data_6WF4 # _entry.id 6WF4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6WF4 pdb_00006wf4 10.2210/pdb6wf4/pdb WWPDB D_1000248101 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6WF4 _pdbx_database_status.recvd_initial_deposition_date 2020-04-03 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Clinger, J.A.' 1 ? 'Miller, M.D.' 2 ? 'Hall, R.E.' 3 ? 'Zhang, Y.' 4 ? 'Elshahawi, S.I.' 5 ? 'Thorson, J.S.' 6 ? 'Van Lanen, S.G.' 7 ? 'Phillips Jr., G.N.' 8 ? 'Enzyme Discovery for Natural Product Biosynthesis (NatPro)' 9 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Structural and functional characterization of two cooperative enzymes responsible for the stability of p-terphenyls. ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Clinger, J.A.' 1 ? primary 'Zhang, Y.' 2 ? primary 'Liu, Y.' 3 ? primary 'Miller, M.D.' 4 ? primary 'Hall, R.E.' 5 ? primary 'Van Lanen, S.G.' 6 ? primary 'Phillips Jr., G.N.' 7 ? primary 'Thorson, J.S.' 8 ? primary 'Elshahawri, S.I.' 9 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6WF4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 97.176 _cell.length_a_esd ? _cell.length_b 97.176 _cell.length_b_esd ? _cell.length_c 29.393 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6WF4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Terfestatin Biosyntheis Enzyme C' 19953.242 1 ? ? ? ? 2 non-polymer syn '(2~5~S)-2~3~,2~5~,2~6~-trihydroxy[1~1~,2~1~:2~4~,3~1~-terphenyl]-2~2~(2~5~H)-one' 294.301 1 ? ? ? ? 3 non-polymer syn 'ISOPROPYL ALCOHOL' 60.095 1 ? ? ? ? 4 water nat water 18.015 72 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHVANTMASPNTPAPPNAAASPNPSDSPNPSDSPNPPASPNIEAILASYAGFRDRDIEGILS GMHPDVEWVHPEGMGKYGLGGTKLGHAGIKEFLAHVPTVLGGMRLAPREFIEQGDRVVVFGTREVTSLRGTTATLDFVHS WTMRDGKATRMEDIFDTVAFHELIES ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHVANTMASPNTPAPPNAAASPNPSDSPNPSDSPNPPASPNIEAILASYAGFRDRDIEGILS GMHPDVEWVHPEGMGKYGLGGTKLGHAGIKEFLAHVPTVLGGMRLAPREFIEQGDRVVVFGTREVTSLRGTTATLDFVHS WTMRDGKATRMEDIFDTVAFHELIES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 VAL n 1 22 ALA n 1 23 ASN n 1 24 THR n 1 25 MET n 1 26 ALA n 1 27 SER n 1 28 PRO n 1 29 ASN n 1 30 THR n 1 31 PRO n 1 32 ALA n 1 33 PRO n 1 34 PRO n 1 35 ASN n 1 36 ALA n 1 37 ALA n 1 38 ALA n 1 39 SER n 1 40 PRO n 1 41 ASN n 1 42 PRO n 1 43 SER n 1 44 ASP n 1 45 SER n 1 46 PRO n 1 47 ASN n 1 48 PRO n 1 49 SER n 1 50 ASP n 1 51 SER n 1 52 PRO n 1 53 ASN n 1 54 PRO n 1 55 PRO n 1 56 ALA n 1 57 SER n 1 58 PRO n 1 59 ASN n 1 60 ILE n 1 61 GLU n 1 62 ALA n 1 63 ILE n 1 64 LEU n 1 65 ALA n 1 66 SER n 1 67 TYR n 1 68 ALA n 1 69 GLY n 1 70 PHE n 1 71 ARG n 1 72 ASP n 1 73 ARG n 1 74 ASP n 1 75 ILE n 1 76 GLU n 1 77 GLY n 1 78 ILE n 1 79 LEU n 1 80 SER n 1 81 GLY n 1 82 MET n 1 83 HIS n 1 84 PRO n 1 85 ASP n 1 86 VAL n 1 87 GLU n 1 88 TRP n 1 89 VAL n 1 90 HIS n 1 91 PRO n 1 92 GLU n 1 93 GLY n 1 94 MET n 1 95 GLY n 1 96 LYS n 1 97 TYR n 1 98 GLY n 1 99 LEU n 1 100 GLY n 1 101 GLY n 1 102 THR n 1 103 LYS n 1 104 LEU n 1 105 GLY n 1 106 HIS n 1 107 ALA n 1 108 GLY n 1 109 ILE n 1 110 LYS n 1 111 GLU n 1 112 PHE n 1 113 LEU n 1 114 ALA n 1 115 HIS n 1 116 VAL n 1 117 PRO n 1 118 THR n 1 119 VAL n 1 120 LEU n 1 121 GLY n 1 122 GLY n 1 123 MET n 1 124 ARG n 1 125 LEU n 1 126 ALA n 1 127 PRO n 1 128 ARG n 1 129 GLU n 1 130 PHE n 1 131 ILE n 1 132 GLU n 1 133 GLN n 1 134 GLY n 1 135 ASP n 1 136 ARG n 1 137 VAL n 1 138 VAL n 1 139 VAL n 1 140 PHE n 1 141 GLY n 1 142 THR n 1 143 ARG n 1 144 GLU n 1 145 VAL n 1 146 THR n 1 147 SER n 1 148 LEU n 1 149 ARG n 1 150 GLY n 1 151 THR n 1 152 THR n 1 153 ALA n 1 154 THR n 1 155 LEU n 1 156 ASP n 1 157 PHE n 1 158 VAL n 1 159 HIS n 1 160 SER n 1 161 TRP n 1 162 THR n 1 163 MET n 1 164 ARG n 1 165 ASP n 1 166 GLY n 1 167 LYS n 1 168 ALA n 1 169 THR n 1 170 ARG n 1 171 MET n 1 172 GLU n 1 173 ASP n 1 174 ILE n 1 175 PHE n 1 176 ASP n 1 177 THR n 1 178 VAL n 1 179 ALA n 1 180 PHE n 1 181 HIS n 1 182 GLU n 1 183 LEU n 1 184 ILE n 1 185 GLU n 1 186 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 186 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces sp. RM-5-8' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1429103 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A3B6UEU1_9ACTN _struct_ref.pdbx_db_accession A0A3B6UEU1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MASPNTPAPPNAAASPNPSDSPNPSDSPNPPASPNIEAILASYAGFRDRDIEGILSGMHPDVEWVHPEGMGKYGLGGTKL GHAGIKEFLAHVPTVLGGMRLAPREFIEQGDRVVVFGTREVTSLRGTTATLDFVHSWTMRDGKATRMEDIFDTVAFHELI ES ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6WF4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 25 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 186 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A3B6UEU1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 162 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 25 _struct_ref_seq.pdbx_auth_seq_align_end 186 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6WF4 MET A 1 ? UNP A0A3B6UEU1 ? ? 'initiating methionine' 1 1 1 6WF4 GLY A 2 ? UNP A0A3B6UEU1 ? ? 'expression tag' 2 2 1 6WF4 SER A 3 ? UNP A0A3B6UEU1 ? ? 'expression tag' 3 3 1 6WF4 SER A 4 ? UNP A0A3B6UEU1 ? ? 'expression tag' 4 4 1 6WF4 HIS A 5 ? UNP A0A3B6UEU1 ? ? 'expression tag' 5 5 1 6WF4 HIS A 6 ? UNP A0A3B6UEU1 ? ? 'expression tag' 6 6 1 6WF4 HIS A 7 ? UNP A0A3B6UEU1 ? ? 'expression tag' 7 7 1 6WF4 HIS A 8 ? UNP A0A3B6UEU1 ? ? 'expression tag' 8 8 1 6WF4 HIS A 9 ? UNP A0A3B6UEU1 ? ? 'expression tag' 9 9 1 6WF4 HIS A 10 ? UNP A0A3B6UEU1 ? ? 'expression tag' 10 10 1 6WF4 SER A 11 ? UNP A0A3B6UEU1 ? ? 'expression tag' 11 11 1 6WF4 SER A 12 ? UNP A0A3B6UEU1 ? ? 'expression tag' 12 12 1 6WF4 GLY A 13 ? UNP A0A3B6UEU1 ? ? 'expression tag' 13 13 1 6WF4 LEU A 14 ? UNP A0A3B6UEU1 ? ? 'expression tag' 14 14 1 6WF4 VAL A 15 ? UNP A0A3B6UEU1 ? ? 'expression tag' 15 15 1 6WF4 PRO A 16 ? UNP A0A3B6UEU1 ? ? 'expression tag' 16 16 1 6WF4 ARG A 17 ? UNP A0A3B6UEU1 ? ? 'expression tag' 17 17 1 6WF4 GLY A 18 ? UNP A0A3B6UEU1 ? ? 'expression tag' 18 18 1 6WF4 SER A 19 ? UNP A0A3B6UEU1 ? ? 'expression tag' 19 19 1 6WF4 HIS A 20 ? UNP A0A3B6UEU1 ? ? 'expression tag' 20 20 1 6WF4 VAL A 21 ? UNP A0A3B6UEU1 ? ? 'expression tag' 21 21 1 6WF4 ALA A 22 ? UNP A0A3B6UEU1 ? ? 'expression tag' 22 22 1 6WF4 ASN A 23 ? UNP A0A3B6UEU1 ? ? 'expression tag' 23 23 1 6WF4 THR A 24 ? UNP A0A3B6UEU1 ? ? 'expression tag' 24 24 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IPA non-polymer . 'ISOPROPYL ALCOHOL' 2-PROPANOL 'C3 H8 O' 60.095 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U07 non-polymer . '(2~5~S)-2~3~,2~5~,2~6~-trihydroxy[1~1~,2~1~:2~4~,3~1~-terphenyl]-2~2~(2~5~H)-one' ? 'C18 H14 O4' 294.301 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6WF4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.01 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.74 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.000 _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% v/v 2-Propanol, 0.1M MES, 20%w/v PEG MME 2000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-300' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-01-31 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength .97856 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-G' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list .97856 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-G _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6WF4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.960 _reflns.d_resolution_low 48.590 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11538 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.200 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14.900 _reflns.pdbx_Rmerge_I_obs 0.102 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 111 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.106 _reflns.pdbx_Rpim_I_all 0.026 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 171889 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.960 2.010 ? ? 3227 ? ? ? 712 88.400 ? ? ? ? 0.795 ? ? ? ? ? ? ? ? 4.500 ? ? ? 1.500 0.880 0.358 ? 1 1 0.460 ? ? 8.770 48.590 ? ? 2351 ? ? ? 154 99.500 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 15.300 ? ? ? 46.600 0.048 0.012 ? 2 1 1.000 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 169.720 _refine.B_iso_mean 50.5429 _refine.B_iso_min 16.980 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6WF4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9700 _refine.ls_d_res_low 31.8100 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11107 _refine.ls_number_reflns_R_free 508 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.6200 _refine.ls_percent_reflns_R_free 4.5700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2024 _refine.ls_R_factor_R_free 0.2362 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2009 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.330 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6D34 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.2700 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.9700 _refine_hist.d_res_low 31.8100 _refine_hist.number_atoms_solvent 74 _refine_hist.number_atoms_total 1113 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 130 _refine_hist.pdbx_B_iso_mean_ligand 55.02 _refine_hist.pdbx_B_iso_mean_solvent 43.48 _refine_hist.pdbx_number_atoms_protein 1005 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 34 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9700 2.1700 2545 . 111 2434 90.0000 . . . 0.3956 0.0000 0.3241 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.1700 2.4800 2793 . 126 2667 97.0000 . . . 0.2842 0.0000 0.2703 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.4800 3.1200 2818 . 138 2680 99.0000 . . . 0.2220 0.0000 0.2209 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.1300 31.8100 2951 . 133 2818 100.0000 . . . 0.2050 0.0000 0.1579 . . . . . . . 4 . . . # _struct.entry_id 6WF4 _struct.title 'Crystal Structure of TerC Co-crystallized with Polyporic Acid' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6WF4 _struct_keywords.text ;natural products, jellyroll, Structural Genomics, PSI-Biology, Enzyme Discovery for Natural Product Biosynthesis, NatPro, BIOSYNTHETIC PROTEIN ; _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 57 ? ASP A 72 ? SER A 57 ASP A 72 1 ? 16 HELX_P HELX_P2 AA2 ASP A 74 ? SER A 80 ? ASP A 74 SER A 80 1 ? 7 HELX_P HELX_P3 AA3 PRO A 91 ? GLY A 98 ? PRO A 91 GLY A 98 5 ? 8 HELX_P HELX_P4 AA4 GLY A 105 ? VAL A 116 ? GLY A 105 VAL A 116 1 ? 12 HELX_P HELX_P5 AA5 ASP A 176 ? GLU A 185 ? ASP A 176 GLU A 185 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 101 ? LEU A 104 ? GLY A 101 LEU A 104 AA1 2 MET A 82 ? HIS A 90 ? MET A 82 HIS A 90 AA1 3 LYS A 167 ? ILE A 174 ? LYS A 167 ILE A 174 AA1 4 THR A 152 ? ARG A 164 ? THR A 152 ARG A 164 AA1 5 ARG A 136 ? SER A 147 ? ARG A 136 SER A 147 AA1 6 LEU A 120 ? GLN A 133 ? LEU A 120 GLN A 133 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LYS A 103 ? O LYS A 103 N TRP A 88 ? N TRP A 88 AA1 2 3 N HIS A 83 ? N HIS A 83 O ALA A 168 ? O ALA A 168 AA1 3 4 O ARG A 170 ? O ARG A 170 N THR A 162 ? N THR A 162 AA1 4 5 O TRP A 161 ? O TRP A 161 N VAL A 137 ? N VAL A 137 AA1 5 6 O THR A 146 ? O THR A 146 N GLY A 122 ? N GLY A 122 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A U07 201 ? 11 'binding site for residue U07 A 201' AC2 Software A IPA 202 ? 5 'binding site for residue IPA A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 PHE A 70 ? PHE A 70 . ? 1_555 ? 2 AC1 11 TRP A 88 ? TRP A 88 . ? 1_555 ? 3 AC1 11 LEU A 113 ? LEU A 113 . ? 1_555 ? 4 AC1 11 MET A 123 ? MET A 123 . ? 1_555 ? 5 AC1 11 LEU A 125 ? LEU A 125 . ? 1_555 ? 6 AC1 11 ARG A 143 ? ARG A 143 . ? 1_555 ? 7 AC1 11 HIS A 159 ? HIS A 159 . ? 1_555 ? 8 AC1 11 ASP A 173 ? ASP A 173 . ? 1_555 ? 9 AC1 11 PHE A 180 ? PHE A 180 . ? 1_555 ? 10 AC1 11 HOH D . ? HOH A 304 . ? 1_555 ? 11 AC1 11 HOH D . ? HOH A 337 . ? 1_555 ? 12 AC2 5 GLY A 122 ? GLY A 122 . ? 1_555 ? 13 AC2 5 MET A 123 ? MET A 123 . ? 1_555 ? 14 AC2 5 ARG A 124 ? ARG A 124 . ? 1_555 ? 15 AC2 5 HOH D . ? HOH A 317 . ? 1_555 ? 16 AC2 5 HOH D . ? HOH A 334 . ? 1_555 ? # _atom_sites.entry_id 6WF4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010291 _atom_sites.fract_transf_matrix[1][2] 0.005941 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011883 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.034022 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 HIS 8 8 ? ? ? A . n A 1 9 HIS 9 9 ? ? ? A . n A 1 10 HIS 10 10 ? ? ? A . n A 1 11 SER 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 GLY 13 13 ? ? ? A . n A 1 14 LEU 14 14 ? ? ? A . n A 1 15 VAL 15 15 ? ? ? A . n A 1 16 PRO 16 16 ? ? ? A . n A 1 17 ARG 17 17 ? ? ? A . n A 1 18 GLY 18 18 ? ? ? A . n A 1 19 SER 19 19 ? ? ? A . n A 1 20 HIS 20 20 ? ? ? A . n A 1 21 VAL 21 21 ? ? ? A . n A 1 22 ALA 22 22 ? ? ? A . n A 1 23 ASN 23 23 ? ? ? A . n A 1 24 THR 24 24 ? ? ? A . n A 1 25 MET 25 25 ? ? ? A . n A 1 26 ALA 26 26 ? ? ? A . n A 1 27 SER 27 27 ? ? ? A . n A 1 28 PRO 28 28 ? ? ? A . n A 1 29 ASN 29 29 ? ? ? A . n A 1 30 THR 30 30 ? ? ? A . n A 1 31 PRO 31 31 ? ? ? A . n A 1 32 ALA 32 32 ? ? ? A . n A 1 33 PRO 33 33 ? ? ? A . n A 1 34 PRO 34 34 ? ? ? A . n A 1 35 ASN 35 35 ? ? ? A . n A 1 36 ALA 36 36 ? ? ? A . n A 1 37 ALA 37 37 ? ? ? A . n A 1 38 ALA 38 38 ? ? ? A . n A 1 39 SER 39 39 ? ? ? A . n A 1 40 PRO 40 40 ? ? ? A . n A 1 41 ASN 41 41 ? ? ? A . n A 1 42 PRO 42 42 ? ? ? A . n A 1 43 SER 43 43 ? ? ? A . n A 1 44 ASP 44 44 ? ? ? A . n A 1 45 SER 45 45 ? ? ? A . n A 1 46 PRO 46 46 ? ? ? A . n A 1 47 ASN 47 47 ? ? ? A . n A 1 48 PRO 48 48 ? ? ? A . n A 1 49 SER 49 49 ? ? ? A . n A 1 50 ASP 50 50 ? ? ? A . n A 1 51 SER 51 51 ? ? ? A . n A 1 52 PRO 52 52 ? ? ? A . n A 1 53 ASN 53 53 ? ? ? A . n A 1 54 PRO 54 54 ? ? ? A . n A 1 55 PRO 55 55 ? ? ? A . n A 1 56 ALA 56 56 ? ? ? A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 TRP 88 88 88 TRP TRP A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 MET 94 94 94 MET MET A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 MET 123 123 123 MET MET A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 PHE 157 157 157 PHE PHE A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 HIS 159 159 159 HIS HIS A . n A 1 160 SER 160 160 160 SER SER A . n A 1 161 TRP 161 161 161 TRP TRP A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 MET 163 163 163 MET MET A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 THR 169 169 169 THR THR A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 MET 171 171 171 MET MET A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 ASP 173 173 173 ASP ASP A . n A 1 174 ILE 174 174 174 ILE ILE A . n A 1 175 PHE 175 175 175 PHE PHE A . n A 1 176 ASP 176 176 176 ASP ASP A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 VAL 178 178 178 VAL VAL A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 PHE 180 180 180 PHE PHE A . n A 1 181 HIS 181 181 181 HIS HIS A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 ILE 184 184 184 ILE ILE A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 SER 186 186 186 SER SER A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name PSI:Biology _pdbx_SG_project.full_name_of_center 'Enzyme Discovery for Natural Product Biosynthesis' _pdbx_SG_project.initial_of_center NatPro # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 U07 1 201 200 U07 APP A . C 3 IPA 1 202 1 IPA IPA A . D 4 HOH 1 301 43 HOH HOH A . D 4 HOH 2 302 23 HOH HOH A . D 4 HOH 3 303 46 HOH HOH A . D 4 HOH 4 304 47 HOH HOH A . D 4 HOH 5 305 69 HOH HOH A . D 4 HOH 6 306 18 HOH HOH A . D 4 HOH 7 307 24 HOH HOH A . D 4 HOH 8 308 41 HOH HOH A . D 4 HOH 9 309 31 HOH HOH A . D 4 HOH 10 310 57 HOH HOH A . D 4 HOH 11 311 7 HOH HOH A . D 4 HOH 12 312 42 HOH HOH A . D 4 HOH 13 313 2 HOH HOH A . D 4 HOH 14 314 75 HOH HOH A . D 4 HOH 15 315 6 HOH HOH A . D 4 HOH 16 316 5 HOH HOH A . D 4 HOH 17 317 10 HOH HOH A . D 4 HOH 18 318 28 HOH HOH A . D 4 HOH 19 319 13 HOH HOH A . D 4 HOH 20 320 38 HOH HOH A . D 4 HOH 21 321 16 HOH HOH A . D 4 HOH 22 322 27 HOH HOH A . D 4 HOH 23 323 73 HOH HOH A . D 4 HOH 24 324 26 HOH HOH A . D 4 HOH 25 325 58 HOH HOH A . D 4 HOH 26 326 20 HOH HOH A . D 4 HOH 27 327 21 HOH HOH A . D 4 HOH 28 328 8 HOH HOH A . D 4 HOH 29 329 17 HOH HOH A . D 4 HOH 30 330 39 HOH HOH A . D 4 HOH 31 331 9 HOH HOH A . D 4 HOH 32 332 63 HOH HOH A . D 4 HOH 33 333 3 HOH HOH A . D 4 HOH 34 334 25 HOH HOH A . D 4 HOH 35 335 64 HOH HOH A . D 4 HOH 36 336 14 HOH HOH A . D 4 HOH 37 337 48 HOH HOH A . D 4 HOH 38 338 22 HOH HOH A . D 4 HOH 39 339 4 HOH HOH A . D 4 HOH 40 340 12 HOH HOH A . D 4 HOH 41 341 76 HOH HOH A . D 4 HOH 42 342 50 HOH HOH A . D 4 HOH 43 343 60 HOH HOH A . D 4 HOH 44 344 15 HOH HOH A . D 4 HOH 45 345 11 HOH HOH A . D 4 HOH 46 346 32 HOH HOH A . D 4 HOH 47 347 37 HOH HOH A . D 4 HOH 48 348 36 HOH HOH A . D 4 HOH 49 349 51 HOH HOH A . D 4 HOH 50 350 59 HOH HOH A . D 4 HOH 51 351 74 HOH HOH A . D 4 HOH 52 352 30 HOH HOH A . D 4 HOH 53 353 19 HOH HOH A . D 4 HOH 54 354 40 HOH HOH A . D 4 HOH 55 355 65 HOH HOH A . D 4 HOH 56 356 34 HOH HOH A . D 4 HOH 57 357 61 HOH HOH A . D 4 HOH 58 358 71 HOH HOH A . D 4 HOH 59 359 68 HOH HOH A . D 4 HOH 60 360 33 HOH HOH A . D 4 HOH 61 361 35 HOH HOH A . D 4 HOH 62 362 1 HOH HOH A . D 4 HOH 63 363 29 HOH HOH A . D 4 HOH 64 364 66 HOH HOH A . D 4 HOH 65 365 70 HOH HOH A . D 4 HOH 66 366 67 HOH HOH A . D 4 HOH 67 367 72 HOH HOH A . D 4 HOH 68 368 62 HOH HOH A . D 4 HOH 69 369 52 HOH HOH A . D 4 HOH 70 370 53 HOH HOH A . D 4 HOH 71 371 54 HOH HOH A . D 4 HOH 72 372 49 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 372 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-04-07 2 'Structure model' 1 1 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_phasing_MR.entry_id 6WF4 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 4.160 _pdbx_phasing_MR.d_res_low_rotation 48.590 _pdbx_phasing_MR.d_res_high_translation 4.160 _pdbx_phasing_MR.d_res_low_translation 48.590 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.32 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.2 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? 2.1.2 5 # _pdbx_entry_details.entry_id 6WF4 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HE2 A HIS 83 ? A O A ARG 164 ? ? 1.46 2 1 OD2 A ASP 156 ? ? O A HOH 301 ? ? 2.09 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 330 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 352 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_556 _pdbx_validate_symm_contact.dist 2.07 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 80 ? ? -65.21 1.85 2 1 GLN A 133 ? ? -162.39 107.64 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 369 ? 6.54 . 2 1 O ? A HOH 370 ? 7.00 . 3 1 O ? A HOH 371 ? 9.09 . 4 1 O ? A HOH 372 ? 12.76 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 73 ? NE ? A ARG 73 NE 2 1 Y 1 A ARG 73 ? CZ ? A ARG 73 CZ 3 1 Y 1 A ARG 73 ? NH1 ? A ARG 73 NH1 4 1 Y 1 A ARG 73 ? NH2 ? A ARG 73 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A HIS 8 ? A HIS 8 9 1 Y 1 A HIS 9 ? A HIS 9 10 1 Y 1 A HIS 10 ? A HIS 10 11 1 Y 1 A SER 11 ? A SER 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A GLY 13 ? A GLY 13 14 1 Y 1 A LEU 14 ? A LEU 14 15 1 Y 1 A VAL 15 ? A VAL 15 16 1 Y 1 A PRO 16 ? A PRO 16 17 1 Y 1 A ARG 17 ? A ARG 17 18 1 Y 1 A GLY 18 ? A GLY 18 19 1 Y 1 A SER 19 ? A SER 19 20 1 Y 1 A HIS 20 ? A HIS 20 21 1 Y 1 A VAL 21 ? A VAL 21 22 1 Y 1 A ALA 22 ? A ALA 22 23 1 Y 1 A ASN 23 ? A ASN 23 24 1 Y 1 A THR 24 ? A THR 24 25 1 Y 1 A MET 25 ? A MET 25 26 1 Y 1 A ALA 26 ? A ALA 26 27 1 Y 1 A SER 27 ? A SER 27 28 1 Y 1 A PRO 28 ? A PRO 28 29 1 Y 1 A ASN 29 ? A ASN 29 30 1 Y 1 A THR 30 ? A THR 30 31 1 Y 1 A PRO 31 ? A PRO 31 32 1 Y 1 A ALA 32 ? A ALA 32 33 1 Y 1 A PRO 33 ? A PRO 33 34 1 Y 1 A PRO 34 ? A PRO 34 35 1 Y 1 A ASN 35 ? A ASN 35 36 1 Y 1 A ALA 36 ? A ALA 36 37 1 Y 1 A ALA 37 ? A ALA 37 38 1 Y 1 A ALA 38 ? A ALA 38 39 1 Y 1 A SER 39 ? A SER 39 40 1 Y 1 A PRO 40 ? A PRO 40 41 1 Y 1 A ASN 41 ? A ASN 41 42 1 Y 1 A PRO 42 ? A PRO 42 43 1 Y 1 A SER 43 ? A SER 43 44 1 Y 1 A ASP 44 ? A ASP 44 45 1 Y 1 A SER 45 ? A SER 45 46 1 Y 1 A PRO 46 ? A PRO 46 47 1 Y 1 A ASN 47 ? A ASN 47 48 1 Y 1 A PRO 48 ? A PRO 48 49 1 Y 1 A SER 49 ? A SER 49 50 1 Y 1 A ASP 50 ? A ASP 50 51 1 Y 1 A SER 51 ? A SER 51 52 1 Y 1 A PRO 52 ? A PRO 52 53 1 Y 1 A ASN 53 ? A ASN 53 54 1 Y 1 A PRO 54 ? A PRO 54 55 1 Y 1 A PRO 55 ? A PRO 55 56 1 Y 1 A ALA 56 ? A ALA 56 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 IPA C1 C N N 169 IPA C2 C N N 170 IPA C3 C N N 171 IPA O2 O N N 172 IPA H11 H N N 173 IPA H12 H N N 174 IPA H13 H N N 175 IPA H2 H N N 176 IPA H31 H N N 177 IPA H32 H N N 178 IPA H33 H N N 179 IPA HO2 H N N 180 LEU N N N N 181 LEU CA C N S 182 LEU C C N N 183 LEU O O N N 184 LEU CB C N N 185 LEU CG C N N 186 LEU CD1 C N N 187 LEU CD2 C N N 188 LEU OXT O N N 189 LEU H H N N 190 LEU H2 H N N 191 LEU HA H N N 192 LEU HB2 H N N 193 LEU HB3 H N N 194 LEU HG H N N 195 LEU HD11 H N N 196 LEU HD12 H N N 197 LEU HD13 H N N 198 LEU HD21 H N N 199 LEU HD22 H N N 200 LEU HD23 H N N 201 LEU HXT H N N 202 LYS N N N N 203 LYS CA C N S 204 LYS C C N N 205 LYS O O N N 206 LYS CB C N N 207 LYS CG C N N 208 LYS CD C N N 209 LYS CE C N N 210 LYS NZ N N N 211 LYS OXT O N N 212 LYS H H N N 213 LYS H2 H N N 214 LYS HA H N N 215 LYS HB2 H N N 216 LYS HB3 H N N 217 LYS HG2 H N N 218 LYS HG3 H N N 219 LYS HD2 H N N 220 LYS HD3 H N N 221 LYS HE2 H N N 222 LYS HE3 H N N 223 LYS HZ1 H N N 224 LYS HZ2 H N N 225 LYS HZ3 H N N 226 LYS HXT H N N 227 MET N N N N 228 MET CA C N S 229 MET C C N N 230 MET O O N N 231 MET CB C N N 232 MET CG C N N 233 MET SD S N N 234 MET CE C N N 235 MET OXT O N N 236 MET H H N N 237 MET H2 H N N 238 MET HA H N N 239 MET HB2 H N N 240 MET HB3 H N N 241 MET HG2 H N N 242 MET HG3 H N N 243 MET HE1 H N N 244 MET HE2 H N N 245 MET HE3 H N N 246 MET HXT H N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 TRP N N N N 319 TRP CA C N S 320 TRP C C N N 321 TRP O O N N 322 TRP CB C N N 323 TRP CG C Y N 324 TRP CD1 C Y N 325 TRP CD2 C Y N 326 TRP NE1 N Y N 327 TRP CE2 C Y N 328 TRP CE3 C Y N 329 TRP CZ2 C Y N 330 TRP CZ3 C Y N 331 TRP CH2 C Y N 332 TRP OXT O N N 333 TRP H H N N 334 TRP H2 H N N 335 TRP HA H N N 336 TRP HB2 H N N 337 TRP HB3 H N N 338 TRP HD1 H N N 339 TRP HE1 H N N 340 TRP HE3 H N N 341 TRP HZ2 H N N 342 TRP HZ3 H N N 343 TRP HH2 H N N 344 TRP HXT H N N 345 TYR N N N N 346 TYR CA C N S 347 TYR C C N N 348 TYR O O N N 349 TYR CB C N N 350 TYR CG C Y N 351 TYR CD1 C Y N 352 TYR CD2 C Y N 353 TYR CE1 C Y N 354 TYR CE2 C Y N 355 TYR CZ C Y N 356 TYR OH O N N 357 TYR OXT O N N 358 TYR H H N N 359 TYR H2 H N N 360 TYR HA H N N 361 TYR HB2 H N N 362 TYR HB3 H N N 363 TYR HD1 H N N 364 TYR HD2 H N N 365 TYR HE1 H N N 366 TYR HE2 H N N 367 TYR HH H N N 368 TYR HXT H N N 369 U07 C01 C N N 370 U07 C02 C N N 371 U07 C03 C Y N 372 U07 C04 C Y N 373 U07 C05 C Y N 374 U07 C06 C Y N 375 U07 C07 C Y N 376 U07 C08 C Y N 377 U07 C09 C N N 378 U07 C10 C N N 379 U07 C11 C N N 380 U07 C12 C Y N 381 U07 C13 C Y N 382 U07 C14 C Y N 383 U07 C15 C Y N 384 U07 C16 C Y N 385 U07 C17 C Y N 386 U07 C18 C N S 387 U07 O01 O N N 388 U07 O02 O N N 389 U07 O03 O N N 390 U07 O04 O N N 391 U07 H3 H N N 392 U07 H4 H N N 393 U07 H5 H N N 394 U07 H6 H N N 395 U07 H7 H N N 396 U07 H10 H N N 397 U07 H11 H N N 398 U07 H12 H N N 399 U07 H13 H N N 400 U07 H14 H N N 401 U07 H15 H N N 402 U07 H16 H N N 403 U07 H17 H N N 404 U07 H18 H N N 405 VAL N N N N 406 VAL CA C N S 407 VAL C C N N 408 VAL O O N N 409 VAL CB C N N 410 VAL CG1 C N N 411 VAL CG2 C N N 412 VAL OXT O N N 413 VAL H H N N 414 VAL H2 H N N 415 VAL HA H N N 416 VAL HB H N N 417 VAL HG11 H N N 418 VAL HG12 H N N 419 VAL HG13 H N N 420 VAL HG21 H N N 421 VAL HG22 H N N 422 VAL HG23 H N N 423 VAL HXT H N N 424 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 IPA C1 C2 sing N N 160 IPA C1 H11 sing N N 161 IPA C1 H12 sing N N 162 IPA C1 H13 sing N N 163 IPA C2 C3 sing N N 164 IPA C2 O2 sing N N 165 IPA C2 H2 sing N N 166 IPA C3 H31 sing N N 167 IPA C3 H32 sing N N 168 IPA C3 H33 sing N N 169 IPA O2 HO2 sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 U07 C14 C13 doub Y N 356 U07 C14 C15 sing Y N 357 U07 C13 C12 sing Y N 358 U07 C15 C16 doub Y N 359 U07 C07 C08 doub Y N 360 U07 C07 C06 sing Y N 361 U07 C08 C03 sing Y N 362 U07 C12 C11 sing N N 363 U07 C12 C17 doub Y N 364 U07 C16 C17 sing Y N 365 U07 C06 C05 doub Y N 366 U07 C10 C09 sing N N 367 U07 C10 C11 doub N N 368 U07 C10 O03 sing N N 369 U07 O02 C09 doub N N 370 U07 C09 C02 sing N N 371 U07 C03 C02 sing N N 372 U07 C03 C04 doub Y N 373 U07 C02 C01 doub N N 374 U07 C11 C18 sing N N 375 U07 C18 C01 sing N N 376 U07 C18 O04 sing N N 377 U07 C05 C04 sing Y N 378 U07 C01 O01 sing N N 379 U07 C04 H3 sing N N 380 U07 C05 H4 sing N N 381 U07 C06 H5 sing N N 382 U07 C07 H6 sing N N 383 U07 C08 H7 sing N N 384 U07 C13 H10 sing N N 385 U07 C14 H11 sing N N 386 U07 C15 H12 sing N N 387 U07 C16 H13 sing N N 388 U07 C17 H14 sing N N 389 U07 C18 H15 sing N N 390 U07 O01 H16 sing N N 391 U07 O03 H17 sing N N 392 U07 O04 H18 sing N N 393 VAL N CA sing N N 394 VAL N H sing N N 395 VAL N H2 sing N N 396 VAL CA C sing N N 397 VAL CA CB sing N N 398 VAL CA HA sing N N 399 VAL C O doub N N 400 VAL C OXT sing N N 401 VAL CB CG1 sing N N 402 VAL CB CG2 sing N N 403 VAL CB HB sing N N 404 VAL CG1 HG11 sing N N 405 VAL CG1 HG12 sing N N 406 VAL CG1 HG13 sing N N 407 VAL CG2 HG21 sing N N 408 VAL CG2 HG22 sing N N 409 VAL CG2 HG23 sing N N 410 VAL OXT HXT sing N N 411 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id U07 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id U07 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(2~5~S)-2~3~,2~5~,2~6~-trihydroxy[1~1~,2~1~:2~4~,3~1~-terphenyl]-2~2~(2~5~H)-one' U07 3 'ISOPROPYL ALCOHOL' IPA 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6D34 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #