data_6VL4
#
_entry.id 6VL4
#
_audit_conform.dict_name mmcif_pdbx.dic
_audit_conform.dict_version 5.397
_audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic
#
loop_
_database_2.database_id
_database_2.database_code
_database_2.pdbx_database_accession
_database_2.pdbx_DOI
PDB 6VL4 pdb_00006vl4 10.2210/pdb6vl4/pdb
WWPDB D_1000246575 ? ?
#
loop_
_pdbx_audit_revision_history.ordinal
_pdbx_audit_revision_history.data_content_type
_pdbx_audit_revision_history.major_revision
_pdbx_audit_revision_history.minor_revision
_pdbx_audit_revision_history.revision_date
1 'Structure model' 1 0 2020-12-02
2 'Structure model' 1 1 2020-12-09
3 'Structure model' 1 2 2020-12-16
4 'Structure model' 1 3 2024-10-23
#
_pdbx_audit_revision_details.ordinal 1
_pdbx_audit_revision_details.revision_ordinal 1
_pdbx_audit_revision_details.data_content_type 'Structure model'
_pdbx_audit_revision_details.provider repository
_pdbx_audit_revision_details.type 'Initial release'
_pdbx_audit_revision_details.description ?
_pdbx_audit_revision_details.details ?
#
loop_
_pdbx_audit_revision_group.ordinal
_pdbx_audit_revision_group.revision_ordinal
_pdbx_audit_revision_group.data_content_type
_pdbx_audit_revision_group.group
1 2 'Structure model' 'Database references'
2 3 'Structure model' 'Database references'
3 4 'Structure model' 'Data collection'
4 4 'Structure model' 'Database references'
5 4 'Structure model' 'Refinement description'
6 4 'Structure model' 'Structure summary'
#
loop_
_pdbx_audit_revision_category.ordinal
_pdbx_audit_revision_category.revision_ordinal
_pdbx_audit_revision_category.data_content_type
_pdbx_audit_revision_category.category
1 2 'Structure model' citation
2 2 'Structure model' citation_author
3 3 'Structure model' citation
4 4 'Structure model' chem_comp_atom
5 4 'Structure model' chem_comp_bond
6 4 'Structure model' database_2
7 4 'Structure model' pdbx_entry_details
8 4 'Structure model' pdbx_initial_refinement_model
9 4 'Structure model' pdbx_modification_feature
10 4 'Structure model' refine
#
loop_
_pdbx_audit_revision_item.ordinal
_pdbx_audit_revision_item.revision_ordinal
_pdbx_audit_revision_item.data_content_type
_pdbx_audit_revision_item.item
1 2 'Structure model' '_citation.journal_id_ISSN'
2 2 'Structure model' '_citation.page_first'
3 2 'Structure model' '_citation.page_last'
4 2 'Structure model' '_citation.pdbx_database_id_PubMed'
5 2 'Structure model' '_citation.title'
6 2 'Structure model' '_citation_author.identifier_ORCID'
7 3 'Structure model' '_citation.journal_volume'
8 4 'Structure model' '_database_2.pdbx_DOI'
9 4 'Structure model' '_database_2.pdbx_database_accession'
10 4 'Structure model' '_pdbx_entry_details.has_protein_modification'
11 4 'Structure model' '_refine.pdbx_starting_model'
#
_pdbx_database_status.status_code REL
_pdbx_database_status.status_code_sf REL
_pdbx_database_status.status_code_mr ?
_pdbx_database_status.entry_id 6VL4
_pdbx_database_status.recvd_initial_deposition_date 2020-01-22
_pdbx_database_status.SG_entry N
_pdbx_database_status.deposit_site RCSB
_pdbx_database_status.process_site RCSB
_pdbx_database_status.status_code_cs ?
_pdbx_database_status.status_code_nmr_data ?
_pdbx_database_status.methods_development_category ?
_pdbx_database_status.pdb_format_compatible Y
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
_audit_author.identifier_ORCID
'Ho, J.D.' 1 0000-0002-9636-5527
'Lee, M.R.' 2 ?
'Rauch, C.T.' 3 ?
'Aznavour, K.' 4 ?
'Park, J.S.' 5 ?
'Luz, J.G.' 6 ?
'Antonysamy, S.' 7 ?
'Condon, B.' 8 ?
'Maletic, M.' 9 ?
'Zhang, A.' 10 ?
'Hickey, M.J.' 11 ?
'Hughes, N.E.' 12 ?
'Chandrasekhar, S.' 13 ?
'Sloan, A.V.' 14 ?
'Gooding, K.' 15 ?
'Harvey, A.' 16 ?
'Yu, X.P.' 17 ?
'Kahl, S.D.' 18 ?
'Norman, B.H.' 19 0000-0002-0765-8548
#
_citation.abstract ?
_citation.abstract_id_CAS ?
_citation.book_id_ISBN ?
_citation.book_publisher ?
_citation.book_publisher_city ?
_citation.book_title ?
_citation.coordinate_linkage ?
_citation.country ?
_citation.database_id_Medline ?
_citation.details ?
_citation.id primary
_citation.journal_abbrev 'Biochim Biophys Acta Gen Subj'
_citation.journal_id_ASTM ?
_citation.journal_id_CSD ?
_citation.journal_id_ISSN 1872-8006
_citation.journal_full ?
_citation.journal_issue ?
_citation.journal_volume 1865
_citation.language ?
_citation.page_first 129800
_citation.page_last 129800
_citation.title
;Structure-based, multi-targeted drug discovery approach to eicosanoid inhibition: Dual inhibitors of mPGES-1 and 5-lipoxygenase activating protein (FLAP).
;
_citation.year 2020
_citation.database_id_CSD ?
_citation.pdbx_database_id_DOI 10.1016/j.bbagen.2020.129800
_citation.pdbx_database_id_PubMed 33246032
_citation.unpublished_flag ?
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
_citation_author.identifier_ORCID
primary 'Ho, J.D.' 1 ?
primary 'Lee, M.R.' 2 ?
primary 'Rauch, C.T.' 3 ?
primary 'Aznavour, K.' 4 ?
primary 'Park, J.S.' 5 ?
primary 'Luz, J.G.' 6 ?
primary 'Antonysamy, S.' 7 ?
primary 'Condon, B.' 8 ?
primary 'Maletic, M.' 9 ?
primary 'Zhang, A.' 10 ?
primary 'Hickey, M.J.' 11 ?
primary 'Hughes, N.E.' 12 ?
primary 'Chandrasekhar, S.' 13 ?
primary 'Sloan, A.V.' 14 ?
primary 'Gooding, K.' 15 ?
primary 'Harvey, A.' 16 ?
primary 'Yu, X.P.' 17 ?
primary 'Kahl, S.D.' 18 ?
primary 'Norman, B.H.' 19 ?
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.pdbx_ec
_entity.pdbx_mutation
_entity.pdbx_fragment
_entity.details
1 polymer man 'Prostaglandin E synthase' 17323.559 1 5.3.99.3 ? ? ?
2 non-polymer syn '(2R)-cyclopentyl{4-[(quinolin-2-yl)methoxy]phenyl}acetic acid' 361.434 1 ? ? ? ?
3 non-polymer man 'octyl beta-D-glucopyranoside' 292.369 1 ? ? ? ?
4 non-polymer syn 'TETRAETHYLENE GLYCOL' 194.226 2 ? ? ? ?
5 water nat water 18.015 61 ? ? ? ?
#
_entity_name_com.entity_id 1
_entity_name_com.name
'Microsomal glutathione S-transferase 1-like 1,MGST1-L1,Microsomal prostaglandin E synthase 1,MPGES-1,p53-induced gene 12 protein'
#
_entity_poly.entity_id 1
_entity_poly.type 'polypeptide(L)'
_entity_poly.nstd_linkage no
_entity_poly.nstd_monomer yes
_entity_poly.pdbx_seq_one_letter_code
;MALPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQY(CSO)RSDPDVERCLRAHRN
DMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
;
_entity_poly.pdbx_seq_one_letter_code_can
;MALPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMET
IYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
;
_entity_poly.pdbx_strand_id A
_entity_poly.pdbx_target_identifier ?
#
loop_
_pdbx_entity_nonpoly.entity_id
_pdbx_entity_nonpoly.name
_pdbx_entity_nonpoly.comp_id
2 '(2R)-cyclopentyl{4-[(quinolin-2-yl)methoxy]phenyl}acetic acid' QY1
3 'octyl beta-D-glucopyranoside' BOG
4 'TETRAETHYLENE GLYCOL' PG4
5 water HOH
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 MET n
1 2 ALA n
1 3 LEU n
1 4 PRO n
1 5 ALA n
1 6 HIS n
1 7 SER n
1 8 LEU n
1 9 VAL n
1 10 MET n
1 11 SER n
1 12 SER n
1 13 PRO n
1 14 ALA n
1 15 LEU n
1 16 PRO n
1 17 ALA n
1 18 PHE n
1 19 LEU n
1 20 LEU n
1 21 CYS n
1 22 SER n
1 23 THR n
1 24 LEU n
1 25 LEU n
1 26 VAL n
1 27 ILE n
1 28 LYS n
1 29 MET n
1 30 TYR n
1 31 VAL n
1 32 VAL n
1 33 ALA n
1 34 ILE n
1 35 ILE n
1 36 THR n
1 37 GLY n
1 38 GLN n
1 39 VAL n
1 40 ARG n
1 41 LEU n
1 42 ARG n
1 43 LYS n
1 44 LYS n
1 45 ALA n
1 46 PHE n
1 47 ALA n
1 48 ASN n
1 49 PRO n
1 50 GLU n
1 51 ASP n
1 52 ALA n
1 53 LEU n
1 54 ARG n
1 55 HIS n
1 56 GLY n
1 57 GLY n
1 58 PRO n
1 59 GLN n
1 60 TYR n
1 61 CSO n
1 62 ARG n
1 63 SER n
1 64 ASP n
1 65 PRO n
1 66 ASP n
1 67 VAL n
1 68 GLU n
1 69 ARG n
1 70 CYS n
1 71 LEU n
1 72 ARG n
1 73 ALA n
1 74 HIS n
1 75 ARG n
1 76 ASN n
1 77 ASP n
1 78 MET n
1 79 GLU n
1 80 THR n
1 81 ILE n
1 82 TYR n
1 83 PRO n
1 84 PHE n
1 85 LEU n
1 86 PHE n
1 87 LEU n
1 88 GLY n
1 89 PHE n
1 90 VAL n
1 91 TYR n
1 92 SER n
1 93 PHE n
1 94 LEU n
1 95 GLY n
1 96 PRO n
1 97 ASN n
1 98 PRO n
1 99 PHE n
1 100 VAL n
1 101 ALA n
1 102 TRP n
1 103 MET n
1 104 HIS n
1 105 PHE n
1 106 LEU n
1 107 VAL n
1 108 PHE n
1 109 LEU n
1 110 VAL n
1 111 GLY n
1 112 ARG n
1 113 VAL n
1 114 ALA n
1 115 HIS n
1 116 THR n
1 117 VAL n
1 118 ALA n
1 119 TYR n
1 120 LEU n
1 121 GLY n
1 122 LYS n
1 123 LEU n
1 124 ARG n
1 125 ALA n
1 126 PRO n
1 127 ILE n
1 128 ARG n
1 129 SER n
1 130 VAL n
1 131 THR n
1 132 TYR n
1 133 THR n
1 134 LEU n
1 135 ALA n
1 136 GLN n
1 137 LEU n
1 138 PRO n
1 139 CYS n
1 140 ALA n
1 141 SER n
1 142 MET n
1 143 ALA n
1 144 LEU n
1 145 GLN n
1 146 ILE n
1 147 LEU n
1 148 TRP n
1 149 GLU n
1 150 ALA n
1 151 ALA n
1 152 ARG n
1 153 HIS n
1 154 LEU n
#
_entity_src_gen.entity_id 1
_entity_src_gen.pdbx_src_id 1
_entity_src_gen.pdbx_alt_source_flag sample
_entity_src_gen.pdbx_seq_type 'Biological sequence'
_entity_src_gen.pdbx_beg_seq_num 1
_entity_src_gen.pdbx_end_seq_num 154
_entity_src_gen.gene_src_common_name Human
_entity_src_gen.gene_src_genus ?
_entity_src_gen.pdbx_gene_src_gene 'PTGES, MGST1L1, MPGES1, PGES, PIG12'
_entity_src_gen.gene_src_species ?
_entity_src_gen.gene_src_strain ?
_entity_src_gen.gene_src_tissue ?
_entity_src_gen.gene_src_tissue_fraction ?
_entity_src_gen.gene_src_details ?
_entity_src_gen.pdbx_gene_src_fragment ?
_entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens'
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606
_entity_src_gen.pdbx_gene_src_variant ?
_entity_src_gen.pdbx_gene_src_cell_line ?
_entity_src_gen.pdbx_gene_src_atcc ?
_entity_src_gen.pdbx_gene_src_organ ?
_entity_src_gen.pdbx_gene_src_organelle ?
_entity_src_gen.pdbx_gene_src_cell ?
_entity_src_gen.pdbx_gene_src_cellular_location ?
_entity_src_gen.host_org_common_name ?
_entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda'
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108
_entity_src_gen.host_org_genus ?
_entity_src_gen.pdbx_host_org_gene ?
_entity_src_gen.pdbx_host_org_organ ?
_entity_src_gen.host_org_species ?
_entity_src_gen.pdbx_host_org_tissue ?
_entity_src_gen.pdbx_host_org_tissue_fraction ?
_entity_src_gen.pdbx_host_org_strain ?
_entity_src_gen.pdbx_host_org_variant ?
_entity_src_gen.pdbx_host_org_cell_line ?
_entity_src_gen.pdbx_host_org_atcc ?
_entity_src_gen.pdbx_host_org_culture_collection ?
_entity_src_gen.pdbx_host_org_cell ?
_entity_src_gen.pdbx_host_org_organelle ?
_entity_src_gen.pdbx_host_org_cellular_location ?
_entity_src_gen.pdbx_host_org_vector_type ?
_entity_src_gen.pdbx_host_org_vector ?
_entity_src_gen.host_org_details ?
_entity_src_gen.expression_system_id ?
_entity_src_gen.plasmid_name ?
_entity_src_gen.plasmid_details ?
_entity_src_gen.pdbx_description ?
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.mon_nstd_flag
_chem_comp.name
_chem_comp.pdbx_synonyms
_chem_comp.formula
_chem_comp.formula_weight
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103
BOG D-saccharide n 'octyl beta-D-glucopyranoside'
'Beta-Octylglucoside; octyl beta-D-glucoside; octyl D-glucoside; octyl glucoside' 'C14 H28 O6' 292.369
CSO 'L-peptide linking' n S-HYDROXYCYSTEINE ? 'C3 H7 N O3 S' 137.158
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129
GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162
HOH non-polymer . WATER ? 'H2 O' 18.015
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211
PG4 non-polymer . 'TETRAETHYLENE GLYCOL' ? 'C8 H18 O5' 194.226
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130
QY1 non-polymer . '(2R)-cyclopentyl{4-[(quinolin-2-yl)methoxy]phenyl}acetic acid' ? 'C23 H23 N O3' 361.434
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146
#
_pdbx_chem_comp_identifier.comp_id BOG
_pdbx_chem_comp_identifier.type 'IUPAC CARBOHYDRATE SYMBOL'
_pdbx_chem_comp_identifier.program PDB-CARE
_pdbx_chem_comp_identifier.program_version 1.0
_pdbx_chem_comp_identifier.identifier b-octylglucoside
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.ndb_seq_num
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
_pdbx_poly_seq_scheme.hetero
A 1 1 MET 1 -1 ? ? ? A . n
A 1 2 ALA 2 0 ? ? ? A . n
A 1 3 LEU 3 1 ? ? ? A . n
A 1 4 PRO 4 2 ? ? ? A . n
A 1 5 ALA 5 3 ? ? ? A . n
A 1 6 HIS 6 4 ? ? ? A . n
A 1 7 SER 7 5 ? ? ? A . n
A 1 8 LEU 8 6 ? ? ? A . n
A 1 9 VAL 9 7 ? ? ? A . n
A 1 10 MET 10 8 ? ? ? A . n
A 1 11 SER 11 9 ? ? ? A . n
A 1 12 SER 12 10 10 SER SER A . n
A 1 13 PRO 13 11 11 PRO PRO A . n
A 1 14 ALA 14 12 12 ALA ALA A . n
A 1 15 LEU 15 13 13 LEU LEU A . n
A 1 16 PRO 16 14 14 PRO PRO A . n
A 1 17 ALA 17 15 15 ALA ALA A . n
A 1 18 PHE 18 16 16 PHE PHE A . n
A 1 19 LEU 19 17 17 LEU LEU A . n
A 1 20 LEU 20 18 18 LEU LEU A . n
A 1 21 CYS 21 19 19 CYS CYS A . n
A 1 22 SER 22 20 20 SER SER A . n
A 1 23 THR 23 21 21 THR THR A . n
A 1 24 LEU 24 22 22 LEU LEU A . n
A 1 25 LEU 25 23 23 LEU LEU A . n
A 1 26 VAL 26 24 24 VAL VAL A . n
A 1 27 ILE 27 25 25 ILE ILE A . n
A 1 28 LYS 28 26 26 LYS LYS A . n
A 1 29 MET 29 27 27 MET MET A . n
A 1 30 TYR 30 28 28 TYR TYR A . n
A 1 31 VAL 31 29 29 VAL VAL A . n
A 1 32 VAL 32 30 30 VAL VAL A . n
A 1 33 ALA 33 31 31 ALA ALA A . n
A 1 34 ILE 34 32 32 ILE ILE A . n
A 1 35 ILE 35 33 33 ILE ILE A . n
A 1 36 THR 36 34 34 THR THR A . n
A 1 37 GLY 37 35 35 GLY GLY A . n
A 1 38 GLN 38 36 36 GLN GLN A . n
A 1 39 VAL 39 37 37 VAL VAL A . n
A 1 40 ARG 40 38 38 ARG ARG A . n
A 1 41 LEU 41 39 39 LEU LEU A . n
A 1 42 ARG 42 40 40 ARG ARG A . n
A 1 43 LYS 43 41 41 LYS LYS A . n
A 1 44 LYS 44 42 42 LYS LYS A . n
A 1 45 ALA 45 43 43 ALA ALA A . n
A 1 46 PHE 46 44 44 PHE PHE A . n
A 1 47 ALA 47 45 45 ALA ALA A . n
A 1 48 ASN 48 46 46 ASN ASN A . n
A 1 49 PRO 49 47 47 PRO PRO A . n
A 1 50 GLU 50 48 48 GLU GLU A . n
A 1 51 ASP 51 49 49 ASP ASP A . n
A 1 52 ALA 52 50 50 ALA ALA A . n
A 1 53 LEU 53 51 51 LEU LEU A . n
A 1 54 ARG 54 52 52 ARG ARG A . n
A 1 55 HIS 55 53 53 HIS HIS A . n
A 1 56 GLY 56 54 54 GLY GLY A . n
A 1 57 GLY 57 55 55 GLY GLY A . n
A 1 58 PRO 58 56 56 PRO PRO A . n
A 1 59 GLN 59 57 57 GLN GLN A . n
A 1 60 TYR 60 58 58 TYR TYR A . n
A 1 61 CSO 61 59 59 CSO CSO A . n
A 1 62 ARG 62 60 60 ARG ARG A . n
A 1 63 SER 63 61 61 SER SER A . n
A 1 64 ASP 64 62 62 ASP ASP A . n
A 1 65 PRO 65 63 63 PRO PRO A . n
A 1 66 ASP 66 64 64 ASP ASP A . n
A 1 67 VAL 67 65 65 VAL VAL A . n
A 1 68 GLU 68 66 66 GLU GLU A . n
A 1 69 ARG 69 67 67 ARG ARG A . n
A 1 70 CYS 70 68 68 CYS CYS A . n
A 1 71 LEU 71 69 69 LEU LEU A . n
A 1 72 ARG 72 70 70 ARG ARG A . n
A 1 73 ALA 73 71 71 ALA ALA A . n
A 1 74 HIS 74 72 72 HIS HIS A . n
A 1 75 ARG 75 73 73 ARG ARG A . n
A 1 76 ASN 76 74 74 ASN ASN A . n
A 1 77 ASP 77 75 75 ASP ASP A . n
A 1 78 MET 78 76 76 MET MET A . n
A 1 79 GLU 79 77 77 GLU GLU A . n
A 1 80 THR 80 78 78 THR THR A . n
A 1 81 ILE 81 79 79 ILE ILE A . n
A 1 82 TYR 82 80 80 TYR TYR A . n
A 1 83 PRO 83 81 81 PRO PRO A . n
A 1 84 PHE 84 82 82 PHE PHE A . n
A 1 85 LEU 85 83 83 LEU LEU A . n
A 1 86 PHE 86 84 84 PHE PHE A . n
A 1 87 LEU 87 85 85 LEU LEU A . n
A 1 88 GLY 88 86 86 GLY GLY A . n
A 1 89 PHE 89 87 87 PHE PHE A . n
A 1 90 VAL 90 88 88 VAL VAL A . n
A 1 91 TYR 91 89 89 TYR TYR A . n
A 1 92 SER 92 90 90 SER SER A . n
A 1 93 PHE 93 91 91 PHE PHE A . n
A 1 94 LEU 94 92 92 LEU LEU A . n
A 1 95 GLY 95 93 93 GLY GLY A . n
A 1 96 PRO 96 94 94 PRO PRO A . n
A 1 97 ASN 97 95 95 ASN ASN A . n
A 1 98 PRO 98 96 96 PRO PRO A . n
A 1 99 PHE 99 97 97 PHE PHE A . n
A 1 100 VAL 100 98 98 VAL VAL A . n
A 1 101 ALA 101 99 99 ALA ALA A . n
A 1 102 TRP 102 100 100 TRP TRP A . n
A 1 103 MET 103 101 101 MET MET A . n
A 1 104 HIS 104 102 102 HIS HIS A . n
A 1 105 PHE 105 103 103 PHE PHE A . n
A 1 106 LEU 106 104 104 LEU LEU A . n
A 1 107 VAL 107 105 105 VAL VAL A . n
A 1 108 PHE 108 106 106 PHE PHE A . n
A 1 109 LEU 109 107 107 LEU LEU A . n
A 1 110 VAL 110 108 108 VAL VAL A . n
A 1 111 GLY 111 109 109 GLY GLY A . n
A 1 112 ARG 112 110 110 ARG ARG A . n
A 1 113 VAL 113 111 111 VAL VAL A . n
A 1 114 ALA 114 112 112 ALA ALA A . n
A 1 115 HIS 115 113 113 HIS HIS A . n
A 1 116 THR 116 114 114 THR THR A . n
A 1 117 VAL 117 115 115 VAL VAL A . n
A 1 118 ALA 118 116 116 ALA ALA A . n
A 1 119 TYR 119 117 117 TYR TYR A . n
A 1 120 LEU 120 118 118 LEU LEU A . n
A 1 121 GLY 121 119 119 GLY GLY A . n
A 1 122 LYS 122 120 120 LYS LYS A . n
A 1 123 LEU 123 121 121 LEU LEU A . n
A 1 124 ARG 124 122 122 ARG ARG A . n
A 1 125 ALA 125 123 123 ALA ALA A . n
A 1 126 PRO 126 124 124 PRO PRO A . n
A 1 127 ILE 127 125 125 ILE ILE A . n
A 1 128 ARG 128 126 126 ARG ARG A . n
A 1 129 SER 129 127 127 SER SER A . n
A 1 130 VAL 130 128 128 VAL VAL A . n
A 1 131 THR 131 129 129 THR THR A . n
A 1 132 TYR 132 130 130 TYR TYR A . n
A 1 133 THR 133 131 131 THR THR A . n
A 1 134 LEU 134 132 132 LEU LEU A . n
A 1 135 ALA 135 133 133 ALA ALA A . n
A 1 136 GLN 136 134 134 GLN GLN A . n
A 1 137 LEU 137 135 135 LEU LEU A . n
A 1 138 PRO 138 136 136 PRO PRO A . n
A 1 139 CYS 139 137 137 CYS CYS A . n
A 1 140 ALA 140 138 138 ALA ALA A . n
A 1 141 SER 141 139 139 SER SER A . n
A 1 142 MET 142 140 140 MET MET A . n
A 1 143 ALA 143 141 141 ALA ALA A . n
A 1 144 LEU 144 142 142 LEU LEU A . n
A 1 145 GLN 145 143 143 GLN GLN A . n
A 1 146 ILE 146 144 144 ILE ILE A . n
A 1 147 LEU 147 145 145 LEU LEU A . n
A 1 148 TRP 148 146 146 TRP TRP A . n
A 1 149 GLU 149 147 147 GLU GLU A . n
A 1 150 ALA 150 148 148 ALA ALA A . n
A 1 151 ALA 151 149 149 ALA ALA A . n
A 1 152 ARG 152 150 150 ARG ARG A . n
A 1 153 HIS 153 151 151 HIS HIS A . n
A 1 154 LEU 154 152 152 LEU LEU A . n
#
_pdbx_entity_instance_feature.ordinal 1
_pdbx_entity_instance_feature.comp_id QY1
_pdbx_entity_instance_feature.asym_id ?
_pdbx_entity_instance_feature.seq_num ?
_pdbx_entity_instance_feature.auth_comp_id QY1
_pdbx_entity_instance_feature.auth_asym_id ?
_pdbx_entity_instance_feature.auth_seq_num ?
_pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION'
_pdbx_entity_instance_feature.details ?
#
loop_
_pdbx_nonpoly_scheme.asym_id
_pdbx_nonpoly_scheme.entity_id
_pdbx_nonpoly_scheme.mon_id
_pdbx_nonpoly_scheme.ndb_seq_num
_pdbx_nonpoly_scheme.pdb_seq_num
_pdbx_nonpoly_scheme.auth_seq_num
_pdbx_nonpoly_scheme.pdb_mon_id
_pdbx_nonpoly_scheme.auth_mon_id
_pdbx_nonpoly_scheme.pdb_strand_id
_pdbx_nonpoly_scheme.pdb_ins_code
B 2 QY1 1 201 1 QY1 SX1 A .
C 3 BOG 1 202 1 BOG BOG A .
D 4 PG4 1 203 2 PG4 PG4 A .
E 4 PG4 1 204 3 PG4 PG4 A .
F 5 HOH 1 301 47 HOH HOH A .
F 5 HOH 2 302 21 HOH HOH A .
F 5 HOH 3 303 25 HOH HOH A .
F 5 HOH 4 304 15 HOH HOH A .
F 5 HOH 5 305 27 HOH HOH A .
F 5 HOH 6 306 13 HOH HOH A .
F 5 HOH 7 307 49 HOH HOH A .
F 5 HOH 8 308 6 HOH HOH A .
F 5 HOH 9 309 28 HOH HOH A .
F 5 HOH 10 310 14 HOH HOH A .
F 5 HOH 11 311 30 HOH HOH A .
F 5 HOH 12 312 34 HOH HOH A .
F 5 HOH 13 313 56 HOH HOH A .
F 5 HOH 14 314 31 HOH HOH A .
F 5 HOH 15 315 52 HOH HOH A .
F 5 HOH 16 316 39 HOH HOH A .
F 5 HOH 17 317 18 HOH HOH A .
F 5 HOH 18 318 20 HOH HOH A .
F 5 HOH 19 319 40 HOH HOH A .
F 5 HOH 20 320 60 HOH HOH A .
F 5 HOH 21 321 29 HOH HOH A .
F 5 HOH 22 322 44 HOH HOH A .
F 5 HOH 23 323 48 HOH HOH A .
F 5 HOH 24 324 5 HOH HOH A .
F 5 HOH 25 325 54 HOH HOH A .
F 5 HOH 26 326 26 HOH HOH A .
F 5 HOH 27 327 61 HOH HOH A .
F 5 HOH 28 328 16 HOH HOH A .
F 5 HOH 29 329 12 HOH HOH A .
F 5 HOH 30 330 43 HOH HOH A .
F 5 HOH 31 331 42 HOH HOH A .
F 5 HOH 32 332 38 HOH HOH A .
F 5 HOH 33 333 22 HOH HOH A .
F 5 HOH 34 334 46 HOH HOH A .
F 5 HOH 35 335 23 HOH HOH A .
F 5 HOH 36 336 19 HOH HOH A .
F 5 HOH 37 337 32 HOH HOH A .
F 5 HOH 38 338 8 HOH HOH A .
F 5 HOH 39 339 36 HOH HOH A .
F 5 HOH 40 340 2 HOH HOH A .
F 5 HOH 41 341 24 HOH HOH A .
F 5 HOH 42 342 53 HOH HOH A .
F 5 HOH 43 343 57 HOH HOH A .
F 5 HOH 44 344 50 HOH HOH A .
F 5 HOH 45 345 55 HOH HOH A .
F 5 HOH 46 346 11 HOH HOH A .
F 5 HOH 47 347 10 HOH HOH A .
F 5 HOH 48 348 59 HOH HOH A .
F 5 HOH 49 349 7 HOH HOH A .
F 5 HOH 50 350 17 HOH HOH A .
F 5 HOH 51 351 9 HOH HOH A .
F 5 HOH 52 352 35 HOH HOH A .
F 5 HOH 53 353 41 HOH HOH A .
F 5 HOH 54 354 1 HOH HOH A .
F 5 HOH 55 355 58 HOH HOH A .
F 5 HOH 56 356 45 HOH HOH A .
F 5 HOH 57 357 3 HOH HOH A .
F 5 HOH 58 358 33 HOH HOH A .
F 5 HOH 59 359 37 HOH HOH A .
F 5 HOH 60 360 51 HOH HOH A .
F 5 HOH 61 361 4 HOH HOH A .
#
loop_
_pdbx_unobs_or_zero_occ_atoms.id
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num
_pdbx_unobs_or_zero_occ_atoms.polymer_flag
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id
_pdbx_unobs_or_zero_occ_atoms.label_alt_id
_pdbx_unobs_or_zero_occ_atoms.label_asym_id
_pdbx_unobs_or_zero_occ_atoms.label_comp_id
_pdbx_unobs_or_zero_occ_atoms.label_seq_id
_pdbx_unobs_or_zero_occ_atoms.label_atom_id
1 1 Y 1 A SER 10 ? OG ? A SER 12 OG
2 1 N 1 A PG4 204 ? C5 ? E PG4 1 C5
3 1 N 1 A PG4 204 ? C6 ? E PG4 1 C6
4 1 N 1 A PG4 204 ? O4 ? E PG4 1 O4
5 1 N 1 A PG4 204 ? C7 ? E PG4 1 C7
6 1 N 1 A PG4 204 ? C8 ? E PG4 1 C8
7 1 N 1 A PG4 204 ? O5 ? E PG4 1 O5
#
loop_
_software.citation_id
_software.classification
_software.compiler_name
_software.compiler_version
_software.contact_author
_software.contact_author_email
_software.date
_software.description
_software.dependencies
_software.hardware
_software.language
_software.location
_software.mods
_software.name
_software.os
_software.os_version
_software.type
_software.version
_software.pdbx_ordinal
? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0103 1
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 2
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 3
? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 4
? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5
#
_cell.angle_alpha 90.000
_cell.angle_alpha_esd ?
_cell.angle_beta 90.000
_cell.angle_beta_esd ?
_cell.angle_gamma 120.000
_cell.angle_gamma_esd ?
_cell.entry_id 6VL4
_cell.details ?
_cell.formula_units_Z ?
_cell.length_a 76.417
_cell.length_a_esd ?
_cell.length_b 76.417
_cell.length_b_esd ?
_cell.length_c 123.784
_cell.length_c_esd ?
_cell.volume ?
_cell.volume_esd ?
_cell.Z_PDB 9
_cell.reciprocal_angle_alpha ?
_cell.reciprocal_angle_beta ?
_cell.reciprocal_angle_gamma ?
_cell.reciprocal_angle_alpha_esd ?
_cell.reciprocal_angle_beta_esd ?
_cell.reciprocal_angle_gamma_esd ?
_cell.reciprocal_length_a ?
_cell.reciprocal_length_b ?
_cell.reciprocal_length_c ?
_cell.reciprocal_length_a_esd ?
_cell.reciprocal_length_b_esd ?
_cell.reciprocal_length_c_esd ?
_cell.pdbx_unique_axis ?
#
_symmetry.entry_id 6VL4
_symmetry.cell_setting ?
_symmetry.Int_Tables_number 146
_symmetry.space_group_name_Hall ?
_symmetry.space_group_name_H-M 'H 3'
_symmetry.pdbx_full_space_group_name_H-M ?
#
_exptl.absorpt_coefficient_mu ?
_exptl.absorpt_correction_T_max ?
_exptl.absorpt_correction_T_min ?
_exptl.absorpt_correction_type ?
_exptl.absorpt_process_details ?
_exptl.entry_id 6VL4
_exptl.crystals_number 1
_exptl.details ?
_exptl.method 'X-RAY DIFFRACTION'
_exptl.method_details ?
#
_exptl_crystal.colour ?
_exptl_crystal.density_diffrn ?
_exptl_crystal.density_Matthews ?
_exptl_crystal.density_method ?
_exptl_crystal.density_percent_sol ?
_exptl_crystal.description ?
_exptl_crystal.F_000 ?
_exptl_crystal.id 1
_exptl_crystal.preparation ?
_exptl_crystal.size_max ?
_exptl_crystal.size_mid ?
_exptl_crystal.size_min ?
_exptl_crystal.size_rad ?
_exptl_crystal.colour_lustre ?
_exptl_crystal.colour_modifier ?
_exptl_crystal.colour_primary ?
_exptl_crystal.density_meas ?
_exptl_crystal.density_meas_esd ?
_exptl_crystal.density_meas_gt ?
_exptl_crystal.density_meas_lt ?
_exptl_crystal.density_meas_temp ?
_exptl_crystal.density_meas_temp_esd ?
_exptl_crystal.density_meas_temp_gt ?
_exptl_crystal.density_meas_temp_lt ?
_exptl_crystal.pdbx_crystal_image_url ?
_exptl_crystal.pdbx_crystal_image_format ?
_exptl_crystal.pdbx_mosaicity ?
_exptl_crystal.pdbx_mosaicity_esd ?
#
_exptl_crystal_grow.apparatus ?
_exptl_crystal_grow.atmosphere ?
_exptl_crystal_grow.crystal_id 1
_exptl_crystal_grow.details ?
_exptl_crystal_grow.method 'VAPOR DIFFUSION'
_exptl_crystal_grow.method_ref ?
_exptl_crystal_grow.pH 8.2
_exptl_crystal_grow.pressure ?
_exptl_crystal_grow.pressure_esd ?
_exptl_crystal_grow.seeding ?
_exptl_crystal_grow.seeding_ref ?
_exptl_crystal_grow.temp 298
_exptl_crystal_grow.temp_details ?
_exptl_crystal_grow.temp_esd ?
_exptl_crystal_grow.time ?
_exptl_crystal_grow.pdbx_details '100mM Tris HCl pH 8.2, 29% PEG 1K, 1mM DG-031'
_exptl_crystal_grow.pdbx_pH_range ?
#
_diffrn.ambient_environment ?
_diffrn.ambient_temp 100
_diffrn.ambient_temp_details ?
_diffrn.ambient_temp_esd ?
_diffrn.crystal_id 1
_diffrn.crystal_support ?
_diffrn.crystal_treatment ?
_diffrn.details ?
_diffrn.id 1
_diffrn.ambient_pressure ?
_diffrn.ambient_pressure_esd ?
_diffrn.ambient_pressure_gt ?
_diffrn.ambient_pressure_lt ?
_diffrn.ambient_temp_gt ?
_diffrn.ambient_temp_lt ?
_diffrn.pdbx_serial_crystal_experiment N
#
_diffrn_detector.details ?
_diffrn_detector.detector CCD
_diffrn_detector.diffrn_id 1
_diffrn_detector.type 'RAYONIX MX-225'
_diffrn_detector.area_resol_mean ?
_diffrn_detector.dtime ?
_diffrn_detector.pdbx_frames_total ?
_diffrn_detector.pdbx_collection_time_total ?
_diffrn_detector.pdbx_collection_date 2013-05-30
_diffrn_detector.pdbx_frequency ?
#
_diffrn_radiation.collimation ?
_diffrn_radiation.diffrn_id 1
_diffrn_radiation.filter_edge ?
_diffrn_radiation.inhomogeneity ?
_diffrn_radiation.monochromator ?
_diffrn_radiation.polarisn_norm ?
_diffrn_radiation.polarisn_ratio ?
_diffrn_radiation.probe ?
_diffrn_radiation.type ?
_diffrn_radiation.xray_symbol ?
_diffrn_radiation.wavelength_id 1
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l M
_diffrn_radiation.pdbx_wavelength_list ?
_diffrn_radiation.pdbx_wavelength ?
_diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH'
_diffrn_radiation.pdbx_analyzer ?
_diffrn_radiation.pdbx_scattering_type x-ray
#
_diffrn_radiation_wavelength.id 1
_diffrn_radiation_wavelength.wavelength 0.9793
_diffrn_radiation_wavelength.wt 1.0
#
_diffrn_source.current ?
_diffrn_source.details ?
_diffrn_source.diffrn_id 1
_diffrn_source.power ?
_diffrn_source.size ?
_diffrn_source.source SYNCHROTRON
_diffrn_source.target ?
_diffrn_source.type 'APS BEAMLINE 31-ID'
_diffrn_source.voltage ?
_diffrn_source.take-off_angle ?
_diffrn_source.pdbx_wavelength_list 0.9793
_diffrn_source.pdbx_wavelength ?
_diffrn_source.pdbx_synchrotron_beamline 31-ID
_diffrn_source.pdbx_synchrotron_site APS
#
_reflns.B_iso_Wilson_estimate ?
_reflns.entry_id 6VL4
_reflns.data_reduction_details ?
_reflns.data_reduction_method ?
_reflns.d_resolution_high 1.4
_reflns.d_resolution_low 23.19
_reflns.details ?
_reflns.limit_h_max ?
_reflns.limit_h_min ?
_reflns.limit_k_max ?
_reflns.limit_k_min ?
_reflns.limit_l_max ?
_reflns.limit_l_min ?
_reflns.number_all ?
_reflns.number_obs 52754
_reflns.observed_criterion ?
_reflns.observed_criterion_F_max ?
_reflns.observed_criterion_F_min ?
_reflns.observed_criterion_I_max ?
_reflns.observed_criterion_I_min ?
_reflns.observed_criterion_sigma_F ?
_reflns.observed_criterion_sigma_I ?
_reflns.percent_possible_obs 99.3
_reflns.R_free_details ?
_reflns.Rmerge_F_all ?
_reflns.Rmerge_F_obs ?
_reflns.Friedel_coverage ?
_reflns.number_gt ?
_reflns.threshold_expression ?
_reflns.pdbx_redundancy 5.6
_reflns.pdbx_Rmerge_I_obs ?
_reflns.pdbx_Rmerge_I_all ?
_reflns.pdbx_Rsym_value 0.082
_reflns.pdbx_netI_over_av_sigmaI ?
_reflns.pdbx_netI_over_sigmaI 10.3
_reflns.pdbx_res_netI_over_av_sigmaI_2 ?
_reflns.pdbx_res_netI_over_sigmaI_2 ?
_reflns.pdbx_chi_squared ?
_reflns.pdbx_scaling_rejects ?
_reflns.pdbx_d_res_high_opt ?
_reflns.pdbx_d_res_low_opt ?
_reflns.pdbx_d_res_opt_method ?
_reflns.phase_calculation_details ?
_reflns.pdbx_Rrim_I_all ?
_reflns.pdbx_Rpim_I_all ?
_reflns.pdbx_d_opt ?
_reflns.pdbx_number_measured_all ?
_reflns.pdbx_diffrn_id 1
_reflns.pdbx_ordinal 1
_reflns.pdbx_CC_half ?
_reflns.pdbx_CC_star ?
_reflns.pdbx_R_split ?
#
_reflns_shell.d_res_high 1.4
_reflns_shell.d_res_low 1.48
_reflns_shell.meanI_over_sigI_all ?
_reflns_shell.meanI_over_sigI_obs 2.4
_reflns_shell.number_measured_all ?
_reflns_shell.number_measured_obs ?
_reflns_shell.number_possible ?
_reflns_shell.number_unique_all ?
_reflns_shell.number_unique_obs 7803
_reflns_shell.percent_possible_all ?
_reflns_shell.percent_possible_obs ?
_reflns_shell.Rmerge_F_all ?
_reflns_shell.Rmerge_F_obs ?
_reflns_shell.Rmerge_I_all ?
_reflns_shell.Rmerge_I_obs ?
_reflns_shell.meanI_over_sigI_gt ?
_reflns_shell.meanI_over_uI_all ?
_reflns_shell.meanI_over_uI_gt ?
_reflns_shell.number_measured_gt ?
_reflns_shell.number_unique_gt ?
_reflns_shell.percent_possible_gt ?
_reflns_shell.Rmerge_F_gt ?
_reflns_shell.Rmerge_I_gt ?
_reflns_shell.pdbx_redundancy ?
_reflns_shell.pdbx_Rsym_value 0.72
_reflns_shell.pdbx_chi_squared ?
_reflns_shell.pdbx_netI_over_sigmaI_all ?
_reflns_shell.pdbx_netI_over_sigmaI_obs ?
_reflns_shell.pdbx_Rrim_I_all ?
_reflns_shell.pdbx_Rpim_I_all ?
_reflns_shell.pdbx_rejects ?
_reflns_shell.pdbx_ordinal 1
_reflns_shell.pdbx_diffrn_id 1
_reflns_shell.pdbx_CC_half ?
_reflns_shell.pdbx_CC_star ?
_reflns_shell.pdbx_R_split ?
#
_refine.aniso_B[1][1] 2.5100
_refine.aniso_B[1][2] 0.0000
_refine.aniso_B[1][3] 0.0000
_refine.aniso_B[2][2] 2.5100
_refine.aniso_B[2][3] 0.0000
_refine.aniso_B[3][3] -5.0200
_refine.B_iso_max 81.660
_refine.B_iso_mean 19.1960
_refine.B_iso_min 5.220
_refine.correlation_coeff_Fo_to_Fc 0.9730
_refine.correlation_coeff_Fo_to_Fc_free 0.9730
_refine.details
'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT U VALUES : REFINED INDIVIDUALLY'
_refine.diff_density_max ?
_refine.diff_density_max_esd ?
_refine.diff_density_min ?
_refine.diff_density_min_esd ?
_refine.diff_density_rms ?
_refine.diff_density_rms_esd ?
_refine.entry_id 6VL4
_refine.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine.ls_abs_structure_details ?
_refine.ls_abs_structure_Flack ?
_refine.ls_abs_structure_Flack_esd ?
_refine.ls_abs_structure_Rogers ?
_refine.ls_abs_structure_Rogers_esd ?
_refine.ls_d_res_high 1.4000
_refine.ls_d_res_low 17.6000
_refine.ls_extinction_coef ?
_refine.ls_extinction_coef_esd ?
_refine.ls_extinction_expression ?
_refine.ls_extinction_method ?
_refine.ls_goodness_of_fit_all ?
_refine.ls_goodness_of_fit_all_esd ?
_refine.ls_goodness_of_fit_obs ?
_refine.ls_goodness_of_fit_obs_esd ?
_refine.ls_hydrogen_treatment ?
_refine.ls_matrix_type ?
_refine.ls_number_constraints ?
_refine.ls_number_parameters ?
_refine.ls_number_reflns_all ?
_refine.ls_number_reflns_obs 50099
_refine.ls_number_reflns_R_free 2652
_refine.ls_number_reflns_R_work ?
_refine.ls_number_restraints ?
_refine.ls_percent_reflns_obs 99.3600
_refine.ls_percent_reflns_R_free 5.0000
_refine.ls_R_factor_all ?
_refine.ls_R_factor_obs 0.1398
_refine.ls_R_factor_R_free 0.1450
_refine.ls_R_factor_R_free_error ?
_refine.ls_R_factor_R_free_error_details ?
_refine.ls_R_factor_R_work 0.1396
_refine.ls_R_Fsqd_factor_obs ?
_refine.ls_R_I_factor_obs ?
_refine.ls_redundancy_reflns_all ?
_refine.ls_redundancy_reflns_obs ?
_refine.ls_restrained_S_all ?
_refine.ls_restrained_S_obs ?
_refine.ls_shift_over_esd_max ?
_refine.ls_shift_over_esd_mean ?
_refine.ls_structure_factor_coef ?
_refine.ls_weighting_details ?
_refine.ls_weighting_scheme ?
_refine.ls_wR_factor_all ?
_refine.ls_wR_factor_obs ?
_refine.ls_wR_factor_R_free ?
_refine.ls_wR_factor_R_work ?
_refine.occupancy_max ?
_refine.occupancy_min ?
_refine.solvent_model_details ?
_refine.solvent_model_param_bsol ?
_refine.solvent_model_param_ksol ?
_refine.pdbx_R_complete ?
_refine.ls_R_factor_gt ?
_refine.ls_goodness_of_fit_gt ?
_refine.ls_goodness_of_fit_ref ?
_refine.ls_shift_over_su_max ?
_refine.ls_shift_over_su_max_lt ?
_refine.ls_shift_over_su_mean ?
_refine.ls_shift_over_su_mean_lt ?
_refine.pdbx_ls_sigma_I ?
_refine.pdbx_ls_sigma_F 0.000
_refine.pdbx_ls_sigma_Fsqd ?
_refine.pdbx_data_cutoff_high_absF ?
_refine.pdbx_data_cutoff_high_rms_absF ?
_refine.pdbx_data_cutoff_low_absF ?
_refine.pdbx_isotropic_thermal_model ?
_refine.pdbx_ls_cross_valid_method THROUGHOUT
_refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT'
_refine.pdbx_starting_model ?
_refine.pdbx_stereochemistry_target_values ?
_refine.pdbx_R_Free_selection_details RANDOM
_refine.pdbx_stereochem_target_val_spec_case ?
_refine.pdbx_overall_ESU_R 0.0070
_refine.pdbx_overall_ESU_R_Free 0.0070
_refine.pdbx_solvent_vdw_probe_radii 1.2000
_refine.pdbx_solvent_ion_probe_radii 0.8000
_refine.pdbx_solvent_shrinkage_radii 0.8000
_refine.pdbx_real_space_R ?
_refine.pdbx_density_correlation ?
_refine.pdbx_pd_number_of_powder_patterns ?
_refine.pdbx_pd_number_of_points ?
_refine.pdbx_pd_meas_number_of_points ?
_refine.pdbx_pd_proc_ls_prof_R_factor ?
_refine.pdbx_pd_proc_ls_prof_wR_factor ?
_refine.pdbx_pd_Marquardt_correlation_coeff ?
_refine.pdbx_pd_Fsqrd_R_factor ?
_refine.pdbx_pd_ls_matrix_band_width ?
_refine.pdbx_overall_phase_error ?
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI ?
_refine.pdbx_overall_SU_R_free_Blow_DPI ?
_refine.pdbx_overall_SU_R_Blow_DPI ?
_refine.pdbx_TLS_residual_ADP_flag ?
_refine.pdbx_diffrn_id 1
_refine.overall_SU_B 0.3400
_refine.overall_SU_ML 0.0150
_refine.overall_SU_R_Cruickshank_DPI ?
_refine.overall_SU_R_free ?
_refine.overall_FOM_free_R_set ?
_refine.overall_FOM_work_R_set ?
_refine.pdbx_average_fsc_overall ?
_refine.pdbx_average_fsc_work ?
_refine.pdbx_average_fsc_free ?
#
_refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_hist.cycle_id final
_refine_hist.details ?
_refine_hist.d_res_high 1.4000
_refine_hist.d_res_low 17.6000
_refine_hist.number_atoms_solvent 61
_refine_hist.number_atoms_total 1267
_refine_hist.number_reflns_all ?
_refine_hist.number_reflns_obs ?
_refine_hist.number_reflns_R_free ?
_refine_hist.number_reflns_R_work ?
_refine_hist.R_factor_all ?
_refine_hist.R_factor_obs ?
_refine_hist.R_factor_R_free ?
_refine_hist.R_factor_R_work ?
_refine_hist.pdbx_number_residues_total 143
_refine_hist.pdbx_B_iso_mean_ligand 42.26
_refine_hist.pdbx_B_iso_mean_solvent 24.77
_refine_hist.pdbx_number_atoms_protein 1139
_refine_hist.pdbx_number_atoms_nucleic_acid 0
_refine_hist.pdbx_number_atoms_ligand 67
_refine_hist.pdbx_number_atoms_lipid ?
_refine_hist.pdbx_number_atoms_carb ?
_refine_hist.pdbx_pseudo_atom_details ?
#
loop_
_refine_ls_restr.pdbx_refine_id
_refine_ls_restr.criterion
_refine_ls_restr.dev_ideal
_refine_ls_restr.dev_ideal_target
_refine_ls_restr.number
_refine_ls_restr.rejects
_refine_ls_restr.type
_refine_ls_restr.weight
_refine_ls_restr.pdbx_restraint_function
'X-RAY DIFFRACTION' ? 0.003 0.012 1277 ? r_bond_refined_d ? ?
'X-RAY DIFFRACTION' ? 1.002 1.701 1736 ? r_angle_refined_deg ? ?
'X-RAY DIFFRACTION' ? 4.006 5.000 152 ? r_dihedral_angle_1_deg ? ?
'X-RAY DIFFRACTION' ? 41.093 21.176 51 ? r_dihedral_angle_2_deg ? ?
'X-RAY DIFFRACTION' ? 13.066 15.000 194 ? r_dihedral_angle_3_deg ? ?
'X-RAY DIFFRACTION' ? 11.019 15.000 11 ? r_dihedral_angle_4_deg ? ?
'X-RAY DIFFRACTION' ? 0.091 0.200 161 ? r_chiral_restr ? ?
'X-RAY DIFFRACTION' ? 0.004 0.020 930 ? r_gen_planes_refined ? ?
#
_refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_ls_shell.d_res_high 1.4000
_refine_ls_shell.d_res_low 1.4360
_refine_ls_shell.number_reflns_all 3934
_refine_ls_shell.number_reflns_obs ?
_refine_ls_shell.number_reflns_R_free 196
_refine_ls_shell.number_reflns_R_work 3738
_refine_ls_shell.percent_reflns_obs 99.9700
_refine_ls_shell.percent_reflns_R_free ?
_refine_ls_shell.R_factor_all ?
_refine_ls_shell.R_factor_obs ?
_refine_ls_shell.R_factor_R_free 0.2650
_refine_ls_shell.R_factor_R_free_error 0.0000
_refine_ls_shell.R_factor_R_work 0.2430
_refine_ls_shell.redundancy_reflns_all ?
_refine_ls_shell.redundancy_reflns_obs ?
_refine_ls_shell.wR_factor_all ?
_refine_ls_shell.wR_factor_obs ?
_refine_ls_shell.wR_factor_R_free ?
_refine_ls_shell.wR_factor_R_work ?
_refine_ls_shell.pdbx_R_complete ?
_refine_ls_shell.pdbx_total_number_of_bins_used 20
_refine_ls_shell.pdbx_phase_error ?
_refine_ls_shell.pdbx_fsc_work ?
_refine_ls_shell.pdbx_fsc_free ?
#
_struct.entry_id 6VL4
_struct.title 'Crystal Structure of mPGES-1 bound to DG-031'
_struct.pdbx_model_details ?
_struct.pdbx_formula_weight ?
_struct.pdbx_formula_weight_method ?
_struct.pdbx_model_type_details ?
_struct.pdbx_CASP_flag N
#
_struct_keywords.entry_id 6VL4
_struct_keywords.text 'mPGES-1, MEMBRANE PROTEIN, ISOMERASE'
_struct_keywords.pdbx_keywords 'ISOMERASE, MEMBRANE PROTEIN'
#
loop_
_struct_asym.id
_struct_asym.pdbx_blank_PDB_chainid_flag
_struct_asym.pdbx_modified
_struct_asym.entity_id
_struct_asym.details
A N N 1 ?
B N N 2 ?
C N N 3 ?
D N N 4 ?
E N N 4 ?
F N N 5 ?
#
_struct_ref.id 1
_struct_ref.db_name UNP
_struct_ref.db_code PTGES_HUMAN
_struct_ref.pdbx_db_accession O14684
_struct_ref.pdbx_db_isoform ?
_struct_ref.entity_id 1
_struct_ref.pdbx_seq_one_letter_code
;PAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYP
FLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
;
_struct_ref.pdbx_align_begin 2
#
_struct_ref_seq.align_id 1
_struct_ref_seq.ref_id 1
_struct_ref_seq.pdbx_PDB_id_code 6VL4
_struct_ref_seq.pdbx_strand_id A
_struct_ref_seq.seq_align_beg 4
_struct_ref_seq.pdbx_seq_align_beg_ins_code ?
_struct_ref_seq.seq_align_end 154
_struct_ref_seq.pdbx_seq_align_end_ins_code ?
_struct_ref_seq.pdbx_db_accession O14684
_struct_ref_seq.db_align_beg 2
_struct_ref_seq.pdbx_db_align_beg_ins_code ?
_struct_ref_seq.db_align_end 152
_struct_ref_seq.pdbx_db_align_end_ins_code ?
_struct_ref_seq.pdbx_auth_seq_align_beg 2
_struct_ref_seq.pdbx_auth_seq_align_end 152
#
loop_
_struct_ref_seq_dif.align_id
_struct_ref_seq_dif.pdbx_pdb_id_code
_struct_ref_seq_dif.mon_id
_struct_ref_seq_dif.pdbx_pdb_strand_id
_struct_ref_seq_dif.seq_num
_struct_ref_seq_dif.pdbx_pdb_ins_code
_struct_ref_seq_dif.pdbx_seq_db_name
_struct_ref_seq_dif.pdbx_seq_db_accession_code
_struct_ref_seq_dif.db_mon_id
_struct_ref_seq_dif.pdbx_seq_db_seq_num
_struct_ref_seq_dif.details
_struct_ref_seq_dif.pdbx_auth_seq_num
_struct_ref_seq_dif.pdbx_ordinal
1 6VL4 MET A 1 ? UNP O14684 ? ? 'initiating methionine' -1 1
1 6VL4 ALA A 2 ? UNP O14684 ? ? 'expression tag' 0 2
1 6VL4 LEU A 3 ? UNP O14684 ? ? 'expression tag' 1 3
#
_pdbx_struct_assembly.id 1
_pdbx_struct_assembly.details author_and_software_defined_assembly
_pdbx_struct_assembly.method_details PISA
_pdbx_struct_assembly.oligomeric_details trimeric
_pdbx_struct_assembly.oligomeric_count 3
#
loop_
_pdbx_struct_assembly_prop.biol_id
_pdbx_struct_assembly_prop.type
_pdbx_struct_assembly_prop.value
_pdbx_struct_assembly_prop.details
1 'ABSA (A^2)' 11370 ?
1 MORE -23 ?
1 'SSA (A^2)' 18130 ?
#
_pdbx_struct_assembly_gen.assembly_id 1
_pdbx_struct_assembly_gen.oper_expression 1,2,3
_pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F
#
_pdbx_struct_assembly_auth_evidence.id 1
_pdbx_struct_assembly_auth_evidence.assembly_id 1
_pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration'
_pdbx_struct_assembly_auth_evidence.details ?
#
loop_
_pdbx_struct_oper_list.id
_pdbx_struct_oper_list.type
_pdbx_struct_oper_list.name
_pdbx_struct_oper_list.symmetry_operation
_pdbx_struct_oper_list.matrix[1][1]
_pdbx_struct_oper_list.matrix[1][2]
_pdbx_struct_oper_list.matrix[1][3]
_pdbx_struct_oper_list.vector[1]
_pdbx_struct_oper_list.matrix[2][1]
_pdbx_struct_oper_list.matrix[2][2]
_pdbx_struct_oper_list.matrix[2][3]
_pdbx_struct_oper_list.vector[2]
_pdbx_struct_oper_list.matrix[3][1]
_pdbx_struct_oper_list.matrix[3][2]
_pdbx_struct_oper_list.matrix[3][3]
_pdbx_struct_oper_list.vector[3]
1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000
2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000
3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000
#
loop_
_struct_conf.conf_type_id
_struct_conf.id
_struct_conf.pdbx_PDB_helix_id
_struct_conf.beg_label_comp_id
_struct_conf.beg_label_asym_id
_struct_conf.beg_label_seq_id
_struct_conf.pdbx_beg_PDB_ins_code
_struct_conf.end_label_comp_id
_struct_conf.end_label_asym_id
_struct_conf.end_label_seq_id
_struct_conf.pdbx_end_PDB_ins_code
_struct_conf.beg_auth_comp_id
_struct_conf.beg_auth_asym_id
_struct_conf.beg_auth_seq_id
_struct_conf.end_auth_comp_id
_struct_conf.end_auth_asym_id
_struct_conf.end_auth_seq_id
_struct_conf.pdbx_PDB_helix_class
_struct_conf.details
_struct_conf.pdbx_PDB_helix_length
HELX_P HELX_P1 AA1 ALA A 14 ? LYS A 44 ? ALA A 12 LYS A 42 1 ? 31
HELX_P HELX_P2 AA2 ASN A 48 ? HIS A 55 ? ASN A 46 HIS A 53 1 ? 8
HELX_P HELX_P3 AA3 GLY A 57 ? CSO A 61 ? GLY A 55 CSO A 59 5 ? 5
HELX_P HELX_P4 AA4 ASP A 64 ? PHE A 93 ? ASP A 62 PHE A 91 1 ? 30
HELX_P HELX_P5 AA5 ASN A 97 ? GLY A 121 ? ASN A 95 GLY A 119 1 ? 25
HELX_P HELX_P6 AA6 PRO A 126 ? HIS A 153 ? PRO A 124 HIS A 151 1 ? 28
#
_struct_conf_type.id HELX_P
_struct_conf_type.criteria ?
_struct_conf_type.reference ?
#
loop_
_struct_conn.id
_struct_conn.conn_type_id
_struct_conn.pdbx_leaving_atom_flag
_struct_conn.pdbx_PDB_id
_struct_conn.ptnr1_label_asym_id
_struct_conn.ptnr1_label_comp_id
_struct_conn.ptnr1_label_seq_id
_struct_conn.ptnr1_label_atom_id
_struct_conn.pdbx_ptnr1_label_alt_id
_struct_conn.pdbx_ptnr1_PDB_ins_code
_struct_conn.pdbx_ptnr1_standard_comp_id
_struct_conn.ptnr1_symmetry
_struct_conn.ptnr2_label_asym_id
_struct_conn.ptnr2_label_comp_id
_struct_conn.ptnr2_label_seq_id
_struct_conn.ptnr2_label_atom_id
_struct_conn.pdbx_ptnr2_label_alt_id
_struct_conn.pdbx_ptnr2_PDB_ins_code
_struct_conn.ptnr1_auth_asym_id
_struct_conn.ptnr1_auth_comp_id
_struct_conn.ptnr1_auth_seq_id
_struct_conn.ptnr2_auth_asym_id
_struct_conn.ptnr2_auth_comp_id
_struct_conn.ptnr2_auth_seq_id
_struct_conn.ptnr2_symmetry
_struct_conn.pdbx_ptnr3_label_atom_id
_struct_conn.pdbx_ptnr3_label_seq_id
_struct_conn.pdbx_ptnr3_label_comp_id
_struct_conn.pdbx_ptnr3_label_asym_id
_struct_conn.pdbx_ptnr3_label_alt_id
_struct_conn.pdbx_ptnr3_PDB_ins_code
_struct_conn.details
_struct_conn.pdbx_dist_value
_struct_conn.pdbx_value_order
_struct_conn.pdbx_role
covale1 covale both ? A TYR 60 C ? ? ? 1_555 A CSO 61 N ? ? A TYR 58 A CSO 59 1_555 ? ? ? ? ? ? ? 1.341 ? ?
covale2 covale both ? A CSO 61 C ? ? ? 1_555 A ARG 62 N ? ? A CSO 59 A ARG 60 1_555 ? ? ? ? ? ? ? 1.338 ? ?
#
_struct_conn_type.id covale
_struct_conn_type.criteria ?
_struct_conn_type.reference ?
#
_pdbx_modification_feature.ordinal 1
_pdbx_modification_feature.label_comp_id CSO
_pdbx_modification_feature.label_asym_id A
_pdbx_modification_feature.label_seq_id 61
_pdbx_modification_feature.label_alt_id ?
_pdbx_modification_feature.modified_residue_label_comp_id .
_pdbx_modification_feature.modified_residue_label_asym_id .
_pdbx_modification_feature.modified_residue_label_seq_id .
_pdbx_modification_feature.modified_residue_label_alt_id .
_pdbx_modification_feature.auth_comp_id CSO
_pdbx_modification_feature.auth_asym_id A
_pdbx_modification_feature.auth_seq_id 59
_pdbx_modification_feature.PDB_ins_code ?
_pdbx_modification_feature.symmetry 1_555
_pdbx_modification_feature.modified_residue_auth_comp_id .
_pdbx_modification_feature.modified_residue_auth_asym_id .
_pdbx_modification_feature.modified_residue_auth_seq_id .
_pdbx_modification_feature.modified_residue_PDB_ins_code .
_pdbx_modification_feature.modified_residue_symmetry .
_pdbx_modification_feature.comp_id_linking_atom .
_pdbx_modification_feature.modified_residue_id_linking_atom .
_pdbx_modification_feature.modified_residue_id CYS
_pdbx_modification_feature.ref_pcm_id 1
_pdbx_modification_feature.ref_comp_id CSO
_pdbx_modification_feature.type Hydroxylation
_pdbx_modification_feature.category 'Named protein modification'
#
_struct_mon_prot_cis.pdbx_id 1
_struct_mon_prot_cis.label_comp_id ALA
_struct_mon_prot_cis.label_seq_id 125
_struct_mon_prot_cis.label_asym_id A
_struct_mon_prot_cis.label_alt_id .
_struct_mon_prot_cis.pdbx_PDB_ins_code ?
_struct_mon_prot_cis.auth_comp_id ALA
_struct_mon_prot_cis.auth_seq_id 123
_struct_mon_prot_cis.auth_asym_id A
_struct_mon_prot_cis.pdbx_label_comp_id_2 PRO
_struct_mon_prot_cis.pdbx_label_seq_id_2 126
_struct_mon_prot_cis.pdbx_label_asym_id_2 A
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 ?
_struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO
_struct_mon_prot_cis.pdbx_auth_seq_id_2 124
_struct_mon_prot_cis.pdbx_auth_asym_id_2 A
_struct_mon_prot_cis.pdbx_PDB_model_num 1
_struct_mon_prot_cis.pdbx_omega_angle 7.33
#
_pdbx_entry_details.entry_id 6VL4
_pdbx_entry_details.has_ligand_of_interest Y
_pdbx_entry_details.compound_details ?
_pdbx_entry_details.source_details ?
_pdbx_entry_details.nonpolymer_details ?
_pdbx_entry_details.sequence_details ?
_pdbx_entry_details.has_protein_modification Y
#
_pdbx_struct_mod_residue.id 1
_pdbx_struct_mod_residue.label_asym_id A
_pdbx_struct_mod_residue.label_comp_id CSO
_pdbx_struct_mod_residue.label_seq_id 61
_pdbx_struct_mod_residue.auth_asym_id A
_pdbx_struct_mod_residue.auth_comp_id CSO
_pdbx_struct_mod_residue.auth_seq_id 59
_pdbx_struct_mod_residue.PDB_ins_code ?
_pdbx_struct_mod_residue.parent_comp_id CYS
_pdbx_struct_mod_residue.details 'modified residue'
#
loop_
_pdbx_unobs_or_zero_occ_residues.id
_pdbx_unobs_or_zero_occ_residues.PDB_model_num
_pdbx_unobs_or_zero_occ_residues.polymer_flag
_pdbx_unobs_or_zero_occ_residues.occupancy_flag
_pdbx_unobs_or_zero_occ_residues.auth_asym_id
_pdbx_unobs_or_zero_occ_residues.auth_comp_id
_pdbx_unobs_or_zero_occ_residues.auth_seq_id
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code
_pdbx_unobs_or_zero_occ_residues.label_asym_id
_pdbx_unobs_or_zero_occ_residues.label_comp_id
_pdbx_unobs_or_zero_occ_residues.label_seq_id
1 1 Y 1 A MET -1 ? A MET 1
2 1 Y 1 A ALA 0 ? A ALA 2
3 1 Y 1 A LEU 1 ? A LEU 3
4 1 Y 1 A PRO 2 ? A PRO 4
5 1 Y 1 A ALA 3 ? A ALA 5
6 1 Y 1 A HIS 4 ? A HIS 6
7 1 Y 1 A SER 5 ? A SER 7
8 1 Y 1 A LEU 6 ? A LEU 8
9 1 Y 1 A VAL 7 ? A VAL 9
10 1 Y 1 A MET 8 ? A MET 10
11 1 Y 1 A SER 9 ? A SER 11
#
loop_
_chem_comp_atom.comp_id
_chem_comp_atom.atom_id
_chem_comp_atom.type_symbol
_chem_comp_atom.pdbx_aromatic_flag
_chem_comp_atom.pdbx_stereo_config
_chem_comp_atom.pdbx_ordinal
ALA N N N N 1
ALA CA C N S 2
ALA C C N N 3
ALA O O N N 4
ALA CB C N N 5
ALA OXT O N N 6
ALA H H N N 7
ALA H2 H N N 8
ALA HA H N N 9
ALA HB1 H N N 10
ALA HB2 H N N 11
ALA HB3 H N N 12
ALA HXT H N N 13
ARG N N N N 14
ARG CA C N S 15
ARG C C N N 16
ARG O O N N 17
ARG CB C N N 18
ARG CG C N N 19
ARG CD C N N 20
ARG NE N N N 21
ARG CZ C N N 22
ARG NH1 N N N 23
ARG NH2 N N N 24
ARG OXT O N N 25
ARG H H N N 26
ARG H2 H N N 27
ARG HA H N N 28
ARG HB2 H N N 29
ARG HB3 H N N 30
ARG HG2 H N N 31
ARG HG3 H N N 32
ARG HD2 H N N 33
ARG HD3 H N N 34
ARG HE H N N 35
ARG HH11 H N N 36
ARG HH12 H N N 37
ARG HH21 H N N 38
ARG HH22 H N N 39
ARG HXT H N N 40
ASN N N N N 41
ASN CA C N S 42
ASN C C N N 43
ASN O O N N 44
ASN CB C N N 45
ASN CG C N N 46
ASN OD1 O N N 47
ASN ND2 N N N 48
ASN OXT O N N 49
ASN H H N N 50
ASN H2 H N N 51
ASN HA H N N 52
ASN HB2 H N N 53
ASN HB3 H N N 54
ASN HD21 H N N 55
ASN HD22 H N N 56
ASN HXT H N N 57
ASP N N N N 58
ASP CA C N S 59
ASP C C N N 60
ASP O O N N 61
ASP CB C N N 62
ASP CG C N N 63
ASP OD1 O N N 64
ASP OD2 O N N 65
ASP OXT O N N 66
ASP H H N N 67
ASP H2 H N N 68
ASP HA H N N 69
ASP HB2 H N N 70
ASP HB3 H N N 71
ASP HD2 H N N 72
ASP HXT H N N 73
BOG C1 C N R 74
BOG O1 O N N 75
BOG C2 C N R 76
BOG O2 O N N 77
BOG C3 C N S 78
BOG O3 O N N 79
BOG C4 C N S 80
BOG O4 O N N 81
BOG C5 C N R 82
BOG O5 O N N 83
BOG C6 C N N 84
BOG O6 O N N 85
BOG "C1'" C N N 86
BOG "C2'" C N N 87
BOG "C3'" C N N 88
BOG "C4'" C N N 89
BOG "C5'" C N N 90
BOG "C6'" C N N 91
BOG "C7'" C N N 92
BOG "C8'" C N N 93
BOG H1 H N N 94
BOG H2 H N N 95
BOG HO2 H N N 96
BOG H3 H N N 97
BOG HO3 H N N 98
BOG H4 H N N 99
BOG HO4 H N N 100
BOG H5 H N N 101
BOG H61 H N N 102
BOG H62 H N N 103
BOG HO6 H N N 104
BOG "H1'1" H N N 105
BOG "H1'2" H N N 106
BOG "H2'1" H N N 107
BOG "H2'2" H N N 108
BOG "H3'1" H N N 109
BOG "H3'2" H N N 110
BOG "H4'1" H N N 111
BOG "H4'2" H N N 112
BOG "H5'1" H N N 113
BOG "H5'2" H N N 114
BOG "H6'1" H N N 115
BOG "H6'2" H N N 116
BOG "H7'1" H N N 117
BOG "H7'2" H N N 118
BOG "H8'1" H N N 119
BOG "H8'2" H N N 120
BOG "H8'3" H N N 121
CSO N N N N 122
CSO CA C N R 123
CSO CB C N N 124
CSO SG S N N 125
CSO C C N N 126
CSO O O N N 127
CSO OXT O N N 128
CSO OD O N N 129
CSO H H N N 130
CSO H2 H N N 131
CSO HA H N N 132
CSO HB2 H N N 133
CSO HB3 H N N 134
CSO HXT H N N 135
CSO HD H N N 136
CYS N N N N 137
CYS CA C N R 138
CYS C C N N 139
CYS O O N N 140
CYS CB C N N 141
CYS SG S N N 142
CYS OXT O N N 143
CYS H H N N 144
CYS H2 H N N 145
CYS HA H N N 146
CYS HB2 H N N 147
CYS HB3 H N N 148
CYS HG H N N 149
CYS HXT H N N 150
GLN N N N N 151
GLN CA C N S 152
GLN C C N N 153
GLN O O N N 154
GLN CB C N N 155
GLN CG C N N 156
GLN CD C N N 157
GLN OE1 O N N 158
GLN NE2 N N N 159
GLN OXT O N N 160
GLN H H N N 161
GLN H2 H N N 162
GLN HA H N N 163
GLN HB2 H N N 164
GLN HB3 H N N 165
GLN HG2 H N N 166
GLN HG3 H N N 167
GLN HE21 H N N 168
GLN HE22 H N N 169
GLN HXT H N N 170
GLU N N N N 171
GLU CA C N S 172
GLU C C N N 173
GLU O O N N 174
GLU CB C N N 175
GLU CG C N N 176
GLU CD C N N 177
GLU OE1 O N N 178
GLU OE2 O N N 179
GLU OXT O N N 180
GLU H H N N 181
GLU H2 H N N 182
GLU HA H N N 183
GLU HB2 H N N 184
GLU HB3 H N N 185
GLU HG2 H N N 186
GLU HG3 H N N 187
GLU HE2 H N N 188
GLU HXT H N N 189
GLY N N N N 190
GLY CA C N N 191
GLY C C N N 192
GLY O O N N 193
GLY OXT O N N 194
GLY H H N N 195
GLY H2 H N N 196
GLY HA2 H N N 197
GLY HA3 H N N 198
GLY HXT H N N 199
HIS N N N N 200
HIS CA C N S 201
HIS C C N N 202
HIS O O N N 203
HIS CB C N N 204
HIS CG C Y N 205
HIS ND1 N Y N 206
HIS CD2 C Y N 207
HIS CE1 C Y N 208
HIS NE2 N Y N 209
HIS OXT O N N 210
HIS H H N N 211
HIS H2 H N N 212
HIS HA H N N 213
HIS HB2 H N N 214
HIS HB3 H N N 215
HIS HD1 H N N 216
HIS HD2 H N N 217
HIS HE1 H N N 218
HIS HE2 H N N 219
HIS HXT H N N 220
HOH O O N N 221
HOH H1 H N N 222
HOH H2 H N N 223
ILE N N N N 224
ILE CA C N S 225
ILE C C N N 226
ILE O O N N 227
ILE CB C N S 228
ILE CG1 C N N 229
ILE CG2 C N N 230
ILE CD1 C N N 231
ILE OXT O N N 232
ILE H H N N 233
ILE H2 H N N 234
ILE HA H N N 235
ILE HB H N N 236
ILE HG12 H N N 237
ILE HG13 H N N 238
ILE HG21 H N N 239
ILE HG22 H N N 240
ILE HG23 H N N 241
ILE HD11 H N N 242
ILE HD12 H N N 243
ILE HD13 H N N 244
ILE HXT H N N 245
LEU N N N N 246
LEU CA C N S 247
LEU C C N N 248
LEU O O N N 249
LEU CB C N N 250
LEU CG C N N 251
LEU CD1 C N N 252
LEU CD2 C N N 253
LEU OXT O N N 254
LEU H H N N 255
LEU H2 H N N 256
LEU HA H N N 257
LEU HB2 H N N 258
LEU HB3 H N N 259
LEU HG H N N 260
LEU HD11 H N N 261
LEU HD12 H N N 262
LEU HD13 H N N 263
LEU HD21 H N N 264
LEU HD22 H N N 265
LEU HD23 H N N 266
LEU HXT H N N 267
LYS N N N N 268
LYS CA C N S 269
LYS C C N N 270
LYS O O N N 271
LYS CB C N N 272
LYS CG C N N 273
LYS CD C N N 274
LYS CE C N N 275
LYS NZ N N N 276
LYS OXT O N N 277
LYS H H N N 278
LYS H2 H N N 279
LYS HA H N N 280
LYS HB2 H N N 281
LYS HB3 H N N 282
LYS HG2 H N N 283
LYS HG3 H N N 284
LYS HD2 H N N 285
LYS HD3 H N N 286
LYS HE2 H N N 287
LYS HE3 H N N 288
LYS HZ1 H N N 289
LYS HZ2 H N N 290
LYS HZ3 H N N 291
LYS HXT H N N 292
MET N N N N 293
MET CA C N S 294
MET C C N N 295
MET O O N N 296
MET CB C N N 297
MET CG C N N 298
MET SD S N N 299
MET CE C N N 300
MET OXT O N N 301
MET H H N N 302
MET H2 H N N 303
MET HA H N N 304
MET HB2 H N N 305
MET HB3 H N N 306
MET HG2 H N N 307
MET HG3 H N N 308
MET HE1 H N N 309
MET HE2 H N N 310
MET HE3 H N N 311
MET HXT H N N 312
PG4 O1 O N N 313
PG4 C1 C N N 314
PG4 C2 C N N 315
PG4 O2 O N N 316
PG4 C3 C N N 317
PG4 C4 C N N 318
PG4 O3 O N N 319
PG4 C5 C N N 320
PG4 C6 C N N 321
PG4 O4 O N N 322
PG4 C7 C N N 323
PG4 C8 C N N 324
PG4 O5 O N N 325
PG4 HO1 H N N 326
PG4 H11 H N N 327
PG4 H12 H N N 328
PG4 H21 H N N 329
PG4 H22 H N N 330
PG4 H31 H N N 331
PG4 H32 H N N 332
PG4 H41 H N N 333
PG4 H42 H N N 334
PG4 H51 H N N 335
PG4 H52 H N N 336
PG4 H61 H N N 337
PG4 H62 H N N 338
PG4 H71 H N N 339
PG4 H72 H N N 340
PG4 H81 H N N 341
PG4 H82 H N N 342
PG4 HO5 H N N 343
PHE N N N N 344
PHE CA C N S 345
PHE C C N N 346
PHE O O N N 347
PHE CB C N N 348
PHE CG C Y N 349
PHE CD1 C Y N 350
PHE CD2 C Y N 351
PHE CE1 C Y N 352
PHE CE2 C Y N 353
PHE CZ C Y N 354
PHE OXT O N N 355
PHE H H N N 356
PHE H2 H N N 357
PHE HA H N N 358
PHE HB2 H N N 359
PHE HB3 H N N 360
PHE HD1 H N N 361
PHE HD2 H N N 362
PHE HE1 H N N 363
PHE HE2 H N N 364
PHE HZ H N N 365
PHE HXT H N N 366
PRO N N N N 367
PRO CA C N S 368
PRO C C N N 369
PRO O O N N 370
PRO CB C N N 371
PRO CG C N N 372
PRO CD C N N 373
PRO OXT O N N 374
PRO H H N N 375
PRO HA H N N 376
PRO HB2 H N N 377
PRO HB3 H N N 378
PRO HG2 H N N 379
PRO HG3 H N N 380
PRO HD2 H N N 381
PRO HD3 H N N 382
PRO HXT H N N 383
QY1 C7 C Y N 384
QY1 C6 C Y N 385
QY1 C1 C Y N 386
QY1 C5 C Y N 387
QY1 C4 C Y N 388
QY1 C3 C Y N 389
QY1 C2 C Y N 390
QY1 C8 C Y N 391
QY1 C9 C Y N 392
QY1 C10 C Y N 393
QY1 C11 C Y N 394
QY1 C12 C Y N 395
QY1 C13 C Y N 396
QY1 C14 C Y N 397
QY1 C15 C Y N 398
QY1 C16 C N N 399
QY1 C17 C N N 400
QY1 C18 C N N 401
QY1 C19 C N N 402
QY1 C20 C N N 403
QY1 C21 C N N 404
QY1 C22 C N N 405
QY1 C23 C N R 406
QY1 N24 N Y N 407
QY1 O25 O N N 408
QY1 O26 O N N 409
QY1 O27 O N N 410
QY1 H1 H N N 411
QY1 H2 H N N 412
QY1 H3 H N N 413
QY1 H4 H N N 414
QY1 H5 H N N 415
QY1 H6 H N N 416
QY1 H7 H N N 417
QY1 H8 H N N 418
QY1 H9 H N N 419
QY1 H10 H N N 420
QY1 H11 H N N 421
QY1 H12 H N N 422
QY1 H13 H N N 423
QY1 H14 H N N 424
QY1 H15 H N N 425
QY1 H16 H N N 426
QY1 H17 H N N 427
QY1 H18 H N N 428
QY1 H19 H N N 429
QY1 H20 H N N 430
QY1 H21 H N N 431
QY1 H22 H N N 432
QY1 H23 H N N 433
SER N N N N 434
SER CA C N S 435
SER C C N N 436
SER O O N N 437
SER CB C N N 438
SER OG O N N 439
SER OXT O N N 440
SER H H N N 441
SER H2 H N N 442
SER HA H N N 443
SER HB2 H N N 444
SER HB3 H N N 445
SER HG H N N 446
SER HXT H N N 447
THR N N N N 448
THR CA C N S 449
THR C C N N 450
THR O O N N 451
THR CB C N R 452
THR OG1 O N N 453
THR CG2 C N N 454
THR OXT O N N 455
THR H H N N 456
THR H2 H N N 457
THR HA H N N 458
THR HB H N N 459
THR HG1 H N N 460
THR HG21 H N N 461
THR HG22 H N N 462
THR HG23 H N N 463
THR HXT H N N 464
TRP N N N N 465
TRP CA C N S 466
TRP C C N N 467
TRP O O N N 468
TRP CB C N N 469
TRP CG C Y N 470
TRP CD1 C Y N 471
TRP CD2 C Y N 472
TRP NE1 N Y N 473
TRP CE2 C Y N 474
TRP CE3 C Y N 475
TRP CZ2 C Y N 476
TRP CZ3 C Y N 477
TRP CH2 C Y N 478
TRP OXT O N N 479
TRP H H N N 480
TRP H2 H N N 481
TRP HA H N N 482
TRP HB2 H N N 483
TRP HB3 H N N 484
TRP HD1 H N N 485
TRP HE1 H N N 486
TRP HE3 H N N 487
TRP HZ2 H N N 488
TRP HZ3 H N N 489
TRP HH2 H N N 490
TRP HXT H N N 491
TYR N N N N 492
TYR CA C N S 493
TYR C C N N 494
TYR O O N N 495
TYR CB C N N 496
TYR CG C Y N 497
TYR CD1 C Y N 498
TYR CD2 C Y N 499
TYR CE1 C Y N 500
TYR CE2 C Y N 501
TYR CZ C Y N 502
TYR OH O N N 503
TYR OXT O N N 504
TYR H H N N 505
TYR H2 H N N 506
TYR HA H N N 507
TYR HB2 H N N 508
TYR HB3 H N N 509
TYR HD1 H N N 510
TYR HD2 H N N 511
TYR HE1 H N N 512
TYR HE2 H N N 513
TYR HH H N N 514
TYR HXT H N N 515
VAL N N N N 516
VAL CA C N S 517
VAL C C N N 518
VAL O O N N 519
VAL CB C N N 520
VAL CG1 C N N 521
VAL CG2 C N N 522
VAL OXT O N N 523
VAL H H N N 524
VAL H2 H N N 525
VAL HA H N N 526
VAL HB H N N 527
VAL HG11 H N N 528
VAL HG12 H N N 529
VAL HG13 H N N 530
VAL HG21 H N N 531
VAL HG22 H N N 532
VAL HG23 H N N 533
VAL HXT H N N 534
#
loop_
_chem_comp_bond.comp_id
_chem_comp_bond.atom_id_1
_chem_comp_bond.atom_id_2
_chem_comp_bond.value_order
_chem_comp_bond.pdbx_aromatic_flag
_chem_comp_bond.pdbx_stereo_config
_chem_comp_bond.pdbx_ordinal
ALA N CA sing N N 1
ALA N H sing N N 2
ALA N H2 sing N N 3
ALA CA C sing N N 4
ALA CA CB sing N N 5
ALA CA HA sing N N 6
ALA C O doub N N 7
ALA C OXT sing N N 8
ALA CB HB1 sing N N 9
ALA CB HB2 sing N N 10
ALA CB HB3 sing N N 11
ALA OXT HXT sing N N 12
ARG N CA sing N N 13
ARG N H sing N N 14
ARG N H2 sing N N 15
ARG CA C sing N N 16
ARG CA CB sing N N 17
ARG CA HA sing N N 18
ARG C O doub N N 19
ARG C OXT sing N N 20
ARG CB CG sing N N 21
ARG CB HB2 sing N N 22
ARG CB HB3 sing N N 23
ARG CG CD sing N N 24
ARG CG HG2 sing N N 25
ARG CG HG3 sing N N 26
ARG CD NE sing N N 27
ARG CD HD2 sing N N 28
ARG CD HD3 sing N N 29
ARG NE CZ sing N N 30
ARG NE HE sing N N 31
ARG CZ NH1 sing N N 32
ARG CZ NH2 doub N N 33
ARG NH1 HH11 sing N N 34
ARG NH1 HH12 sing N N 35
ARG NH2 HH21 sing N N 36
ARG NH2 HH22 sing N N 37
ARG OXT HXT sing N N 38
ASN N CA sing N N 39
ASN N H sing N N 40
ASN N H2 sing N N 41
ASN CA C sing N N 42
ASN CA CB sing N N 43
ASN CA HA sing N N 44
ASN C O doub N N 45
ASN C OXT sing N N 46
ASN CB CG sing N N 47
ASN CB HB2 sing N N 48
ASN CB HB3 sing N N 49
ASN CG OD1 doub N N 50
ASN CG ND2 sing N N 51
ASN ND2 HD21 sing N N 52
ASN ND2 HD22 sing N N 53
ASN OXT HXT sing N N 54
ASP N CA sing N N 55
ASP N H sing N N 56
ASP N H2 sing N N 57
ASP CA C sing N N 58
ASP CA CB sing N N 59
ASP CA HA sing N N 60
ASP C O doub N N 61
ASP C OXT sing N N 62
ASP CB CG sing N N 63
ASP CB HB2 sing N N 64
ASP CB HB3 sing N N 65
ASP CG OD1 doub N N 66
ASP CG OD2 sing N N 67
ASP OD2 HD2 sing N N 68
ASP OXT HXT sing N N 69
BOG C1 O1 sing N N 70
BOG C1 C2 sing N N 71
BOG C1 O5 sing N N 72
BOG C1 H1 sing N N 73
BOG O1 "C1'" sing N N 74
BOG C2 O2 sing N N 75
BOG C2 C3 sing N N 76
BOG C2 H2 sing N N 77
BOG O2 HO2 sing N N 78
BOG C3 O3 sing N N 79
BOG C3 C4 sing N N 80
BOG C3 H3 sing N N 81
BOG O3 HO3 sing N N 82
BOG C4 O4 sing N N 83
BOG C4 C5 sing N N 84
BOG C4 H4 sing N N 85
BOG O4 HO4 sing N N 86
BOG C5 O5 sing N N 87
BOG C5 C6 sing N N 88
BOG C5 H5 sing N N 89
BOG C6 O6 sing N N 90
BOG C6 H61 sing N N 91
BOG C6 H62 sing N N 92
BOG O6 HO6 sing N N 93
BOG "C1'" "C2'" sing N N 94
BOG "C1'" "H1'1" sing N N 95
BOG "C1'" "H1'2" sing N N 96
BOG "C2'" "C3'" sing N N 97
BOG "C2'" "H2'1" sing N N 98
BOG "C2'" "H2'2" sing N N 99
BOG "C3'" "C4'" sing N N 100
BOG "C3'" "H3'1" sing N N 101
BOG "C3'" "H3'2" sing N N 102
BOG "C4'" "C5'" sing N N 103
BOG "C4'" "H4'1" sing N N 104
BOG "C4'" "H4'2" sing N N 105
BOG "C5'" "C6'" sing N N 106
BOG "C5'" "H5'1" sing N N 107
BOG "C5'" "H5'2" sing N N 108
BOG "C6'" "C7'" sing N N 109
BOG "C6'" "H6'1" sing N N 110
BOG "C6'" "H6'2" sing N N 111
BOG "C7'" "C8'" sing N N 112
BOG "C7'" "H7'1" sing N N 113
BOG "C7'" "H7'2" sing N N 114
BOG "C8'" "H8'1" sing N N 115
BOG "C8'" "H8'2" sing N N 116
BOG "C8'" "H8'3" sing N N 117
CSO N CA sing N N 118
CSO N H sing N N 119
CSO N H2 sing N N 120
CSO CA CB sing N N 121
CSO CA C sing N N 122
CSO CA HA sing N N 123
CSO CB SG sing N N 124
CSO CB HB2 sing N N 125
CSO CB HB3 sing N N 126
CSO SG OD sing N N 127
CSO C O doub N N 128
CSO C OXT sing N N 129
CSO OXT HXT sing N N 130
CSO OD HD sing N N 131
CYS N CA sing N N 132
CYS N H sing N N 133
CYS N H2 sing N N 134
CYS CA C sing N N 135
CYS CA CB sing N N 136
CYS CA HA sing N N 137
CYS C O doub N N 138
CYS C OXT sing N N 139
CYS CB SG sing N N 140
CYS CB HB2 sing N N 141
CYS CB HB3 sing N N 142
CYS SG HG sing N N 143
CYS OXT HXT sing N N 144
GLN N CA sing N N 145
GLN N H sing N N 146
GLN N H2 sing N N 147
GLN CA C sing N N 148
GLN CA CB sing N N 149
GLN CA HA sing N N 150
GLN C O doub N N 151
GLN C OXT sing N N 152
GLN CB CG sing N N 153
GLN CB HB2 sing N N 154
GLN CB HB3 sing N N 155
GLN CG CD sing N N 156
GLN CG HG2 sing N N 157
GLN CG HG3 sing N N 158
GLN CD OE1 doub N N 159
GLN CD NE2 sing N N 160
GLN NE2 HE21 sing N N 161
GLN NE2 HE22 sing N N 162
GLN OXT HXT sing N N 163
GLU N CA sing N N 164
GLU N H sing N N 165
GLU N H2 sing N N 166
GLU CA C sing N N 167
GLU CA CB sing N N 168
GLU CA HA sing N N 169
GLU C O doub N N 170
GLU C OXT sing N N 171
GLU CB CG sing N N 172
GLU CB HB2 sing N N 173
GLU CB HB3 sing N N 174
GLU CG CD sing N N 175
GLU CG HG2 sing N N 176
GLU CG HG3 sing N N 177
GLU CD OE1 doub N N 178
GLU CD OE2 sing N N 179
GLU OE2 HE2 sing N N 180
GLU OXT HXT sing N N 181
GLY N CA sing N N 182
GLY N H sing N N 183
GLY N H2 sing N N 184
GLY CA C sing N N 185
GLY CA HA2 sing N N 186
GLY CA HA3 sing N N 187
GLY C O doub N N 188
GLY C OXT sing N N 189
GLY OXT HXT sing N N 190
HIS N CA sing N N 191
HIS N H sing N N 192
HIS N H2 sing N N 193
HIS CA C sing N N 194
HIS CA CB sing N N 195
HIS CA HA sing N N 196
HIS C O doub N N 197
HIS C OXT sing N N 198
HIS CB CG sing N N 199
HIS CB HB2 sing N N 200
HIS CB HB3 sing N N 201
HIS CG ND1 sing Y N 202
HIS CG CD2 doub Y N 203
HIS ND1 CE1 doub Y N 204
HIS ND1 HD1 sing N N 205
HIS CD2 NE2 sing Y N 206
HIS CD2 HD2 sing N N 207
HIS CE1 NE2 sing Y N 208
HIS CE1 HE1 sing N N 209
HIS NE2 HE2 sing N N 210
HIS OXT HXT sing N N 211
HOH O H1 sing N N 212
HOH O H2 sing N N 213
ILE N CA sing N N 214
ILE N H sing N N 215
ILE N H2 sing N N 216
ILE CA C sing N N 217
ILE CA CB sing N N 218
ILE CA HA sing N N 219
ILE C O doub N N 220
ILE C OXT sing N N 221
ILE CB CG1 sing N N 222
ILE CB CG2 sing N N 223
ILE CB HB sing N N 224
ILE CG1 CD1 sing N N 225
ILE CG1 HG12 sing N N 226
ILE CG1 HG13 sing N N 227
ILE CG2 HG21 sing N N 228
ILE CG2 HG22 sing N N 229
ILE CG2 HG23 sing N N 230
ILE CD1 HD11 sing N N 231
ILE CD1 HD12 sing N N 232
ILE CD1 HD13 sing N N 233
ILE OXT HXT sing N N 234
LEU N CA sing N N 235
LEU N H sing N N 236
LEU N H2 sing N N 237
LEU CA C sing N N 238
LEU CA CB sing N N 239
LEU CA HA sing N N 240
LEU C O doub N N 241
LEU C OXT sing N N 242
LEU CB CG sing N N 243
LEU CB HB2 sing N N 244
LEU CB HB3 sing N N 245
LEU CG CD1 sing N N 246
LEU CG CD2 sing N N 247
LEU CG HG sing N N 248
LEU CD1 HD11 sing N N 249
LEU CD1 HD12 sing N N 250
LEU CD1 HD13 sing N N 251
LEU CD2 HD21 sing N N 252
LEU CD2 HD22 sing N N 253
LEU CD2 HD23 sing N N 254
LEU OXT HXT sing N N 255
LYS N CA sing N N 256
LYS N H sing N N 257
LYS N H2 sing N N 258
LYS CA C sing N N 259
LYS CA CB sing N N 260
LYS CA HA sing N N 261
LYS C O doub N N 262
LYS C OXT sing N N 263
LYS CB CG sing N N 264
LYS CB HB2 sing N N 265
LYS CB HB3 sing N N 266
LYS CG CD sing N N 267
LYS CG HG2 sing N N 268
LYS CG HG3 sing N N 269
LYS CD CE sing N N 270
LYS CD HD2 sing N N 271
LYS CD HD3 sing N N 272
LYS CE NZ sing N N 273
LYS CE HE2 sing N N 274
LYS CE HE3 sing N N 275
LYS NZ HZ1 sing N N 276
LYS NZ HZ2 sing N N 277
LYS NZ HZ3 sing N N 278
LYS OXT HXT sing N N 279
MET N CA sing N N 280
MET N H sing N N 281
MET N H2 sing N N 282
MET CA C sing N N 283
MET CA CB sing N N 284
MET CA HA sing N N 285
MET C O doub N N 286
MET C OXT sing N N 287
MET CB CG sing N N 288
MET CB HB2 sing N N 289
MET CB HB3 sing N N 290
MET CG SD sing N N 291
MET CG HG2 sing N N 292
MET CG HG3 sing N N 293
MET SD CE sing N N 294
MET CE HE1 sing N N 295
MET CE HE2 sing N N 296
MET CE HE3 sing N N 297
MET OXT HXT sing N N 298
PG4 O1 C1 sing N N 299
PG4 O1 HO1 sing N N 300
PG4 C1 C2 sing N N 301
PG4 C1 H11 sing N N 302
PG4 C1 H12 sing N N 303
PG4 C2 O2 sing N N 304
PG4 C2 H21 sing N N 305
PG4 C2 H22 sing N N 306
PG4 O2 C3 sing N N 307
PG4 C3 C4 sing N N 308
PG4 C3 H31 sing N N 309
PG4 C3 H32 sing N N 310
PG4 C4 O3 sing N N 311
PG4 C4 H41 sing N N 312
PG4 C4 H42 sing N N 313
PG4 O3 C5 sing N N 314
PG4 C5 C6 sing N N 315
PG4 C5 H51 sing N N 316
PG4 C5 H52 sing N N 317
PG4 C6 O4 sing N N 318
PG4 C6 H61 sing N N 319
PG4 C6 H62 sing N N 320
PG4 O4 C7 sing N N 321
PG4 C7 C8 sing N N 322
PG4 C7 H71 sing N N 323
PG4 C7 H72 sing N N 324
PG4 C8 O5 sing N N 325
PG4 C8 H81 sing N N 326
PG4 C8 H82 sing N N 327
PG4 O5 HO5 sing N N 328
PHE N CA sing N N 329
PHE N H sing N N 330
PHE N H2 sing N N 331
PHE CA C sing N N 332
PHE CA CB sing N N 333
PHE CA HA sing N N 334
PHE C O doub N N 335
PHE C OXT sing N N 336
PHE CB CG sing N N 337
PHE CB HB2 sing N N 338
PHE CB HB3 sing N N 339
PHE CG CD1 doub Y N 340
PHE CG CD2 sing Y N 341
PHE CD1 CE1 sing Y N 342
PHE CD1 HD1 sing N N 343
PHE CD2 CE2 doub Y N 344
PHE CD2 HD2 sing N N 345
PHE CE1 CZ doub Y N 346
PHE CE1 HE1 sing N N 347
PHE CE2 CZ sing Y N 348
PHE CE2 HE2 sing N N 349
PHE CZ HZ sing N N 350
PHE OXT HXT sing N N 351
PRO N CA sing N N 352
PRO N CD sing N N 353
PRO N H sing N N 354
PRO CA C sing N N 355
PRO CA CB sing N N 356
PRO CA HA sing N N 357
PRO C O doub N N 358
PRO C OXT sing N N 359
PRO CB CG sing N N 360
PRO CB HB2 sing N N 361
PRO CB HB3 sing N N 362
PRO CG CD sing N N 363
PRO CG HG2 sing N N 364
PRO CG HG3 sing N N 365
PRO CD HD2 sing N N 366
PRO CD HD3 sing N N 367
PRO OXT HXT sing N N 368
QY1 C18 C20 sing N N 369
QY1 C18 C17 sing N N 370
QY1 C8 C5 doub Y N 371
QY1 C8 C14 sing Y N 372
QY1 C20 C21 sing N N 373
QY1 C5 C12 sing Y N 374
QY1 O27 C14 sing N N 375
QY1 O27 C22 sing N N 376
QY1 C10 C4 doub Y N 377
QY1 C10 C15 sing Y N 378
QY1 C4 C11 sing Y N 379
QY1 C14 C9 doub Y N 380
QY1 C17 C19 sing N N 381
QY1 C12 C23 sing N N 382
QY1 C12 C6 doub Y N 383
QY1 C21 C23 sing N N 384
QY1 C21 C19 sing N N 385
QY1 C22 C15 sing N N 386
QY1 C15 N24 doub Y N 387
QY1 C23 C16 sing N N 388
QY1 C11 C3 doub Y N 389
QY1 C11 C13 sing Y N 390
QY1 C9 C6 sing Y N 391
QY1 C3 C1 sing Y N 392
QY1 N24 C13 sing Y N 393
QY1 C13 C7 doub Y N 394
QY1 C16 O25 doub N N 395
QY1 C16 O26 sing N N 396
QY1 C1 C2 doub Y N 397
QY1 C7 C2 sing Y N 398
QY1 C7 H1 sing N N 399
QY1 C6 H2 sing N N 400
QY1 C1 H3 sing N N 401
QY1 C5 H4 sing N N 402
QY1 C4 H5 sing N N 403
QY1 C3 H6 sing N N 404
QY1 C2 H7 sing N N 405
QY1 C8 H8 sing N N 406
QY1 C9 H9 sing N N 407
QY1 C10 H10 sing N N 408
QY1 C17 H11 sing N N 409
QY1 C17 H12 sing N N 410
QY1 C18 H13 sing N N 411
QY1 C18 H14 sing N N 412
QY1 C19 H15 sing N N 413
QY1 C19 H16 sing N N 414
QY1 C20 H17 sing N N 415
QY1 C20 H18 sing N N 416
QY1 C21 H19 sing N N 417
QY1 C22 H20 sing N N 418
QY1 C22 H21 sing N N 419
QY1 C23 H22 sing N N 420
QY1 O26 H23 sing N N 421
SER N CA sing N N 422
SER N H sing N N 423
SER N H2 sing N N 424
SER CA C sing N N 425
SER CA CB sing N N 426
SER CA HA sing N N 427
SER C O doub N N 428
SER C OXT sing N N 429
SER CB OG sing N N 430
SER CB HB2 sing N N 431
SER CB HB3 sing N N 432
SER OG HG sing N N 433
SER OXT HXT sing N N 434
THR N CA sing N N 435
THR N H sing N N 436
THR N H2 sing N N 437
THR CA C sing N N 438
THR CA CB sing N N 439
THR CA HA sing N N 440
THR C O doub N N 441
THR C OXT sing N N 442
THR CB OG1 sing N N 443
THR CB CG2 sing N N 444
THR CB HB sing N N 445
THR OG1 HG1 sing N N 446
THR CG2 HG21 sing N N 447
THR CG2 HG22 sing N N 448
THR CG2 HG23 sing N N 449
THR OXT HXT sing N N 450
TRP N CA sing N N 451
TRP N H sing N N 452
TRP N H2 sing N N 453
TRP CA C sing N N 454
TRP CA CB sing N N 455
TRP CA HA sing N N 456
TRP C O doub N N 457
TRP C OXT sing N N 458
TRP CB CG sing N N 459
TRP CB HB2 sing N N 460
TRP CB HB3 sing N N 461
TRP CG CD1 doub Y N 462
TRP CG CD2 sing Y N 463
TRP CD1 NE1 sing Y N 464
TRP CD1 HD1 sing N N 465
TRP CD2 CE2 doub Y N 466
TRP CD2 CE3 sing Y N 467
TRP NE1 CE2 sing Y N 468
TRP NE1 HE1 sing N N 469
TRP CE2 CZ2 sing Y N 470
TRP CE3 CZ3 doub Y N 471
TRP CE3 HE3 sing N N 472
TRP CZ2 CH2 doub Y N 473
TRP CZ2 HZ2 sing N N 474
TRP CZ3 CH2 sing Y N 475
TRP CZ3 HZ3 sing N N 476
TRP CH2 HH2 sing N N 477
TRP OXT HXT sing N N 478
TYR N CA sing N N 479
TYR N H sing N N 480
TYR N H2 sing N N 481
TYR CA C sing N N 482
TYR CA CB sing N N 483
TYR CA HA sing N N 484
TYR C O doub N N 485
TYR C OXT sing N N 486
TYR CB CG sing N N 487
TYR CB HB2 sing N N 488
TYR CB HB3 sing N N 489
TYR CG CD1 doub Y N 490
TYR CG CD2 sing Y N 491
TYR CD1 CE1 sing Y N 492
TYR CD1 HD1 sing N N 493
TYR CD2 CE2 doub Y N 494
TYR CD2 HD2 sing N N 495
TYR CE1 CZ doub Y N 496
TYR CE1 HE1 sing N N 497
TYR CE2 CZ sing Y N 498
TYR CE2 HE2 sing N N 499
TYR CZ OH sing N N 500
TYR OH HH sing N N 501
TYR OXT HXT sing N N 502
VAL N CA sing N N 503
VAL N H sing N N 504
VAL N H2 sing N N 505
VAL CA C sing N N 506
VAL CA CB sing N N 507
VAL CA HA sing N N 508
VAL C O doub N N 509
VAL C OXT sing N N 510
VAL CB CG1 sing N N 511
VAL CB CG2 sing N N 512
VAL CB HB sing N N 513
VAL CG1 HG11 sing N N 514
VAL CG1 HG12 sing N N 515
VAL CG1 HG13 sing N N 516
VAL CG2 HG21 sing N N 517
VAL CG2 HG22 sing N N 518
VAL CG2 HG23 sing N N 519
VAL OXT HXT sing N N 520
#
_pdbx_initial_refinement_model.accession_code 2Q7M
_pdbx_initial_refinement_model.details ?
_pdbx_initial_refinement_model.entity_id_list ?
_pdbx_initial_refinement_model.id 1
_pdbx_initial_refinement_model.source_name PDB
_pdbx_initial_refinement_model.type 'experimental model'
#
loop_
_pdbx_reflns_twin.domain_id
_pdbx_reflns_twin.crystal_id
_pdbx_reflns_twin.diffrn_id
_pdbx_reflns_twin.fraction
_pdbx_reflns_twin.operator
_pdbx_reflns_twin.type
_pdbx_reflns_twin.mean_F_square_over_mean_F2
_pdbx_reflns_twin.mean_I2_over_mean_I_square
1 1 1 0.439 'H, K, L' ? ? ?
2 1 1 0.561 'K, H, -L' ? ? ?
#
_atom_sites.entry_id 6VL4
_atom_sites.Cartn_transf_matrix[1][1] ?
_atom_sites.Cartn_transf_matrix[1][2] ?
_atom_sites.Cartn_transf_matrix[1][3] ?
_atom_sites.Cartn_transf_matrix[2][1] ?
_atom_sites.Cartn_transf_matrix[2][2] ?
_atom_sites.Cartn_transf_matrix[2][3] ?
_atom_sites.Cartn_transf_matrix[3][1] ?
_atom_sites.Cartn_transf_matrix[3][2] ?
_atom_sites.Cartn_transf_matrix[3][3] ?
_atom_sites.Cartn_transf_vector[1] ?
_atom_sites.Cartn_transf_vector[2] ?
_atom_sites.Cartn_transf_vector[3] ?
_atom_sites.fract_transf_matrix[1][1] 0.013086
_atom_sites.fract_transf_matrix[1][2] 0.007555
_atom_sites.fract_transf_matrix[1][3] 0.000000
_atom_sites.fract_transf_matrix[2][1] -0.000000
_atom_sites.fract_transf_matrix[2][2] 0.015111
_atom_sites.fract_transf_matrix[2][3] 0.000000
_atom_sites.fract_transf_matrix[3][1] 0.000000
_atom_sites.fract_transf_matrix[3][2] -0.000000
_atom_sites.fract_transf_matrix[3][3] 0.008079
_atom_sites.fract_transf_vector[1] 0.000000
_atom_sites.fract_transf_vector[2] 0.000000
_atom_sites.fract_transf_vector[3] 0.000000
_atom_sites.solution_primary ?
_atom_sites.solution_secondary ?
_atom_sites.solution_hydrogens ?
_atom_sites.special_details ?
#
loop_
_atom_type.symbol
C
N
O
S
#
loop_