data_6XPG # _entry.id 6XPG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6XPG pdb_00006xpg 10.2210/pdb6xpg/pdb WWPDB D_1000250417 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 6NJC unspecified TargetTrack . apc113151 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6XPG _pdbx_database_status.recvd_initial_deposition_date 2020-07-08 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kim, Y.' 1 ? 'Sherrell, D.A.' 2 ? 'Owen, R.' 3 ? 'Axford, D.' 4 ? 'Ebrahim, A.' 5 ? 'Johnson, J.' 6 ? 'Welk, L.' 7 ? 'Babnigg, G.' 8 ? 'Joachimiak, A.' 9 ? 'Midwest Center for Structural Genomics (MCSG)' 10 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal Structure of Sialate O-acetylesterase from Bacteroides vulgatus by Serial Crystallography' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, Y.' 1 ? primary 'Sherrell, D.A.' 2 ? primary 'Owen, R.' 3 ? primary 'Axford, D.' 4 ? primary 'Ebrahim, A.' 5 ? primary 'Johnson, J.' 6 ? primary 'Welk, L.' 7 ? primary 'Babnigg, G.' 8 ? primary 'Joachimiak, A.' 9 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6XPG _cell.details ? _cell.formula_units_Z ? _cell.length_a 102.533 _cell.length_a_esd ? _cell.length_b 102.533 _cell.length_b_esd ? _cell.length_c 103.042 _cell.length_c_esd ? _cell.volume 938149.908 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6XPG _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall 'P 65 2 (x,y,z+1/12)' _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Lysophospholipase L1' 23158.023 1 3.-.-.- ? ? ? 2 water nat water 18.015 58 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Sialate O-acetylesterase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SNAERKYSTFYEQRATLFEELPVTSKDIIFLGNSITNGCEWAELFQNKNVKNRGISGDIC(MSE)GVYDRLDPIVKGKPA KIFLLIGINDVSRGTSADKIISEIS(MSE)IVRKIKQESPKTKLYLQSVLPVNDCYG(MSE)FNGHTSRWQVVKQINDLL EPLAVKEGVAYIDLYSHFVEKETGK(MSE)NPVYTNDGLHLLGKGYLLWRDIVKPYVD ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAERKYSTFYEQRATLFEELPVTSKDIIFLGNSITNGCEWAELFQNKNVKNRGISGDICMGVYDRLDPIVKGKPAKIFL LIGINDVSRGTSADKIISEISMIVRKIKQESPKTKLYLQSVLPVNDCYGMFNGHTSRWQVVKQINDLLEPLAVKEGVAYI DLYSHFVEKETGKMNPVYTNDGLHLLGKGYLLWRDIVKPYVD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier apc113151 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 GLU n 1 5 ARG n 1 6 LYS n 1 7 TYR n 1 8 SER n 1 9 THR n 1 10 PHE n 1 11 TYR n 1 12 GLU n 1 13 GLN n 1 14 ARG n 1 15 ALA n 1 16 THR n 1 17 LEU n 1 18 PHE n 1 19 GLU n 1 20 GLU n 1 21 LEU n 1 22 PRO n 1 23 VAL n 1 24 THR n 1 25 SER n 1 26 LYS n 1 27 ASP n 1 28 ILE n 1 29 ILE n 1 30 PHE n 1 31 LEU n 1 32 GLY n 1 33 ASN n 1 34 SER n 1 35 ILE n 1 36 THR n 1 37 ASN n 1 38 GLY n 1 39 CYS n 1 40 GLU n 1 41 TRP n 1 42 ALA n 1 43 GLU n 1 44 LEU n 1 45 PHE n 1 46 GLN n 1 47 ASN n 1 48 LYS n 1 49 ASN n 1 50 VAL n 1 51 LYS n 1 52 ASN n 1 53 ARG n 1 54 GLY n 1 55 ILE n 1 56 SER n 1 57 GLY n 1 58 ASP n 1 59 ILE n 1 60 CYS n 1 61 MSE n 1 62 GLY n 1 63 VAL n 1 64 TYR n 1 65 ASP n 1 66 ARG n 1 67 LEU n 1 68 ASP n 1 69 PRO n 1 70 ILE n 1 71 VAL n 1 72 LYS n 1 73 GLY n 1 74 LYS n 1 75 PRO n 1 76 ALA n 1 77 LYS n 1 78 ILE n 1 79 PHE n 1 80 LEU n 1 81 LEU n 1 82 ILE n 1 83 GLY n 1 84 ILE n 1 85 ASN n 1 86 ASP n 1 87 VAL n 1 88 SER n 1 89 ARG n 1 90 GLY n 1 91 THR n 1 92 SER n 1 93 ALA n 1 94 ASP n 1 95 LYS n 1 96 ILE n 1 97 ILE n 1 98 SER n 1 99 GLU n 1 100 ILE n 1 101 SER n 1 102 MSE n 1 103 ILE n 1 104 VAL n 1 105 ARG n 1 106 LYS n 1 107 ILE n 1 108 LYS n 1 109 GLN n 1 110 GLU n 1 111 SER n 1 112 PRO n 1 113 LYS n 1 114 THR n 1 115 LYS n 1 116 LEU n 1 117 TYR n 1 118 LEU n 1 119 GLN n 1 120 SER n 1 121 VAL n 1 122 LEU n 1 123 PRO n 1 124 VAL n 1 125 ASN n 1 126 ASP n 1 127 CYS n 1 128 TYR n 1 129 GLY n 1 130 MSE n 1 131 PHE n 1 132 ASN n 1 133 GLY n 1 134 HIS n 1 135 THR n 1 136 SER n 1 137 ARG n 1 138 TRP n 1 139 GLN n 1 140 VAL n 1 141 VAL n 1 142 LYS n 1 143 GLN n 1 144 ILE n 1 145 ASN n 1 146 ASP n 1 147 LEU n 1 148 LEU n 1 149 GLU n 1 150 PRO n 1 151 LEU n 1 152 ALA n 1 153 VAL n 1 154 LYS n 1 155 GLU n 1 156 GLY n 1 157 VAL n 1 158 ALA n 1 159 TYR n 1 160 ILE n 1 161 ASP n 1 162 LEU n 1 163 TYR n 1 164 SER n 1 165 HIS n 1 166 PHE n 1 167 VAL n 1 168 GLU n 1 169 LYS n 1 170 GLU n 1 171 THR n 1 172 GLY n 1 173 LYS n 1 174 MSE n 1 175 ASN n 1 176 PRO n 1 177 VAL n 1 178 TYR n 1 179 THR n 1 180 ASN n 1 181 ASP n 1 182 GLY n 1 183 LEU n 1 184 HIS n 1 185 LEU n 1 186 LEU n 1 187 GLY n 1 188 LYS n 1 189 GLY n 1 190 TYR n 1 191 LEU n 1 192 LEU n 1 193 TRP n 1 194 ARG n 1 195 ASP n 1 196 ILE n 1 197 VAL n 1 198 LYS n 1 199 PRO n 1 200 TYR n 1 201 VAL n 1 202 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 202 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ;DW857_02595, DW869_04095, DWX04_04065, DWZ06_04430, DXA04_10705, EAJ12_11850, ERS852457_01148, ERS852509_00617, ERS852556_01195, SAMN04487923_100221 ; _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacteroides vulgatus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 821 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 8482 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant Gold _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A174J845_BACVU _struct_ref.pdbx_db_accession A0A174J845 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ERKYSTFYEQRATLFEELPVTSKDIIFLGNSITNGCEWAELFQNKNVKNRGISGDICMGVYDRLDPIVKGKPAKIFLLIG INDVSRGTSADKIISEISMIVRKIKQESPKTKLYLQSVLPVNDCYGMFNGHTSRWQVVKQINDLLEPLAVKEGVAYIDLY SHFVEKETGKMNPVYTNDGLHLLGKGYLLWRDIVKPYVD ; _struct_ref.pdbx_align_begin 21 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6XPG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 202 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A174J845 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 219 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 22 _struct_ref_seq.pdbx_auth_seq_align_end 220 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6XPG SER A 1 ? UNP A0A174J845 ? ? 'expression tag' 19 1 1 6XPG ASN A 2 ? UNP A0A174J845 ? ? 'expression tag' 20 2 1 6XPG ALA A 3 ? UNP A0A174J845 ? ? 'expression tag' 21 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6XPG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.40 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 63.85 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'BATCH MODE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M lithium sulfate, 0.1 M acetate, pH 4.5, 2.5 M sodium chloride' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 295 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment Y # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-10-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'double crystal Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9686 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I24' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9686 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I24 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 15.29 _reflns.entry_id 6XPG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.9 _reflns.d_resolution_low 45.91 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 25754 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 97.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 2.22 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.982 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.90 _reflns_shell.d_res_low 1.93 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.45 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1256 _reflns_shell.percent_possible_all 99.3 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.85 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.288 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 23.42 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6XPG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.90 _refine.ls_d_res_low 45.90 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 25744 _refine.ls_number_reflns_R_free 1319 _refine.ls_number_reflns_R_work 24425 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.92 _refine.ls_percent_reflns_R_free 5.12 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2076 _refine.ls_R_factor_R_free 0.2423 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2056 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 6NJC' _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.3666 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2563 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.90 _refine_hist.d_res_low 45.90 _refine_hist.number_atoms_solvent 58 _refine_hist.number_atoms_total 1645 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1587 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0059 ? 1620 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.7357 ? 2189 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0495 ? 244 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0039 ? 276 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.3207 ? 610 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.90 1.98 . . 135 2648 99.29 . . . 0.3506 . 0.3364 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.98 2.07 . . 130 2667 100.00 . . . 0.3294 . 0.3055 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.07 2.17 . . 125 2678 100.00 . . . 0.3258 . 0.2776 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.17 2.31 . . 151 2675 100.00 . . . 0.3015 . 0.2432 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.31 2.49 . . 152 2673 100.00 . . . 0.3083 . 0.2291 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.49 2.74 . . 145 2709 100.00 . . . 0.2598 . 0.2266 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.74 3.14 . . 154 2697 99.96 . . . 0.2599 . 0.2082 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.14 3.95 . . 163 2764 100.00 . . . 0.1997 . 0.1507 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.95 45.90 . . 164 2914 100.00 . . . 0.1490 . 0.1274 . . . . . . . . . . . # _struct.entry_id 6XPG _struct.title 'Crystal Structure of Sialate O-acetylesterase from Bacteroides vulgatus by Serial Crystallography' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6XPG _struct_keywords.text ;Sialate O-acetylesterase, alpha-beta fold, Serial Crystallography, Structural Genomics, Midwest Center for Structural Genomics, PSI-Biology, MCSG, HYDROLASE ; _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 5 ? LEU A 21 ? ARG A 23 LEU A 39 1 ? 17 HELX_P HELX_P2 AA2 ASN A 33 ? GLY A 38 ? ASN A 51 GLY A 56 1 ? 6 HELX_P HELX_P3 AA3 GLU A 40 ? GLN A 46 ? GLU A 58 GLN A 64 1 ? 7 HELX_P HELX_P4 AA4 ILE A 59 ? ARG A 66 ? ILE A 77 ARG A 84 1 ? 8 HELX_P HELX_P5 AA5 LEU A 67 ? LYS A 72 ? LEU A 85 LYS A 90 1 ? 6 HELX_P HELX_P6 AA6 GLY A 83 ? ARG A 89 ? GLY A 101 ARG A 107 1 ? 7 HELX_P HELX_P7 AA7 SER A 92 ? SER A 111 ? SER A 110 SER A 129 1 ? 20 HELX_P HELX_P8 AA8 PHE A 131 ? SER A 136 ? PHE A 149 SER A 154 1 ? 6 HELX_P HELX_P9 AA9 GLN A 139 ? GLY A 156 ? GLN A 157 GLY A 174 1 ? 18 HELX_P HELX_P10 AB1 LEU A 162 ? VAL A 167 ? LEU A 180 VAL A 185 1 ? 6 HELX_P HELX_P11 AB2 ASN A 175 ? THR A 179 ? ASN A 193 THR A 197 5 ? 5 HELX_P HELX_P12 AB3 LEU A 186 ? ASP A 202 ? LEU A 204 ASP A 220 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A CYS 60 C ? ? ? 1_555 A MSE 61 N ? ? A CYS 78 A MSE 79 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale2 covale both ? A MSE 61 C ? ? ? 1_555 A GLY 62 N ? ? A MSE 79 A GLY 80 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale3 covale both ? A SER 101 C ? ? ? 1_555 A MSE 102 N ? ? A SER 119 A MSE 120 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale4 covale both ? A MSE 102 C ? ? ? 1_555 A ILE 103 N ? ? A MSE 120 A ILE 121 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale5 covale both ? A GLY 129 C ? ? ? 1_555 A MSE 130 N ? ? A GLY 147 A MSE 148 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale6 covale both ? A MSE 130 C ? ? ? 1_555 A PHE 131 N ? ? A MSE 148 A PHE 149 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale7 covale both ? A LYS 173 C ? ? ? 1_555 A MSE 174 N ? ? A LYS 191 A MSE 192 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale8 covale both ? A MSE 174 C ? ? ? 1_555 A ASN 175 N ? ? A MSE 192 A ASN 193 1_555 ? ? ? ? ? ? ? 1.315 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 50 ? GLY A 54 ? VAL A 68 GLY A 72 AA1 2 ILE A 28 ? GLY A 32 ? ILE A 46 GLY A 50 AA1 3 LYS A 77 ? LEU A 81 ? LYS A 95 LEU A 99 AA1 4 LYS A 115 ? GLN A 119 ? LYS A 133 GLN A 137 AA1 5 ALA A 158 ? ILE A 160 ? ALA A 176 ILE A 178 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LYS A 51 ? O LYS A 69 N ILE A 28 ? N ILE A 46 AA1 2 3 N ILE A 29 ? N ILE A 47 O PHE A 79 ? O PHE A 97 AA1 3 4 N ILE A 78 ? N ILE A 96 O TYR A 117 ? O TYR A 135 AA1 4 5 N LEU A 118 ? N LEU A 136 O ALA A 158 ? O ALA A 176 # _atom_sites.entry_id 6XPG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009753 _atom_sites.fract_transf_matrix[1][2] 0.005631 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011262 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009705 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? NA ? ? 9.38062 1.54875 ? ? 3.38349 72.32734 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? SE ? ? 26.02326 7.89457 ? ? 1.54240 29.12501 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 19 ? ? ? A . n A 1 2 ASN 2 20 ? ? ? A . n A 1 3 ALA 3 21 ? ? ? A . n A 1 4 GLU 4 22 ? ? ? A . n A 1 5 ARG 5 23 23 ARG ARG A . n A 1 6 LYS 6 24 24 LYS LYS A . n A 1 7 TYR 7 25 25 TYR TYR A . n A 1 8 SER 8 26 26 SER SER A . n A 1 9 THR 9 27 27 THR THR A . n A 1 10 PHE 10 28 28 PHE PHE A . n A 1 11 TYR 11 29 29 TYR TYR A . n A 1 12 GLU 12 30 30 GLU GLU A . n A 1 13 GLN 13 31 31 GLN GLN A . n A 1 14 ARG 14 32 32 ARG ARG A . n A 1 15 ALA 15 33 33 ALA ALA A . n A 1 16 THR 16 34 34 THR THR A . n A 1 17 LEU 17 35 35 LEU LEU A . n A 1 18 PHE 18 36 36 PHE PHE A . n A 1 19 GLU 19 37 37 GLU GLU A . n A 1 20 GLU 20 38 38 GLU GLU A . n A 1 21 LEU 21 39 39 LEU LEU A . n A 1 22 PRO 22 40 40 PRO PRO A . n A 1 23 VAL 23 41 41 VAL VAL A . n A 1 24 THR 24 42 42 THR THR A . n A 1 25 SER 25 43 43 SER SER A . n A 1 26 LYS 26 44 44 LYS LYS A . n A 1 27 ASP 27 45 45 ASP ASP A . n A 1 28 ILE 28 46 46 ILE ILE A . n A 1 29 ILE 29 47 47 ILE ILE A . n A 1 30 PHE 30 48 48 PHE PHE A . n A 1 31 LEU 31 49 49 LEU LEU A . n A 1 32 GLY 32 50 50 GLY GLY A . n A 1 33 ASN 33 51 51 ASN ASN A . n A 1 34 SER 34 52 52 SER SER A . n A 1 35 ILE 35 53 53 ILE ILE A . n A 1 36 THR 36 54 54 THR THR A . n A 1 37 ASN 37 55 55 ASN ASN A . n A 1 38 GLY 38 56 56 GLY GLY A . n A 1 39 CYS 39 57 57 CYS CYS A . n A 1 40 GLU 40 58 58 GLU GLU A . n A 1 41 TRP 41 59 59 TRP TRP A . n A 1 42 ALA 42 60 60 ALA ALA A . n A 1 43 GLU 43 61 61 GLU GLU A . n A 1 44 LEU 44 62 62 LEU LEU A . n A 1 45 PHE 45 63 63 PHE PHE A . n A 1 46 GLN 46 64 64 GLN GLN A . n A 1 47 ASN 47 65 65 ASN ASN A . n A 1 48 LYS 48 66 66 LYS LYS A . n A 1 49 ASN 49 67 67 ASN ASN A . n A 1 50 VAL 50 68 68 VAL VAL A . n A 1 51 LYS 51 69 69 LYS LYS A . n A 1 52 ASN 52 70 70 ASN ASN A . n A 1 53 ARG 53 71 71 ARG ARG A . n A 1 54 GLY 54 72 72 GLY GLY A . n A 1 55 ILE 55 73 73 ILE ILE A . n A 1 56 SER 56 74 74 SER SER A . n A 1 57 GLY 57 75 75 GLY GLY A . n A 1 58 ASP 58 76 76 ASP ASP A . n A 1 59 ILE 59 77 77 ILE ILE A . n A 1 60 CYS 60 78 78 CYS CYS A . n A 1 61 MSE 61 79 79 MSE MSE A . n A 1 62 GLY 62 80 80 GLY GLY A . n A 1 63 VAL 63 81 81 VAL VAL A . n A 1 64 TYR 64 82 82 TYR TYR A . n A 1 65 ASP 65 83 83 ASP ASP A . n A 1 66 ARG 66 84 84 ARG ARG A . n A 1 67 LEU 67 85 85 LEU LEU A . n A 1 68 ASP 68 86 86 ASP ASP A . n A 1 69 PRO 69 87 87 PRO PRO A . n A 1 70 ILE 70 88 88 ILE ILE A . n A 1 71 VAL 71 89 89 VAL VAL A . n A 1 72 LYS 72 90 90 LYS LYS A . n A 1 73 GLY 73 91 91 GLY GLY A . n A 1 74 LYS 74 92 92 LYS LYS A . n A 1 75 PRO 75 93 93 PRO PRO A . n A 1 76 ALA 76 94 94 ALA ALA A . n A 1 77 LYS 77 95 95 LYS LYS A . n A 1 78 ILE 78 96 96 ILE ILE A . n A 1 79 PHE 79 97 97 PHE PHE A . n A 1 80 LEU 80 98 98 LEU LEU A . n A 1 81 LEU 81 99 99 LEU LEU A . n A 1 82 ILE 82 100 100 ILE ILE A . n A 1 83 GLY 83 101 101 GLY GLY A . n A 1 84 ILE 84 102 102 ILE ILE A . n A 1 85 ASN 85 103 103 ASN ASN A . n A 1 86 ASP 86 104 104 ASP ASP A . n A 1 87 VAL 87 105 105 VAL VAL A . n A 1 88 SER 88 106 106 SER SER A . n A 1 89 ARG 89 107 107 ARG ARG A . n A 1 90 GLY 90 108 108 GLY GLY A . n A 1 91 THR 91 109 109 THR THR A . n A 1 92 SER 92 110 110 SER SER A . n A 1 93 ALA 93 111 111 ALA ALA A . n A 1 94 ASP 94 112 112 ASP ASP A . n A 1 95 LYS 95 113 113 LYS LYS A . n A 1 96 ILE 96 114 114 ILE ILE A . n A 1 97 ILE 97 115 115 ILE ILE A . n A 1 98 SER 98 116 116 SER SER A . n A 1 99 GLU 99 117 117 GLU GLU A . n A 1 100 ILE 100 118 118 ILE ILE A . n A 1 101 SER 101 119 119 SER SER A . n A 1 102 MSE 102 120 120 MSE MSE A . n A 1 103 ILE 103 121 121 ILE ILE A . n A 1 104 VAL 104 122 122 VAL VAL A . n A 1 105 ARG 105 123 123 ARG ARG A . n A 1 106 LYS 106 124 124 LYS LYS A . n A 1 107 ILE 107 125 125 ILE ILE A . n A 1 108 LYS 108 126 126 LYS LYS A . n A 1 109 GLN 109 127 127 GLN GLN A . n A 1 110 GLU 110 128 128 GLU GLU A . n A 1 111 SER 111 129 129 SER SER A . n A 1 112 PRO 112 130 130 PRO PRO A . n A 1 113 LYS 113 131 131 LYS LYS A . n A 1 114 THR 114 132 132 THR THR A . n A 1 115 LYS 115 133 133 LYS LYS A . n A 1 116 LEU 116 134 134 LEU LEU A . n A 1 117 TYR 117 135 135 TYR TYR A . n A 1 118 LEU 118 136 136 LEU LEU A . n A 1 119 GLN 119 137 137 GLN GLN A . n A 1 120 SER 120 138 138 SER SER A . n A 1 121 VAL 121 139 139 VAL VAL A . n A 1 122 LEU 122 140 140 LEU LEU A . n A 1 123 PRO 123 141 141 PRO PRO A . n A 1 124 VAL 124 142 142 VAL VAL A . n A 1 125 ASN 125 143 143 ASN ASN A . n A 1 126 ASP 126 144 144 ASP ASP A . n A 1 127 CYS 127 145 145 CYS CYS A . n A 1 128 TYR 128 146 146 TYR TYR A . n A 1 129 GLY 129 147 147 GLY GLY A . n A 1 130 MSE 130 148 148 MSE MSE A . n A 1 131 PHE 131 149 149 PHE PHE A . n A 1 132 ASN 132 150 150 ASN ASN A . n A 1 133 GLY 133 151 151 GLY GLY A . n A 1 134 HIS 134 152 152 HIS HIS A . n A 1 135 THR 135 153 153 THR THR A . n A 1 136 SER 136 154 154 SER SER A . n A 1 137 ARG 137 155 155 ARG ARG A . n A 1 138 TRP 138 156 156 TRP TRP A . n A 1 139 GLN 139 157 157 GLN GLN A . n A 1 140 VAL 140 158 158 VAL VAL A . n A 1 141 VAL 141 159 159 VAL VAL A . n A 1 142 LYS 142 160 160 LYS LYS A . n A 1 143 GLN 143 161 161 GLN GLN A . n A 1 144 ILE 144 162 162 ILE ILE A . n A 1 145 ASN 145 163 163 ASN ASN A . n A 1 146 ASP 146 164 164 ASP ASP A . n A 1 147 LEU 147 165 165 LEU LEU A . n A 1 148 LEU 148 166 166 LEU LEU A . n A 1 149 GLU 149 167 167 GLU GLU A . n A 1 150 PRO 150 168 168 PRO PRO A . n A 1 151 LEU 151 169 169 LEU LEU A . n A 1 152 ALA 152 170 170 ALA ALA A . n A 1 153 VAL 153 171 171 VAL VAL A . n A 1 154 LYS 154 172 172 LYS LYS A . n A 1 155 GLU 155 173 173 GLU GLU A . n A 1 156 GLY 156 174 174 GLY GLY A . n A 1 157 VAL 157 175 175 VAL VAL A . n A 1 158 ALA 158 176 176 ALA ALA A . n A 1 159 TYR 159 177 177 TYR TYR A . n A 1 160 ILE 160 178 178 ILE ILE A . n A 1 161 ASP 161 179 179 ASP ASP A . n A 1 162 LEU 162 180 180 LEU LEU A . n A 1 163 TYR 163 181 181 TYR TYR A . n A 1 164 SER 164 182 182 SER SER A . n A 1 165 HIS 165 183 183 HIS HIS A . n A 1 166 PHE 166 184 184 PHE PHE A . n A 1 167 VAL 167 185 185 VAL VAL A . n A 1 168 GLU 168 186 186 GLU GLU A . n A 1 169 LYS 169 187 187 LYS LYS A . n A 1 170 GLU 170 188 188 GLU GLU A . n A 1 171 THR 171 189 189 THR THR A . n A 1 172 GLY 172 190 190 GLY GLY A . n A 1 173 LYS 173 191 191 LYS LYS A . n A 1 174 MSE 174 192 192 MSE MSE A . n A 1 175 ASN 175 193 193 ASN ASN A . n A 1 176 PRO 176 194 194 PRO PRO A . n A 1 177 VAL 177 195 195 VAL VAL A . n A 1 178 TYR 178 196 196 TYR TYR A . n A 1 179 THR 179 197 197 THR THR A . n A 1 180 ASN 180 198 198 ASN ASN A . n A 1 181 ASP 181 199 199 ASP ASP A . n A 1 182 GLY 182 200 200 GLY GLY A . n A 1 183 LEU 183 201 201 LEU LEU A . n A 1 184 HIS 184 202 202 HIS HIS A . n A 1 185 LEU 185 203 203 LEU LEU A . n A 1 186 LEU 186 204 204 LEU LEU A . n A 1 187 GLY 187 205 205 GLY GLY A . n A 1 188 LYS 188 206 206 LYS LYS A . n A 1 189 GLY 189 207 207 GLY GLY A . n A 1 190 TYR 190 208 208 TYR TYR A . n A 1 191 LEU 191 209 209 LEU LEU A . n A 1 192 LEU 192 210 210 LEU LEU A . n A 1 193 TRP 193 211 211 TRP TRP A . n A 1 194 ARG 194 212 212 ARG ARG A . n A 1 195 ASP 195 213 213 ASP ASP A . n A 1 196 ILE 196 214 214 ILE ILE A . n A 1 197 VAL 197 215 215 VAL VAL A . n A 1 198 LYS 198 216 216 LYS LYS A . n A 1 199 PRO 199 217 217 PRO PRO A . n A 1 200 TYR 200 218 218 TYR TYR A . n A 1 201 VAL 201 219 219 VAL VAL A . n A 1 202 ASP 202 220 220 ASP ASP A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name PSI:Biology _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 1 HOH HOH A . B 2 HOH 2 302 4 HOH HOH A . B 2 HOH 3 303 18 HOH HOH A . B 2 HOH 4 304 40 HOH HOH A . B 2 HOH 5 305 52 HOH HOH A . B 2 HOH 6 306 9 HOH HOH A . B 2 HOH 7 307 41 HOH HOH A . B 2 HOH 8 308 22 HOH HOH A . B 2 HOH 9 309 39 HOH HOH A . B 2 HOH 10 310 25 HOH HOH A . B 2 HOH 11 311 20 HOH HOH A . B 2 HOH 12 312 7 HOH HOH A . B 2 HOH 13 313 24 HOH HOH A . B 2 HOH 14 314 8 HOH HOH A . B 2 HOH 15 315 45 HOH HOH A . B 2 HOH 16 316 48 HOH HOH A . B 2 HOH 17 317 42 HOH HOH A . B 2 HOH 18 318 11 HOH HOH A . B 2 HOH 19 319 44 HOH HOH A . B 2 HOH 20 320 2 HOH HOH A . B 2 HOH 21 321 33 HOH HOH A . B 2 HOH 22 322 46 HOH HOH A . B 2 HOH 23 323 55 HOH HOH A . B 2 HOH 24 324 35 HOH HOH A . B 2 HOH 25 325 23 HOH HOH A . B 2 HOH 26 326 19 HOH HOH A . B 2 HOH 27 327 14 HOH HOH A . B 2 HOH 28 328 51 HOH HOH A . B 2 HOH 29 329 50 HOH HOH A . B 2 HOH 30 330 36 HOH HOH A . B 2 HOH 31 331 26 HOH HOH A . B 2 HOH 32 332 6 HOH HOH A . B 2 HOH 33 333 56 HOH HOH A . B 2 HOH 34 334 29 HOH HOH A . B 2 HOH 35 335 34 HOH HOH A . B 2 HOH 36 336 31 HOH HOH A . B 2 HOH 37 337 10 HOH HOH A . B 2 HOH 38 338 5 HOH HOH A . B 2 HOH 39 339 3 HOH HOH A . B 2 HOH 40 340 15 HOH HOH A . B 2 HOH 41 341 17 HOH HOH A . B 2 HOH 42 342 54 HOH HOH A . B 2 HOH 43 343 37 HOH HOH A . B 2 HOH 44 344 38 HOH HOH A . B 2 HOH 45 345 27 HOH HOH A . B 2 HOH 46 346 30 HOH HOH A . B 2 HOH 47 347 12 HOH HOH A . B 2 HOH 48 348 47 HOH HOH A . B 2 HOH 49 349 13 HOH HOH A . B 2 HOH 50 350 53 HOH HOH A . B 2 HOH 51 351 16 HOH HOH A . B 2 HOH 52 352 43 HOH HOH A . B 2 HOH 53 353 32 HOH HOH A . B 2 HOH 54 354 49 HOH HOH A . B 2 HOH 55 355 57 HOH HOH A . B 2 HOH 56 356 21 HOH HOH A . B 2 HOH 57 357 58 HOH HOH A . B 2 HOH 58 358 28 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 61 A MSE 79 ? MET 'modified residue' 2 A MSE 102 A MSE 120 ? MET 'modified residue' 3 A MSE 130 A MSE 148 ? MET 'modified residue' 4 A MSE 174 A MSE 192 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2720 ? 1 MORE -16 ? 1 'SSA (A^2)' 15930 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_554 x,x-y,-z-1/6 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -17.1736666667 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-07-15 2 'Structure model' 1 1 2020-12-23 3 'Structure model' 1 2 2023-10-18 4 'Structure model' 1 3 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' 6 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_audit_author.name' 2 2 'Structure model' '_citation_author.name' 3 3 'Structure model' '_database_2.pdbx_DOI' 4 3 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_chem_comp_atom.atom_id' 6 4 'Structure model' '_chem_comp_bond.atom_id_2' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+5/6 3 y,-x+y,z+1/6 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 x-y,-y,-z 7 -x,-x+y,-z+1/3 8 -x,-y,z+1/2 9 y,x,-z+2/3 10 -y,-x,-z+1/6 11 -x+y,y,-z+1/2 12 x,x-y,-z+5/6 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 33.1202134465 7.71872758743 -4.37020845991 0.0693512125411 ? -0.00615423757398 ? -0.0244522080592 ? 0.0508061820742 ? 0.0425990023102 ? 0.080315181639 ? 1.09375116958 ? -0.962776257331 ? -0.560125103821 ? 2.63437591144 ? -0.893044461092 ? 2.69330166947 ? -0.0133042093179 ? -0.0204972665809 ? -0.130708397127 ? -0.0487815820069 ? 0.0326799901986 ? 0.111181302869 ? 0.146208573419 ? -0.120039506544 ? -0.0758722442763 ? 2 'X-RAY DIFFRACTION' ? refined 36.976600522 19.9819088106 0.0519513160639 0.109260140404 ? -0.0783101942059 ? -0.0737199481673 ? 0.0782107595656 ? 0.0353979135705 ? 0.119506072344 ? 0.253057554016 ? -0.0334181245313 ? 0.10973716605 ? 0.260618036613 ? -0.0352364797275 ? 0.163400057321 ? -0.0263592861741 ? 0.0495002557086 ? 0.0498921665385 ? 0.0329191282876 ? -0.00817815327415 ? -0.115619365304 ? -0.0713176421551 ? 0.0804425883171 ? -0.0393308683889 ? 3 'X-RAY DIFFRACTION' ? refined 33.2151543288 16.4067032576 7.41910174099 0.161810990819 ? -0.051987301115 ? -0.0810938579024 ? 0.0876589235265 ? 0.0212985223525 ? 0.106461592351 ? 2.06153389556 ? 0.304509483274 ? -0.120528210982 ? 0.5877572026 ? 0.265527841186 ? 0.551692147753 ? 0.0744573312294 ? -0.034337117762 ? -0.125433457696 ? 0.103192040591 ? -0.0266278556589 ? -0.10748801877 ? 0.028843877771 ? 0.0519882052393 ? -0.0610200920604 ? 4 'X-RAY DIFFRACTION' ? refined 33.1792430968 14.2200409754 16.1695708678 0.264044406844 ? -0.0164444957173 ? -0.051508031092 ? 0.0833138368179 ? 0.0201153163737 ? 0.0804327449277 ? 5.23025811481 ? 0.351540672158 ? -0.526852125264 ? 0.673224580027 ? -0.532832164994 ? 1.06740547082 ? -0.0523748428594 ? -0.329823538023 ? -0.188260451328 ? 0.155848932116 ? -0.0314763406818 ? -0.10132432229 ? 0.0462192902701 ? 0.0843033564298 ? 0.0282782858263 ? 5 'X-RAY DIFFRACTION' ? refined 24.474352975 24.8226745084 10.0833812038 0.24817973594 ? 0.0155356207906 ? -0.0520482772211 ? 0.136259306288 ? -0.0185464175482 ? 0.0979562751586 ? 0.876411997579 ? -0.0893456635202 ? 0.358046283846 ? 0.370898766756 ? -0.0981475528295 ? 0.898186457741 ? -0.0721537681678 ? -0.143109907265 ? 0.0291858673218 ? 0.25043574418 ? 0.013961282408 ? -0.0650297144858 ? -0.0962373438896 ? -0.104242112903 ? 0.0291701417138 ? 6 'X-RAY DIFFRACTION' ? refined 14.6794685036 33.2025795314 5.44881503185 0.311289357903 ? 0.0922203217498 ? 0.0304726033028 ? 0.226257288249 ? -0.0477567789329 ? 0.193340077107 ? 7.24751361053 ? 2.36518830605 ? -2.05708005347 ? 1.18673978294 ? -1.55544593629 ? 5.10440509497 ? 0.00300278412764 ? -0.287096480225 ? 0.551208906378 ? 0.194685173279 ? -0.0358122113779 ? 0.160091394289 ? -0.47208781563 ? -0.140366127912 ? 0.0121029130537 ? 7 'X-RAY DIFFRACTION' ? refined 27.5924219883 31.5057455059 -1.01241480856 0.128423382919 ? -0.0223189877393 ? -0.0624106974585 ? 0.0369228783146 ? 0.0136672478712 ? 0.113642690443 ? 0.637065653166 ? 0.328480153576 ? 0.32913791526 ? 0.177993151326 ? 0.191589452452 ? 0.22491760877 ? -0.0216855498846 ? -0.00659666758887 ? 0.0850620322734 ? 0.0435281815726 ? -0.0104693500086 ? -0.0700004130661 ? -0.0979281469329 ? 0.0433824464504 ? 0.000325416455575 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 23 through 38 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 39 through 84 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 85 through 110 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 111 through 128 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 129 through 184 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 185 through 193 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 194 through 220 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _pdbx_entry_details.entry_id 6XPG _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 51 ? ? -104.65 -143.75 2 1 LEU A 201 ? ? -135.48 -50.23 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 19 ? A SER 1 2 1 Y 1 A ASN 20 ? A ASN 2 3 1 Y 1 A ALA 21 ? A ALA 3 4 1 Y 1 A GLU 22 ? A GLU 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MSE N N N N 230 MSE CA C N S 231 MSE C C N N 232 MSE O O N N 233 MSE OXT O N N 234 MSE CB C N N 235 MSE CG C N N 236 MSE SE SE N N 237 MSE CE C N N 238 MSE H H N N 239 MSE H2 H N N 240 MSE HA H N N 241 MSE HXT H N N 242 MSE HB2 H N N 243 MSE HB3 H N N 244 MSE HG2 H N N 245 MSE HG3 H N N 246 MSE HE1 H N N 247 MSE HE2 H N N 248 MSE HE3 H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MSE N CA sing N N 218 MSE N H sing N N 219 MSE N H2 sing N N 220 MSE CA C sing N N 221 MSE CA CB sing N N 222 MSE CA HA sing N N 223 MSE C O doub N N 224 MSE C OXT sing N N 225 MSE OXT HXT sing N N 226 MSE CB CG sing N N 227 MSE CB HB2 sing N N 228 MSE CB HB3 sing N N 229 MSE CG SE sing N N 230 MSE CG HG2 sing N N 231 MSE CG HG3 sing N N 232 MSE SE CE sing N N 233 MSE CE HE1 sing N N 234 MSE CE HE2 sing N N 235 MSE CE HE3 sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6NJC _pdbx_initial_refinement_model.details 'PDB entry 6NJC' # _pdbx_serial_crystallography_data_reduction.diffrn_id 1 _pdbx_serial_crystallography_data_reduction.frames_total 51200 _pdbx_serial_crystallography_data_reduction.xfel_pulse_events ? _pdbx_serial_crystallography_data_reduction.frame_hits 10846 _pdbx_serial_crystallography_data_reduction.crystal_hits 10846 _pdbx_serial_crystallography_data_reduction.droplet_hits ? _pdbx_serial_crystallography_data_reduction.frames_failed_index ? _pdbx_serial_crystallography_data_reduction.frames_indexed 10846 _pdbx_serial_crystallography_data_reduction.lattices_indexed 10608 _pdbx_serial_crystallography_data_reduction.xfel_run_numbers ? # _pdbx_serial_crystallography_sample_delivery.diffrn_id 1 _pdbx_serial_crystallography_sample_delivery.description 'Silicon nitride chips' _pdbx_serial_crystallography_sample_delivery.method 'fixed target' # _pdbx_serial_crystallography_sample_delivery_fixed_target.diffrn_id 1 _pdbx_serial_crystallography_sample_delivery_fixed_target.description 'Silicon nitride chips' _pdbx_serial_crystallography_sample_delivery_fixed_target.sample_holding 'Diamond/Hamburg holder' _pdbx_serial_crystallography_sample_delivery_fixed_target.support_base ? _pdbx_serial_crystallography_sample_delivery_fixed_target.sample_unit_size ? _pdbx_serial_crystallography_sample_delivery_fixed_target.crystals_per_unit ? _pdbx_serial_crystallography_sample_delivery_fixed_target.sample_solvent ? _pdbx_serial_crystallography_sample_delivery_fixed_target.sample_dehydration_prevention '6um Mylar' _pdbx_serial_crystallography_sample_delivery_fixed_target.motion_control 'GeoBrick / SmarAct' _pdbx_serial_crystallography_sample_delivery_fixed_target.velocity_horizontal ? _pdbx_serial_crystallography_sample_delivery_fixed_target.velocity_vertical ? _pdbx_serial_crystallography_sample_delivery_fixed_target.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 65 2 2' _space_group.name_Hall 'P 65 2 (x,y,z+1/12)' _space_group.IT_number 179 _space_group.crystal_system hexagonal _space_group.id 1 #