 194 A PRO 37 A ? PRO 195 A 8 0.26 9 SER 36 A . ? SER 194 A PRO 37 A ? PRO 195 A 9 0.03 10 SER 36 A . ? SER 194 A PRO 37 A ? PRO 195 A 10 0.31 11 SER 36 A . ? SER 194 A PRO 37 A ? PRO 195 A 11 0.17 12 SER 36 A . ? SER 194 A PRO 37 A ? PRO 195 A 12 0.14 13 SER 36 A . ? SER 194 A PRO 37 A ? PRO 195 A 13 0.38 14 SER 36 A . ? SER 194 A PRO 37 A ? PRO 195 A 14 0.59 15 SER 36 A . ? SER 194 A PRO 37 A ? PRO 195 A 15 -0.73 16 SER 36 A . ? SER 194 A PRO 37 A ? PRO 195 A 16 0.53 17 SER 36 A . ? SER 194 A PRO 37 A ? PRO 195 A 17 0.30 18 SER 36 A . ? SER 194 A PRO 37 A ? PRO 195 A 18 0.28 19 SER 36 A . ? SER 194 A PRO 37 A ? PRO 195 A 19 1.03 20 SER 36 A . ? SER 194 A PRO 37 A ? PRO 195 A 20 0.42 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TRP A 67 ? PHE A 69 ? TRP A 225 PHE A 227 AA1 2 TRP A 77 ? TYR A 79 ? TRP A 235 TYR A 237 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id CYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 68 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id CYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 226 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLU _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 78 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLU _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 236 # _atom_sites.entry_id 6UZ5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TYR 1 -7 ? ? ? A . n A 1 2 VAL 2 -6 ? ? ? A . n A 1 3 GLU 3 -5 ? ? ? A . n A 1 4 PHE 4 -4 ? ? ? A . n A 1 5 SER 5 -3 ? ? ? A . n A 1 6 GLU 6 -2 -2 GLU GLU A . n A 1 7 GLU 7 -1 -1 GLU GLU A . n A 1 8 CYS 8 166 166 CYS CYS A . n A 1 9 MET 9 167 167 MET MET A . n A 1 10 HIS 10 168 168 HIS HIS A . n A 1 11 GLY 11 169 169 GLY GLY A . n A 1 12 SER 12 170 170 SER SER A . n A 1 13 GLY 13 171 171 GLY GLY A . n A 1 14 GLU 14 172 172 GLU GLU A . n A 1 15 ASN 15 173 173 ASN ASN A . n A 1 16 TYR 16 174 174 TYR TYR A . n A 1 17 ASP 17 175 175 ASP ASP A . n A 1 18 GLY 18 176 176 GLY GLY A . n A 1 19 LYS 19 177 177 LYS LYS A . n A 1 20 ILE 20 178 178 ILE ILE A . n A 1 21 SER 21 179 179 SER SER A . n A 1 22 LYS 22 180 180 LYS LYS A . n A 1 23 THR 23 181 181 THR THR A . n A 1 24 MET 24 182 182 MET MET A . n A 1 25 SER 25 183 183 SER SER A . n A 1 26 GLY 26 184 184 GLY GLY A . n A 1 27 LEU 27 185 185 LEU LEU A . n A 1 28 GLU 28 186 186 GLU GLU A . n A 1 29 CYS 29 187 187 CYS CYS A . n A 1 30 GLN 30 188 188 GLN GLN A . n A 1 31 ALA 31 189 189 ALA ALA A . n A 1 32 TRP 32 190 190 TRP TRP A . n A 1 33 ASP 33 191 191 ASP ASP A . n A 1 34 SER 34 192 192 SER SER A . n A 1 35 GLN 35 193 193 GLN GLN A . n A 1 36 SER 36 194 194 SER SER A . n A 1 37 PRO 37 195 195 PRO PRO A . n A 1 38 HIS 38 196 196 HIS HIS A . n A 1 39 ALA 39 197 197 ALA ALA A . n A 1 40 HIS 40 198 198 HIS HIS A . n A 1 41 GLY 41 199 199 GLY GLY A . n A 1 42 TYR 42 200 200 TYR TYR A . n A 1 43 ILE 43 201 201 ILE ILE A . n A 1 44 PRO 44 202 202 PRO PRO A . n A 1 45 SER 45 203 203 SER SER A . n A 1 46 LYS 46 204 204 LYS LYS A . n A 1 47 PHE 47 205 205 PHE PHE A . n A 1 48 PRO 48 206 206 PRO PRO A . n A 1 49 ASN 49 207 207 ASN ASN A . n A 1 50 LYS 50 208 208 LYS LYS A . n A 1 51 ASN 51 209 209 ASN ASN A . n A 1 52 LEU 52 210 210 LEU LEU A . n A 1 53 LYS 53 211 211 LYS LYS A . n A 1 54 LYS 54 212 212 LYS LYS A . n A 1 55 ASN 55 213 213 ASN ASN A . n A 1 56 TYR 56 214 214 TYR TYR A . n A 1 57 CYS 57 215 215 CYS CYS A . n A 1 58 ARG 58 216 216 ARG ARG A . n A 1 59 ASN 59 217 217 ASN ASN A . n A 1 60 PRO 60 218 218 PRO PRO A . n A 1 61 ASP 61 219 219 ASP ASP A . n A 1 62 ARG 62 220 220 ARG ARG A . n A 1 63 ASP 63 221 221 ASP ASP A . n A 1 64 LEU 64 222 222 LEU LEU A . n A 1 65 ARG 65 223 223 ARG ARG A . n A 1 66 PRO 66 224 224 PRO PRO A . n A 1 67 TRP 67 225 225 TRP TRP A . n A 1 68 CYS 68 226 226 CYS CYS A . n A 1 69 PHE 69 227 227 PHE PHE A . n A 1 70 THR 70 228 228 THR THR A . n A 1 71 THR 71 229 229 THR THR A . n A 1 72 ASP 72 230 230 ASP ASP A . n A 1 73 PRO 73 231 231 PRO PRO A . n A 1 74 ASN 74 232 232 ASN ASN A . n A 1 75 LYS 75 233 233 LYS LYS A . n A 1 76 ARG 76 234 234 ARG ARG A . n A 1 77 TRP 77 235 235 TRP TRP A . n A 1 78 GLU 78 236 236 GLU GLU A . n A 1 79 TYR 79 237 237 TYR TYR A . n A 1 80 CYS 80 238 238 CYS CYS A . n A 1 81 ASP 81 239 239 ASP ASP A . n A 1 82 ILE 82 240 240 ILE ILE A . n A 1 83 PRO 83 241 241 PRO PRO A . n A 1 84 ARG 84 242 242 ARG ARG A . n A 1 85 CYS 85 243 243 CYS CYS A . n A 1 86 ALA 86 244 ? ? ? A . n A 1 87 ALA 87 245 ? ? ? A . n B 2 1 GLY 1 -2 -2 GLY GLY B . n B 2 2 SER 2 -1 -1 SER SER B . n B 2 3 LYS 3 85 85 LYS LYS B . n B 2 4 THR 4 86 86 THR THR B . n B 2 5 ILE 5 87 87 ILE ILE B . n B 2 6 GLN 6 88 88 GLN GLN B . n B 2 7 GLU 7 89 89 GLU GLU B . n B 2 8 LYS 8 90 90 LYS LYS B . n B 2 9 GLU 9 91 91 GLU GLU B . n B 2 10 GLN 10 92 92 GLN GLN B . n B 2 11 GLU 11 93 93 GLU GLU B . n B 2 12 LEU 12 94 94 LEU LEU B . n B 2 13 LYS 13 95 95 LYS LYS B . n B 2 14 ASN 14 96 96 ASN ASN B . n B 2 15 LEU 15 97 97 LEU LEU B . n B 2 16 LYS 16 98 98 LYS LYS B . n B 2 17 ASP 17 99 99 ASP ASP B . n B 2 18 ASN 18 100 100 ASN ASN B . n B 2 19 VAL 19 101 101 VAL VAL B . n B 2 20 GLU 20 102 102 GLU GLU B . n B 2 21 LEU 21 103 103 LEU LEU B . n B 2 22 GLU 22 104 104 GLU GLU B . n B 2 23 ARG 23 105 105 ARG ARG B . n B 2 24 LEU 24 106 106 LEU LEU B . n B 2 25 LYS 25 107 107 LYS LYS B . n B 2 26 ASN 26 108 108 ASN ASN B . n B 2 27 GLU 27 109 109 GLU GLU B . n B 2 28 ARG 28 110 110 ARG ARG B . n B 2 29 HIS 29 111 111 HIS HIS B . n B 2 30 ASP 30 112 112 ASP ASP B . n B 2 31 HIS 31 113 113 HIS HIS B . n B 2 32 ASP 32 114 114 ASP ASP B . n B 2 33 GLU 33 115 115 GLU GLU B . n B 2 34 GLU 34 116 116 GLU GLU B . n B 2 35 ALA 35 117 117 ALA ALA B . n B 2 36 GLU 36 118 118 GLU GLU B . n B 2 37 ARG 37 119 119 ARG ARG B . n B 2 38 LYS 38 120 120 LYS LYS B . n B 2 39 ALA 39 121 121 ALA ALA B . n B 2 40 LEU 40 122 122 LEU LEU B . n B 2 41 GLU 41 123 123 GLU GLU B . n B 2 42 ASP 42 124 124 ASP ASP B . n B 2 43 LYS 43 125 125 LYS LYS B . n B 2 44 LEU 44 126 126 LEU LEU B . n B 2 45 ALA 45 127 127 ALA ALA B . n B 2 46 ASP 46 128 128 ASP ASP B . n B 2 47 LYS 47 129 129 LYS LYS B . n B 2 48 GLN 48 130 130 GLN GLN B . n B 2 49 GLU 49 131 131 GLU GLU B . n B 2 50 HIS 50 132 132 HIS HIS B . n B 2 51 LEU 51 133 133 LEU LEU B . n B 2 52 ASP 52 134 134 ASP ASP B . n B 2 53 GLY 53 135 135 GLY GLY B . n B 2 54 ALA 54 136 136 ALA ALA B . n B 2 55 LEU 55 137 137 LEU LEU B . n B 2 56 ARG 56 138 138 ARG ARG B . n B 2 57 TYR 57 139 139 TYR TYR B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1120 ? 1 MORE -2 ? 1 'SSA (A^2)' 10850 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2020-12-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 KTI55 1.0 ? mM '[U-99% 13C; U-99% 15N]' 1 'Kringle 2' 1.2 ? mM 'natural abundance' 1 Bis-Tris-d19 20 ? mM '[U-2H]' 1 DSS 2 ? ug/mL 'natural abundance' 1 'sodium azide' 2 ? ug/mL 'natural abundance' 2 'Kringle 2' 1.0 ? mM '[U-99% 13C; U-99% 15N]' 2 KTI55 1.2 ? mM 'natural abundance' 2 Bis-Tris-d19 20 ? mM '[U-2H]' 2 DSS 2 ? ug/mL 'natural abundance' 2 'sodium azide' 2 ? ug/mL 'natural abundance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 HG A SER 183 ? ? OE2 A GLU 236 ? ? 1.57 2 4 OE1 B GLU 118 ? ? HZ1 B LYS 125 ? ? 1.57 3 4 HZ2 B LYS 98 ? ? OE1 B GLU 102 ? ? 1.57 4 5 OE2 A GLU 172 ? ? HZ2 A LYS 208 ? ? 1.57 5 6 OE2 A GLU 172 ? ? HZ1 A LYS 208 ? ? 1.58 6 10 HG A SER 183 ? ? OE2 A GLU 236 ? ? 1.60 7 11 HZ1 A LYS 233 ? ? OE2 A GLU 236 ? ? 1.57 8 12 OE1 B GLU 91 ? ? HZ3 B LYS 95 ? ? 1.58 9 12 OD2 A ASP 221 ? ? HH A TYR 237 ? ? 1.59 10 15 OE2 B GLU 109 ? ? HE2 B HIS 113 ? ? 1.60 11 16 OE2 B GLU 91 ? ? HZ1 B LYS 95 ? ? 1.60 12 18 HG A SER 183 ? ? OE1 A GLU 236 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 173 ? ? -99.50 30.77 2 1 ASP A 175 ? ? -114.40 61.13 3 1 TYR A 200 ? ? -105.53 61.71 4 1 LYS A 212 ? ? 49.14 -112.19 5 1 HIS B 132 ? ? 64.11 -90.56 6 1 LEU B 133 ? ? 63.02 -175.37 7 2 ASN A 173 ? ? -102.01 42.76 8 2 LYS A 212 ? ? 48.72 -113.04 9 2 HIS B 132 ? ? 67.00 -75.86 10 2 LEU B 133 ? ? 61.70 -172.84 11 2 ASP B 134 ? ? -119.37 -77.88 12 3 TYR A 200 ? ? -95.72 55.65 13 3 LYS A 212 ? ? 49.41 -113.66 14 3 GLU B 104 ? ? 61.85 67.28 15 3 ASN B 108 ? ? 64.56 -1.62 16 3 HIS B 132 ? ? 63.18 -119.59 17 3 LEU B 133 ? ? 60.80 -167.43 18 4 ASN A 173 ? ? -94.06 31.89 19 4 ASP A 175 ? ? -102.86 49.50 20 4 TYR A 200 ? ? -100.54 48.02 21 4 LYS A 212 ? ? 50.82 -119.21 22 4 GLU B 104 ? ? 63.21 69.60 23 4 HIS B 132 ? ? 68.32 -74.37 24 4 LEU B 133 ? ? 67.30 166.94 25 4 ASP B 134 ? ? -109.82 -157.10 26 5 TYR A 200 ? ? -100.90 43.77 27 5 LYS A 212 ? ? 51.05 -118.21 28 5 HIS B 132 ? ? 59.35 -93.11 29 5 LEU B 133 ? ? 53.81 -139.32 30 6 TYR A 200 ? ? -94.92 47.21 31 6 LYS A 212 ? ? 51.78 -113.21 32 6 HIS B 132 ? ? 55.40 -122.39 33 6 LEU B 133 ? ? 70.10 140.35 34 6 ARG B 138 ? ? -132.03 -68.97 35 7 ASN A 173 ? ? -102.24 43.46 36 7 LYS A 212 ? ? 45.89 -112.45 37 7 LYS B 107 ? ? 59.60 14.27 38 7 HIS B 132 ? ? 64.07 -112.93 39 7 LEU B 133 ? ? 65.80 156.95 40 7 ARG B 138 ? ? -141.12 -18.04 41 8 TYR A 200 ? ? -94.15 58.85 42 8 LYS A 212 ? ? 51.15 -117.85 43 8 GLU B 104 ? ? 56.10 76.11 44 8 HIS B 132 ? ? 70.52 -88.49 45 8 LEU B 133 ? ? 54.09 -148.74 46 8 LEU B 137 ? ? -91.66 49.54 47 8 ARG B 138 ? ? -136.15 -66.47 48 9 ASP A 175 ? ? -141.61 56.94 49 9 LYS A 212 ? ? 51.24 -108.93 50 9 HIS B 132 ? ? 62.96 -160.17 51 9 LEU B 133 ? ? 68.40 175.65 52 10 ASN A 173 ? ? -97.93 47.08 53 10 LYS A 177 ? ? -99.30 32.54 54 10 LYS A 212 ? ? 53.02 -121.12 55 10 ARG A 234 ? ? -51.98 -70.19 56 10 ASP B 128 ? ? -103.56 -169.95 57 10 HIS B 132 ? ? 71.71 -80.05 58 10 LEU B 133 ? ? 57.04 -164.66 59 10 LEU B 137 ? ? -87.22 40.38 60 11 TYR A 200 ? ? -107.65 54.55 61 11 LYS A 212 ? ? 49.12 -114.77 62 11 ARG A 234 ? ? -56.12 -70.02 63 11 GLU B 104 ? ? 66.22 88.27 64 11 HIS B 132 ? ? 64.13 -98.51 65 11 LEU B 133 ? ? 64.98 -177.02 66 12 TYR A 200 ? ? -94.87 58.74 67 12 LYS A 212 ? ? 45.78 -119.31 68 12 ASP B 128 ? ? -88.84 -82.70 69 12 GLU B 131 ? ? -81.22 -71.00 70 12 HIS B 132 ? ? 65.59 -93.36 71 12 LEU B 133 ? ? 64.94 -174.32 72 12 LEU B 137 ? ? -83.77 43.05 73 12 ARG B 138 ? ? -141.25 -41.57 74 13 ASP A 175 ? ? -153.20 70.73 75 13 LYS A 212 ? ? 50.76 -119.77 76 13 GLU B 104 ? ? 56.30 77.85 77 13 HIS B 132 ? ? 65.09 -86.71 78 13 LEU B 133 ? ? 67.72 138.53 79 14 ASP A 175 ? ? -150.59 35.87 80 14 LYS A 212 ? ? 50.51 -112.40 81 14 GLU B 104 ? ? 61.45 65.37 82 14 HIS B 132 ? ? 67.47 -86.92 83 14 LEU B 133 ? ? 63.67 -161.77 84 15 TYR A 200 ? ? -92.15 59.39 85 15 LYS A 212 ? ? 46.74 -110.13 86 15 PRO A 231 ? ? -64.97 13.50 87 15 GLU B 104 ? ? 58.81 75.41 88 15 HIS B 132 ? ? 61.52 -112.19 89 15 LEU B 133 ? ? 59.49 -163.14 90 16 GLN A 193 ? ? -108.24 45.79 91 16 LYS A 212 ? ? 50.81 -119.88 92 16 GLU B 104 ? ? 54.58 80.92 93 16 LYS B 107 ? ? 59.60 18.22 94 16 HIS B 132 ? ? 70.50 -86.17 95 16 LEU B 133 ? ? 63.78 -177.00 96 16 ASP B 134 ? ? -144.14 -85.47 97 17 GLU A -1 ? ? -93.56 34.53 98 17 TYR A 200 ? ? -93.27 58.43 99 17 LYS A 212 ? ? 47.99 -117.69 100 17 ARG A 234 ? ? -62.04 -70.97 101 17 ASP B 128 ? ? -72.50 -87.46 102 17 LYS B 129 ? ? -161.06 97.73 103 17 HIS B 132 ? ? 66.01 -94.08 104 17 LEU B 133 ? ? 67.41 143.12 105 18 TYR A 200 ? ? -103.47 52.58 106 18 LYS A 212 ? ? 48.41 -116.70 107 18 GLU B 104 ? ? 54.39 70.46 108 18 HIS B 132 ? ? 62.32 -102.60 109 18 LEU B 133 ? ? 67.98 163.40 110 19 TYR A 200 ? ? -91.45 58.45 111 19 LYS A 212 ? ? 50.77 -113.29 112 19 HIS B 132 ? ? 57.21 -103.13 113 19 LEU B 133 ? ? 54.13 -140.14 114 20 LYS A 212 ? ? 54.29 -119.21 115 20 HIS B 132 ? ? 68.19 -87.43 116 20 LEU B 133 ? ? 61.95 -174.26 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A TYR -7 ? A TYR 1 2 1 Y 1 A VAL -6 ? A VAL 2 3 1 Y 1 A GLU -5 ? A GLU 3 4 1 Y 1 A PHE -4 ? A PHE 4 5 1 Y 1 A SER -3 ? A SER 5 6 1 Y 1 A ALA 244 ? A ALA 86 7 1 Y 1 A ALA 245 ? A ALA 87 8 2 Y 1 A TYR -7 ? A TYR 1 9 2 Y 1 A VAL -6 ? A VAL 2 10 2 Y 1 A GLU -5 ? A GLU 3 11 2 Y 1 A PHE -4 ? A PHE 4 12 2 Y 1 A SER -3 ? A SER 5 13 2 Y 1 A ALA 244 ? A ALA 86 14 2 Y 1 A ALA 245 ? A ALA 87 15 3 Y 1 A TYR -7 ? A TYR 1 16 3 Y 1 A VAL -6 ? A VAL 2 17 3 Y 1 A GLU -5 ? A GLU 3 18 3 Y 1 A PHE -4 ? A PHE 4 19 3 Y 1 A SER -3 ? A SER 5 20 3 Y 1 A ALA 244 ? A ALA 86 21 3 Y 1 A ALA 245 ? A ALA 87 22 4 Y 1 A TYR -7 ? A TYR 1 23 4 Y 1 A VAL -6 ? A VAL 2 24 4 Y 1 A GLU -5 ? A GLU 3 25 4 Y 1 A PHE -4 ? A PHE 4 26 4 Y 1 A SER -3 ? A SER 5 27 4 Y 1 A ALA 244 ? A ALA 86 28 4 Y 1 A ALA 245 ? A ALA 87 29 5 Y 1 A TYR -7 ? A TYR 1 30 5 Y 1 A VAL -6 ? A VAL 2 31 5 Y 1 A GLU -5 ? A GLU 3 32 5 Y 1 A PHE -4 ? A PHE 4 33 5 Y 1 A SER -3 ? A SER 5 34 5 Y 1 A ALA 244 ? A ALA 86 35 5 Y 1 A ALA 245 ? A ALA 87 36 6 Y 1 A TYR -7 ? A TYR 1 37 6 Y 1 A VAL -6 ? A VAL 2 38 6 Y 1 A GLU -5 ? A GLU 3 39 6 Y 1 A PHE -4 ? A PHE 4 40 6 Y 1 A SER -3 ? A SER 5 41 6 Y 1 A ALA 244 ? A ALA 86 42 6 Y 1 A ALA 245 ? A ALA 87 43 7 Y 1 A TYR -7 ? A TYR 1 44 7 Y 1 A VAL -6 ? A VAL 2 45 7 Y 1 A GLU -5 ? A GLU 3 46 7 Y 1 A PHE -4 ? A PHE 4 47 7 Y 1 A SER -3 ? A SER 5 48 7 Y 1 A ALA 244 ? A ALA 86 49 7 Y 1 A ALA 245 ? A ALA 87 50 8 Y 1 A TYR -7 ? A TYR 1 51 8 Y 1 A VAL -6 ? A VAL 2 52 8 Y 1 A GLU -5 ? A GLU 3 53 8 Y 1 A PHE -4 ? A PHE 4 54 8 Y 1 A SER -3 ? A SER 5 55 8 Y 1 A ALA 244 ? A ALA 86 56 8 Y 1 A ALA 245 ? A ALA 87 57 9 Y 1 A TYR -7 ? A TYR 1 58 9 Y 1 A VAL -6 ? A VAL 2 59 9 Y 1 A GLU -5 ? A GLU 3 60 9 Y 1 A PHE -4 ? A PHE 4 61 9 Y 1 A SER -3 ? A SER 5 62 9 Y 1 A ALA 244 ? A ALA 86 63 9 Y 1 A ALA 245 ? A ALA 87 64 10 Y 1 A TYR -7 ? A TYR 1 65 10 Y 1 A VAL -6 ? A VAL 2 66 10 Y 1 A GLU -5 ? A GLU 3 67 10 Y 1 A PHE -4 ? A PHE 4 68 10 Y 1 A SER -3 ? A SER 5 69 10 Y 1 A ALA 244 ? A ALA 86 70 10 Y 1 A ALA 245 ? A ALA 87 71 11 Y 1 A TYR -7 ? A TYR 1 72 11 Y 1 A VAL -6 ? A VAL 2 73 11 Y 1 A GLU -5 ? A GLU 3 74 11 Y 1 A PHE -4 ? A PHE 4 75 11 Y 1 A SER -3 ? A SER 5 76 11 Y 1 A ALA 244 ? A ALA 86 77 11 Y 1 A ALA 245 ? A ALA 87 78 12 Y 1 A TYR -7 ? A TYR 1 79 12 Y 1 A VAL -6 ? A VAL 2 80 12 Y 1 A GLU -5 ? A GLU 3 81 12 Y 1 A PHE -4 ? A PHE 4 82 12 Y 1 A SER -3 ? A SER 5 83 12 Y 1 A ALA 244 ? A ALA 86 84 12 Y 1 A ALA 245 ? A ALA 87 85 13 Y 1 A TYR -7 ? A TYR 1 86 13 Y 1 A VAL -6 ? A VAL 2 87 13 Y 1 A GLU -5 ? A GLU 3 88 13 Y 1 A PHE -4 ? A PHE 4 89 13 Y 1 A SER -3 ? A SER 5 90 13 Y 1 A ALA 244 ? A ALA 86 91 13 Y 1 A ALA 245 ? A ALA 87 92 14 Y 1 A TYR -7 ? A TYR 1 93 14 Y 1 A VAL -6 ? A VAL 2 94 14 Y 1 A GLU -5 ? A GLU 3 95 14 Y 1 A PHE -4 ? A PHE 4 96 14 Y 1 A SER -3 ? A SER 5 97 14 Y 1 A ALA 244 ? A ALA 86 98 14 Y 1 A ALA 245 ? A ALA 87 99 15 Y 1 A TYR -7 ? A TYR 1 100 15 Y 1 A VAL -6 ? A VAL 2 101 15 Y 1 A GLU -5 ? A GLU 3 102 15 Y 1 A PHE -4 ? A PHE 4 103 15 Y 1 A SER -3 ? A SER 5 104 15 Y 1 A ALA 244 ? A ALA 86 105 15 Y 1 A ALA 245 ? A ALA 87 106 16 Y 1 A TYR -7 ? A TYR 1 107 16 Y 1 A VAL -6 ? A VAL 2 108 16 Y 1 A GLU -5 ? A GLU 3 109 16 Y 1 A PHE -4 ? A PHE 4 110 16 Y 1 A SER -3 ? A SER 5 111 16 Y 1 A ALA 244 ? A ALA 86 112 16 Y 1 A ALA 245 ? A ALA 87 113 17 Y 1 A TYR -7 ? A TYR 1 114 17 Y 1 A VAL -6 ? A VAL 2 115 17 Y 1 A GLU -5 ? A GLU 3 116 17 Y 1 A PHE -4 ? A PHE 4 117 17 Y 1 A SER -3 ? A SER 5 118 17 Y 1 A ALA 244 ? A ALA 86 119 17 Y 1 A ALA 245 ? A ALA 87 120 18 Y 1 A TYR -7 ? A TYR 1 121 18 Y 1 A VAL -6 ? A VAL 2 122 18 Y 1 A GLU -5 ? A GLU 3 123 18 Y 1 A PHE -4 ? A PHE 4 124 18 Y 1 A SER -3 ? A SER 5 125 18 Y 1 A ALA 244 ? A ALA 86 126 18 Y 1 A ALA 245 ? A ALA 87 127 19 Y 1 A TYR -7 ? A TYR 1 128 19 Y 1 A VAL -6 ? A VAL 2 129 19 Y 1 A GLU -5 ? A GLU 3 130 19 Y 1 A PHE -4 ? A PHE 4 131 19 Y 1 A SER -3 ? A SER 5 132 19 Y 1 A ALA 244 ? A ALA 86 133 19 Y 1 A ALA 245 ? A ALA 87 134 20 Y 1 A TYR -7 ? A TYR 1 135 20 Y 1 A VAL -6 ? A VAL 2 136 20 Y 1 A GLU -5 ? A GLU 3 137 20 Y 1 A PHE -4 ? A PHE 4 138 20 Y 1 A SER -3 ? A SER 5 139 20 Y 1 A ALA 244 ? A ALA 86 140 20 Y 1 A ALA 245 ? A ALA 87 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Human Genome Research Institute (NIH/NHGRI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number HL013423 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #