data_6VO4 # _entry.id 6VO4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6VO4 pdb_00006vo4 10.2210/pdb6vo4/pdb WWPDB D_1000246708 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6VO4 _pdbx_database_status.recvd_initial_deposition_date 2020-01-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Seo, H.-S.' 1 ? 'Dhe-Paganon, S.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Cell Chem Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2451-9456 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 27 _citation.language ? _citation.page_first 647 _citation.page_last ? _citation.title 'Identification of a Covalent Molecular Inhibitor of Anti-apoptotic BFL-1 by Disulfide Tethering.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.chembiol.2020.04.004 _citation.pdbx_database_id_PubMed 32413285 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Harvey, E.P.' 1 ? primary 'Hauseman, Z.J.' 2 ? primary 'Cohen, D.T.' 3 ? primary 'Rettenmaier, T.J.' 4 ? primary 'Lee, S.' 5 ? primary 'Huhn, A.J.' 6 ? primary 'Wales, T.E.' 7 ? primary 'Seo, H.S.' 8 ? primary 'Luccarelli, J.' 9 ? primary 'Newman, C.E.' 10 ? primary 'Guerra, R.M.' 11 ? primary 'Bird, G.H.' 12 ? primary 'Dhe-Paganon, S.' 13 ? primary 'Engen, J.R.' 14 ? primary 'Wells, J.A.' 15 ? primary 'Walensky, L.D.' 16 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 104.900 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6VO4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 39.550 _cell.length_a_esd ? _cell.length_b 43.240 _cell.length_b_esd ? _cell.length_c 43.490 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6VO4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bcl-2-related protein A1' 18596.062 1 ? ? ? ? 2 water nat water 18.015 20 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Bcl-2-like protein 5,Bcl2-L-5,Hemopoietic-specific early response protein,Protein BFL-1,Protein GRS' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHSHMTDSEFGYIYRLAQDYLQSVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTL FNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP K ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHSHMTDSEFGYIYRLAQDYLQSVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTL FNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP K ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 SER n 1 10 HIS n 1 11 MET n 1 12 THR n 1 13 ASP n 1 14 SER n 1 15 GLU n 1 16 PHE n 1 17 GLY n 1 18 TYR n 1 19 ILE n 1 20 TYR n 1 21 ARG n 1 22 LEU n 1 23 ALA n 1 24 GLN n 1 25 ASP n 1 26 TYR n 1 27 LEU n 1 28 GLN n 1 29 SER n 1 30 VAL n 1 31 LEU n 1 32 GLN n 1 33 ILE n 1 34 PRO n 1 35 GLN n 1 36 PRO n 1 37 GLY n 1 38 SER n 1 39 GLY n 1 40 PRO n 1 41 SER n 1 42 LYS n 1 43 THR n 1 44 SER n 1 45 ARG n 1 46 VAL n 1 47 LEU n 1 48 GLN n 1 49 ASN n 1 50 VAL n 1 51 ALA n 1 52 PHE n 1 53 SER n 1 54 VAL n 1 55 GLN n 1 56 LYS n 1 57 GLU n 1 58 VAL n 1 59 GLU n 1 60 LYS n 1 61 ASN n 1 62 LEU n 1 63 LYS n 1 64 SER n 1 65 CYS n 1 66 LEU n 1 67 ASP n 1 68 ASN n 1 69 VAL n 1 70 ASN n 1 71 VAL n 1 72 VAL n 1 73 SER n 1 74 VAL n 1 75 ASP n 1 76 THR n 1 77 ALA n 1 78 ARG n 1 79 THR n 1 80 LEU n 1 81 PHE n 1 82 ASN n 1 83 GLN n 1 84 VAL n 1 85 MET n 1 86 GLU n 1 87 LYS n 1 88 GLU n 1 89 PHE n 1 90 GLU n 1 91 ASP n 1 92 GLY n 1 93 ILE n 1 94 ILE n 1 95 ASN n 1 96 TRP n 1 97 GLY n 1 98 ARG n 1 99 ILE n 1 100 VAL n 1 101 THR n 1 102 ILE n 1 103 PHE n 1 104 ALA n 1 105 PHE n 1 106 GLU n 1 107 GLY n 1 108 ILE n 1 109 LEU n 1 110 ILE n 1 111 LYS n 1 112 LYS n 1 113 LEU n 1 114 LEU n 1 115 ARG n 1 116 GLN n 1 117 GLN n 1 118 ILE n 1 119 ALA n 1 120 PRO n 1 121 ASP n 1 122 VAL n 1 123 ASP n 1 124 THR n 1 125 TYR n 1 126 LYS n 1 127 GLU n 1 128 ILE n 1 129 SER n 1 130 TYR n 1 131 PHE n 1 132 VAL n 1 133 ALA n 1 134 GLU n 1 135 PHE n 1 136 ILE n 1 137 MET n 1 138 ASN n 1 139 ASN n 1 140 THR n 1 141 GLY n 1 142 GLU n 1 143 TRP n 1 144 ILE n 1 145 ARG n 1 146 GLN n 1 147 ASN n 1 148 GLY n 1 149 GLY n 1 150 TRP n 1 151 GLU n 1 152 ASN n 1 153 GLY n 1 154 PHE n 1 155 VAL n 1 156 LYS n 1 157 LYS n 1 158 PHE n 1 159 GLU n 1 160 PRO n 1 161 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 161 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BCL2A1, BCL2L5, BFL1, GRS, HBPA1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B2LA1_HUMAN _struct_ref.pdbx_db_accession Q16548 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFE DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6VO4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 11 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 161 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q16548 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 151 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 151 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6VO4 MET A 1 ? UNP Q16548 ? ? 'initiating methionine' -9 1 1 6VO4 GLY A 2 ? UNP Q16548 ? ? 'expression tag' -8 2 1 6VO4 HIS A 3 ? UNP Q16548 ? ? 'expression tag' -7 3 1 6VO4 HIS A 4 ? UNP Q16548 ? ? 'expression tag' -6 4 1 6VO4 HIS A 5 ? UNP Q16548 ? ? 'expression tag' -5 5 1 6VO4 HIS A 6 ? UNP Q16548 ? ? 'expression tag' -4 6 1 6VO4 HIS A 7 ? UNP Q16548 ? ? 'expression tag' -3 7 1 6VO4 HIS A 8 ? UNP Q16548 ? ? 'expression tag' -2 8 1 6VO4 SER A 9 ? UNP Q16548 ? ? 'expression tag' -1 9 1 6VO4 HIS A 10 ? UNP Q16548 ? ? 'expression tag' 0 10 1 6VO4 SER A 14 ? UNP Q16548 CYS 4 'engineered mutation' 4 11 1 6VO4 SER A 29 ? UNP Q16548 CYS 19 'engineered mutation' 19 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6VO4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.93 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 36.35 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '3.5M Sodium formate, pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-11-16 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 36.743 _reflns.entry_id 6VO4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.740 _reflns.d_resolution_low 38.220 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13579 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 92.300 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.200 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.063 _reflns.pdbx_Rpim_I_all 0.035 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 43051 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.740 1.770 ? 0.700 2190 ? ? ? 653 92.900 ? ? ? ? ? ? ? ? ? ? ? ? ? 3.400 ? ? ? ? 1.990 1.068 ? 1 1 ? ? ? 4.720 38.230 ? 30.700 2090 ? ? ? 668 87.300 ? ? ? ? ? ? ? ? ? ? ? ? ? 3.100 ? ? ? ? 0.042 0.024 ? 2 1 ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 119.550 _refine.B_iso_mean 60.0618 _refine.B_iso_min 30.870 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6VO4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.7400 _refine.ls_d_res_low 38.2200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13520 _refine.ls_number_reflns_R_free 686 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 91.9200 _refine.ls_percent_reflns_R_free 5.0700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2409 _refine.ls_R_factor_R_free 0.2831 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2386 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5WHH _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 43.2700 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.7400 _refine_hist.d_res_low 38.2200 _refine_hist.number_atoms_solvent 20 _refine_hist.number_atoms_total 1089 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 138 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 58.45 _refine_hist.pdbx_number_atoms_protein 1069 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.7400 1.8700 2654 . 133 2521 91.0000 . . . 0.5086 0.0000 0.4267 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 1.8700 2.0600 2752 . 116 2636 95.0000 . . . 0.3324 0.0000 0.3126 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.0600 2.3600 2777 . 150 2627 95.0000 . . . 0.3182 0.0000 0.2508 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.3600 2.9700 2684 . 145 2539 92.0000 . . . 0.3256 0.0000 0.2782 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.9800 38.2200 2653 . 142 2511 88.0000 . . . 0.2453 0.0000 0.2044 . . . . . . . 5 . . . # _struct.entry_id 6VO4 _struct.title 'Crystal Structure Analysis of BFL1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6VO4 _struct_keywords.text 'BFL-1/A1, BCL-2 family, apoptosis, disulfide tethering, small molecule, inhibitor' _struct_keywords.pdbx_keywords APOPTOSIS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 14 ? LEU A 31 ? SER A 4 LEU A 21 1 ? 18 HELX_P HELX_P2 AA2 SER A 41 ? LEU A 62 ? SER A 31 LEU A 52 1 ? 22 HELX_P HELX_P3 AA3 SER A 73 ? PHE A 89 ? SER A 63 PHE A 79 1 ? 17 HELX_P HELX_P4 AA4 ASN A 95 ? GLN A 117 ? ASN A 85 GLN A 107 1 ? 23 HELX_P HELX_P5 AA5 TYR A 125 ? ASN A 147 ? TYR A 115 ASN A 137 1 ? 23 HELX_P HELX_P6 AA6 GLY A 148 ? GLY A 153 ? GLY A 138 GLY A 143 1 ? 6 HELX_P HELX_P7 AA7 GLY A 153 ? GLU A 159 ? GLY A 143 GLU A 149 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 6VO4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.025284 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.006728 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023127 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023794 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -9 ? ? ? A . n A 1 2 GLY 2 -8 ? ? ? A . n A 1 3 HIS 3 -7 ? ? ? A . n A 1 4 HIS 4 -6 ? ? ? A . n A 1 5 HIS 5 -5 ? ? ? A . n A 1 6 HIS 6 -4 ? ? ? A . n A 1 7 HIS 7 -3 ? ? ? A . n A 1 8 HIS 8 -2 ? ? ? A . n A 1 9 SER 9 -1 ? ? ? A . n A 1 10 HIS 10 0 ? ? ? A . n A 1 11 MET 11 1 ? ? ? A . n A 1 12 THR 12 2 ? ? ? A . n A 1 13 ASP 13 3 ? ? ? A . n A 1 14 SER 14 4 4 SER SER A . n A 1 15 GLU 15 5 5 GLU GLU A . n A 1 16 PHE 16 6 6 PHE PHE A . n A 1 17 GLY 17 7 7 GLY GLY A . n A 1 18 TYR 18 8 8 TYR TYR A . n A 1 19 ILE 19 9 9 ILE ILE A . n A 1 20 TYR 20 10 10 TYR TYR A . n A 1 21 ARG 21 11 11 ARG ARG A . n A 1 22 LEU 22 12 12 LEU LEU A . n A 1 23 ALA 23 13 13 ALA ALA A . n A 1 24 GLN 24 14 14 GLN GLN A . n A 1 25 ASP 25 15 15 ASP ASP A . n A 1 26 TYR 26 16 16 TYR TYR A . n A 1 27 LEU 27 17 17 LEU LEU A . n A 1 28 GLN 28 18 18 GLN GLN A . n A 1 29 SER 29 19 19 SER SER A . n A 1 30 VAL 30 20 20 VAL VAL A . n A 1 31 LEU 31 21 21 LEU LEU A . n A 1 32 GLN 32 22 22 GLN GLN A . n A 1 33 ILE 33 23 23 ILE ILE A . n A 1 34 PRO 34 24 24 PRO PRO A . n A 1 35 GLN 35 25 ? ? ? A . n A 1 36 PRO 36 26 ? ? ? A . n A 1 37 GLY 37 27 ? ? ? A . n A 1 38 SER 38 28 28 SER GLY A . n A 1 39 GLY 39 29 29 GLY GLY A . n A 1 40 PRO 40 30 30 PRO PRO A . n A 1 41 SER 41 31 31 SER SER A . n A 1 42 LYS 42 32 32 LYS LYS A . n A 1 43 THR 43 33 33 THR THR A . n A 1 44 SER 44 34 34 SER SER A . n A 1 45 ARG 45 35 35 ARG ARG A . n A 1 46 VAL 46 36 36 VAL VAL A . n A 1 47 LEU 47 37 37 LEU LEU A . n A 1 48 GLN 48 38 38 GLN GLN A . n A 1 49 ASN 49 39 39 ASN ASN A . n A 1 50 VAL 50 40 40 VAL VAL A . n A 1 51 ALA 51 41 41 ALA ALA A . n A 1 52 PHE 52 42 42 PHE PHE A . n A 1 53 SER 53 43 43 SER SER A . n A 1 54 VAL 54 44 44 VAL VAL A . n A 1 55 GLN 55 45 45 GLN GLN A . n A 1 56 LYS 56 46 46 LYS LYS A . n A 1 57 GLU 57 47 47 GLU GLU A . n A 1 58 VAL 58 48 48 VAL VAL A . n A 1 59 GLU 59 49 49 GLU GLU A . n A 1 60 LYS 60 50 50 LYS LYS A . n A 1 61 ASN 61 51 51 ASN ASN A . n A 1 62 LEU 62 52 52 LEU LEU A . n A 1 63 LYS 63 53 ? ? ? A . n A 1 64 SER 64 54 ? ? ? A . n A 1 65 CYS 65 55 ? ? ? A . n A 1 66 LEU 66 56 56 LEU LEU A . n A 1 67 ASP 67 57 57 ASP ASP A . n A 1 68 ASN 68 58 58 ASN ASN A . n A 1 69 VAL 69 59 59 VAL VAL A . n A 1 70 ASN 70 60 60 ASN ASN A . n A 1 71 VAL 71 61 61 VAL VAL A . n A 1 72 VAL 72 62 62 VAL VAL A . n A 1 73 SER 73 63 63 SER SER A . n A 1 74 VAL 74 64 64 VAL VAL A . n A 1 75 ASP 75 65 65 ASP ASP A . n A 1 76 THR 76 66 66 THR THR A . n A 1 77 ALA 77 67 67 ALA ALA A . n A 1 78 ARG 78 68 68 ARG ARG A . n A 1 79 THR 79 69 69 THR THR A . n A 1 80 LEU 80 70 70 LEU LEU A . n A 1 81 PHE 81 71 71 PHE PHE A . n A 1 82 ASN 82 72 72 ASN ASN A . n A 1 83 GLN 83 73 73 GLN GLN A . n A 1 84 VAL 84 74 74 VAL VAL A . n A 1 85 MET 85 75 75 MET MET A . n A 1 86 GLU 86 76 76 GLU GLU A . n A 1 87 LYS 87 77 77 LYS LYS A . n A 1 88 GLU 88 78 78 GLU GLU A . n A 1 89 PHE 89 79 79 PHE PHE A . n A 1 90 GLU 90 80 80 GLU GLU A . n A 1 91 ASP 91 81 81 ASP ASP A . n A 1 92 GLY 92 82 82 GLY GLY A . n A 1 93 ILE 93 83 83 ILE ILE A . n A 1 94 ILE 94 84 84 ILE ILE A . n A 1 95 ASN 95 85 85 ASN ASN A . n A 1 96 TRP 96 86 86 TRP TRP A . n A 1 97 GLY 97 87 87 GLY GLY A . n A 1 98 ARG 98 88 88 ARG ARG A . n A 1 99 ILE 99 89 89 ILE ILE A . n A 1 100 VAL 100 90 90 VAL VAL A . n A 1 101 THR 101 91 91 THR THR A . n A 1 102 ILE 102 92 92 ILE ILE A . n A 1 103 PHE 103 93 93 PHE PHE A . n A 1 104 ALA 104 94 94 ALA ALA A . n A 1 105 PHE 105 95 95 PHE PHE A . n A 1 106 GLU 106 96 96 GLU GLU A . n A 1 107 GLY 107 97 97 GLY GLY A . n A 1 108 ILE 108 98 98 ILE ILE A . n A 1 109 LEU 109 99 99 LEU LEU A . n A 1 110 ILE 110 100 100 ILE ILE A . n A 1 111 LYS 111 101 101 LYS LYS A . n A 1 112 LYS 112 102 102 LYS LYS A . n A 1 113 LEU 113 103 103 LEU LEU A . n A 1 114 LEU 114 104 104 LEU LEU A . n A 1 115 ARG 115 105 105 ARG ARG A . n A 1 116 GLN 116 106 106 GLN GLN A . n A 1 117 GLN 117 107 107 GLN GLN A . n A 1 118 ILE 118 108 108 ILE ILE A . n A 1 119 ALA 119 109 109 ALA ALA A . n A 1 120 PRO 120 110 110 PRO PRO A . n A 1 121 ASP 121 111 ? ? ? A . n A 1 122 VAL 122 112 ? ? ? A . n A 1 123 ASP 123 113 ? ? ? A . n A 1 124 THR 124 114 114 THR THR A . n A 1 125 TYR 125 115 115 TYR TYR A . n A 1 126 LYS 126 116 116 LYS LYS A . n A 1 127 GLU 127 117 117 GLU GLU A . n A 1 128 ILE 128 118 118 ILE ILE A . n A 1 129 SER 129 119 119 SER SER A . n A 1 130 TYR 130 120 120 TYR TYR A . n A 1 131 PHE 131 121 121 PHE PHE A . n A 1 132 VAL 132 122 122 VAL VAL A . n A 1 133 ALA 133 123 123 ALA ALA A . n A 1 134 GLU 134 124 124 GLU GLU A . n A 1 135 PHE 135 125 125 PHE PHE A . n A 1 136 ILE 136 126 126 ILE ILE A . n A 1 137 MET 137 127 127 MET MET A . n A 1 138 ASN 138 128 128 ASN ASN A . n A 1 139 ASN 139 129 129 ASN ASN A . n A 1 140 THR 140 130 130 THR THR A . n A 1 141 GLY 141 131 131 GLY GLY A . n A 1 142 GLU 142 132 132 GLU GLU A . n A 1 143 TRP 143 133 133 TRP TRP A . n A 1 144 ILE 144 134 134 ILE ILE A . n A 1 145 ARG 145 135 135 ARG ARG A . n A 1 146 GLN 146 136 136 GLN GLN A . n A 1 147 ASN 147 137 137 ASN ASN A . n A 1 148 GLY 148 138 138 GLY GLY A . n A 1 149 GLY 149 139 139 GLY GLY A . n A 1 150 TRP 150 140 140 TRP TRP A . n A 1 151 GLU 151 141 141 GLU GLU A . n A 1 152 ASN 152 142 142 ASN ASN A . n A 1 153 GLY 153 143 143 GLY GLY A . n A 1 154 PHE 154 144 144 PHE PHE A . n A 1 155 VAL 155 145 145 VAL VAL A . n A 1 156 LYS 156 146 146 LYS LYS A . n A 1 157 LYS 157 147 147 LYS LYS A . n A 1 158 PHE 158 148 148 PHE PHE A . n A 1 159 GLU 159 149 149 GLU GLU A . n A 1 160 PRO 160 150 150 PRO PRO A . n A 1 161 LYS 161 151 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 15 HOH HOH A . B 2 HOH 2 202 4 HOH HOH A . B 2 HOH 3 203 3 HOH HOH A . B 2 HOH 4 204 5 HOH HOH A . B 2 HOH 5 205 8 HOH HOH A . B 2 HOH 6 206 12 HOH HOH A . B 2 HOH 7 207 1 HOH HOH A . B 2 HOH 8 208 14 HOH HOH A . B 2 HOH 9 209 13 HOH HOH A . B 2 HOH 10 210 2 HOH HOH A . B 2 HOH 11 211 18 HOH HOH A . B 2 HOH 12 212 20 HOH HOH A . B 2 HOH 13 213 11 HOH HOH A . B 2 HOH 14 214 6 HOH HOH A . B 2 HOH 15 215 10 HOH HOH A . B 2 HOH 16 216 17 HOH HOH A . B 2 HOH 17 217 7 HOH HOH A . B 2 HOH 18 218 9 HOH HOH A . B 2 HOH 19 219 16 HOH HOH A . B 2 HOH 20 220 19 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7750 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-06-03 2 'Structure model' 1 1 2020-07-01 3 'Structure model' 1 2 2023-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 3 'Structure model' '_database_2.pdbx_DOI' 4 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 5.7695 12.5565 -11.5575 0.5944 ? -0.0781 ? 0.0108 ? 0.2756 ? -0.0445 ? 0.4560 ? 5.0192 ? -3.4312 ? 1.7090 ? 5.2076 ? -1.0856 ? 7.6480 ? 0.0916 ? 0.1392 ? 0.5592 ? 0.2781 ? 0.1956 ? -0.9802 ? -1.4761 ? 0.5374 ? -0.3816 ? 2 'X-RAY DIFFRACTION' ? refined 0.3453 4.1026 -19.7762 0.7358 ? -0.1134 ? 0.0223 ? 0.3019 ? 0.0223 ? 0.3762 ? 4.0665 ? 1.1983 ? 3.4862 ? 5.4666 ? 1.1285 ? 6.7246 ? -0.1431 ? 0.7389 ? -0.7175 ? -0.4734 ? 0.4406 ? 0.2778 ? 0.9905 ? 0.6690 ? -0.1949 ? 3 'X-RAY DIFFRACTION' ? refined -12.7687 19.1734 -24.3573 1.0300 ? -0.0569 ? 0.1148 ? 0.9483 ? 0.1381 ? 0.6667 ? 7.3249 ? 4.7220 ? 1.2872 ? 3.5121 ? 1.9290 ? 2.7962 ? -0.6958 ? 1.7084 ? -0.4040 ? -1.6170 ? 1.3354 ? -0.6525 ? -1.0595 ? -2.4070 ? -0.0290 ? 4 'X-RAY DIFFRACTION' ? refined -8.3963 12.1952 -14.9209 0.5111 ? 0.0817 ? 0.0400 ? 0.5440 ? 0.0581 ? 0.3895 ? 3.5085 ? -1.0517 ? -1.2240 ? 7.7029 ? -4.2536 ? 5.3522 ? 0.1432 ? 0.2269 ? 0.4085 ? 0.3593 ? 0.6431 ? 1.1054 ? -0.5892 ? -1.5242 ? -0.6288 ? 5 'X-RAY DIFFRACTION' ? refined -4.5427 9.9147 -4.4658 0.5718 ? 0.0629 ? 0.1460 ? 0.3255 ? -0.0027 ? 0.3433 ? 3.0964 ? -0.4783 ? 0.0035 ? 1.6510 ? 1.4139 ? 4.5355 ? 0.3508 ? -0.0299 ? 0.0854 ? 0.1988 ? -0.5096 ? 0.4795 ? -0.5090 ? -0.2847 ? 0.0992 ? 6 'X-RAY DIFFRACTION' ? refined 4.2185 -3.2404 -7.6571 0.8335 ? -0.0006 ? 0.0029 ? 0.3692 ? 0.0039 ? 0.3637 ? 8.5060 ? -3.7508 ? -4.1860 ? 8.5438 ? 5.3555 ? 3.8441 ? 0.3879 ? -0.0649 ? 0.2258 ? 0.6532 ? 0.1131 ? -0.4930 ? 0.3961 ? 0.2875 ? -0.3609 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 4 ? ? A 31 ? ;chain 'A' and (resid 4 through 31 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 32 ? ? A 51 ? ;chain 'A' and (resid 32 through 51 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 52 ? ? A 63 ? ;chain 'A' and (resid 52 through 63 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 64 ? ? A 114 ? ;chain 'A' and (resid 64 through 114 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 115 ? ? A 137 ? ;chain 'A' and (resid 115 through 137 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? A 138 ? ? A 150 ? ;chain 'A' and (resid 138 through 150 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 208 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 211 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.13 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 5 ? CG ? A GLU 15 CG 2 1 Y 1 A GLU 5 ? CD ? A GLU 15 CD 3 1 Y 1 A GLU 5 ? OE1 ? A GLU 15 OE1 4 1 Y 1 A GLU 5 ? OE2 ? A GLU 15 OE2 5 1 Y 1 A SER 28 ? CB ? A SER 38 CB 6 1 Y 1 A SER 28 ? OG ? A SER 38 OG 7 1 Y 1 A GLU 47 ? CG ? A GLU 57 CG 8 1 Y 1 A GLU 47 ? CD ? A GLU 57 CD 9 1 Y 1 A GLU 47 ? OE1 ? A GLU 57 OE1 10 1 Y 1 A GLU 47 ? OE2 ? A GLU 57 OE2 11 1 Y 1 A LEU 52 ? CG ? A LEU 62 CG 12 1 Y 1 A LEU 52 ? CD1 ? A LEU 62 CD1 13 1 Y 1 A LEU 52 ? CD2 ? A LEU 62 CD2 14 1 Y 1 A ASN 58 ? CG ? A ASN 68 CG 15 1 Y 1 A ASN 58 ? OD1 ? A ASN 68 OD1 16 1 Y 1 A ASN 58 ? ND2 ? A ASN 68 ND2 17 1 Y 1 A VAL 59 ? CG1 ? A VAL 69 CG1 18 1 Y 1 A VAL 59 ? CG2 ? A VAL 69 CG2 19 1 Y 1 A THR 66 ? OG1 ? A THR 76 OG1 20 1 Y 1 A THR 66 ? CG2 ? A THR 76 CG2 21 1 Y 1 A LEU 70 ? CG ? A LEU 80 CG 22 1 Y 1 A LEU 70 ? CD1 ? A LEU 80 CD1 23 1 Y 1 A LEU 70 ? CD2 ? A LEU 80 CD2 24 1 Y 1 A GLN 73 ? CG ? A GLN 83 CG 25 1 Y 1 A GLN 73 ? CD ? A GLN 83 CD 26 1 Y 1 A GLN 73 ? OE1 ? A GLN 83 OE1 27 1 Y 1 A GLN 73 ? NE2 ? A GLN 83 NE2 28 1 Y 1 A VAL 74 ? CG1 ? A VAL 84 CG1 29 1 Y 1 A VAL 74 ? CG2 ? A VAL 84 CG2 30 1 Y 1 A GLU 76 ? CG ? A GLU 86 CG 31 1 Y 1 A GLU 76 ? CD ? A GLU 86 CD 32 1 Y 1 A GLU 76 ? OE1 ? A GLU 86 OE1 33 1 Y 1 A GLU 76 ? OE2 ? A GLU 86 OE2 34 1 Y 1 A LYS 77 ? CG ? A LYS 87 CG 35 1 Y 1 A LYS 77 ? CD ? A LYS 87 CD 36 1 Y 1 A LYS 77 ? CE ? A LYS 87 CE 37 1 Y 1 A LYS 77 ? NZ ? A LYS 87 NZ 38 1 Y 1 A GLU 78 ? CG ? A GLU 88 CG 39 1 Y 1 A GLU 78 ? CD ? A GLU 88 CD 40 1 Y 1 A GLU 78 ? OE1 ? A GLU 88 OE1 41 1 Y 1 A GLU 78 ? OE2 ? A GLU 88 OE2 42 1 Y 1 A GLU 80 ? CG ? A GLU 90 CG 43 1 Y 1 A GLU 80 ? CD ? A GLU 90 CD 44 1 Y 1 A GLU 80 ? OE1 ? A GLU 90 OE1 45 1 Y 1 A GLU 80 ? OE2 ? A GLU 90 OE2 46 1 Y 1 A ARG 105 ? CG ? A ARG 115 CG 47 1 Y 1 A ARG 105 ? CD ? A ARG 115 CD 48 1 Y 1 A ARG 105 ? NE ? A ARG 115 NE 49 1 Y 1 A ARG 105 ? CZ ? A ARG 115 CZ 50 1 Y 1 A ARG 105 ? NH1 ? A ARG 115 NH1 51 1 Y 1 A ARG 105 ? NH2 ? A ARG 115 NH2 52 1 Y 1 A ILE 108 ? CG1 ? A ILE 118 CG1 53 1 Y 1 A ILE 108 ? CG2 ? A ILE 118 CG2 54 1 Y 1 A ILE 108 ? CD1 ? A ILE 118 CD1 55 1 Y 1 A GLU 117 ? CG ? A GLU 127 CG 56 1 Y 1 A GLU 117 ? CD ? A GLU 127 CD 57 1 Y 1 A GLU 117 ? OE1 ? A GLU 127 OE1 58 1 Y 1 A GLU 117 ? OE2 ? A GLU 127 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -9 ? A MET 1 2 1 Y 1 A GLY -8 ? A GLY 2 3 1 Y 1 A HIS -7 ? A HIS 3 4 1 Y 1 A HIS -6 ? A HIS 4 5 1 Y 1 A HIS -5 ? A HIS 5 6 1 Y 1 A HIS -4 ? A HIS 6 7 1 Y 1 A HIS -3 ? A HIS 7 8 1 Y 1 A HIS -2 ? A HIS 8 9 1 Y 1 A SER -1 ? A SER 9 10 1 Y 1 A HIS 0 ? A HIS 10 11 1 Y 1 A MET 1 ? A MET 11 12 1 Y 1 A THR 2 ? A THR 12 13 1 Y 1 A ASP 3 ? A ASP 13 14 1 Y 1 A GLN 25 ? A GLN 35 15 1 Y 1 A PRO 26 ? A PRO 36 16 1 Y 1 A GLY 27 ? A GLY 37 17 1 Y 1 A LYS 53 ? A LYS 63 18 1 Y 1 A SER 54 ? A SER 64 19 1 Y 1 A CYS 55 ? A CYS 65 20 1 Y 1 A ASP 111 ? A ASP 121 21 1 Y 1 A VAL 112 ? A VAL 122 22 1 Y 1 A ASP 113 ? A ASP 123 23 1 Y 1 A LYS 151 ? A LYS 161 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Cancer Institute (NIH/NCI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5WHH _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details monomeric #