data_6XW9
# 
_entry.id   6XW9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.383 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6XW9         pdb_00006xw9 10.2210/pdb6xw9/pdb 
WWPDB D_1292106425 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-04-08 
2 'Structure model' 1 1 2020-04-22 
3 'Structure model' 1 2 2020-07-08 
4 'Structure model' 1 3 2024-01-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Database references'    
3 4 'Structure model' 'Data collection'        
4 4 'Structure model' 'Database references'    
5 4 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                      
2 2 'Structure model' citation_author               
3 3 'Structure model' citation                      
4 4 'Structure model' chem_comp_atom                
5 4 'Structure model' chem_comp_bond                
6 4 'Structure model' database_2                    
7 4 'Structure model' pdbx_initial_refinement_model 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                   
2  2 'Structure model' '_citation.journal_abbrev'            
3  2 'Structure model' '_citation.journal_id_ASTM'           
4  2 'Structure model' '_citation.journal_id_CSD'            
5  2 'Structure model' '_citation.journal_id_ISSN'           
6  2 'Structure model' '_citation.pdbx_database_id_DOI'      
7  2 'Structure model' '_citation.pdbx_database_id_PubMed'   
8  2 'Structure model' '_citation.title'                     
9  2 'Structure model' '_citation.year'                      
10 3 'Structure model' '_citation.journal_volume'            
11 3 'Structure model' '_citation.page_first'                
12 3 'Structure model' '_citation.page_last'                 
13 4 'Structure model' '_database_2.pdbx_DOI'                
14 4 'Structure model' '_database_2.pdbx_database_accession' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6XW9 
_pdbx_database_status.recvd_initial_deposition_date   2020-01-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Ruskamo, S.'   1 ? 
'Lehtimaki, M.' 2 ? 
'Kursula, P.'   3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            295 
_citation.language                  ? 
_citation.page_first                8692 
_citation.page_last                 8705 
_citation.title                     
;Cryo-EM, X-ray diffraction, and atomistic simulations reveal determinants for the formation of a supramolecular myelin-like proteolipid lattice.
;
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.RA120.013087 
_citation.pdbx_database_id_PubMed   32265298 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ruskamo, S.'     1  0000-0002-9740-9077 
primary 'Krokengen, O.C.' 2  ?                   
primary 'Kowal, J.'       3  0000-0003-4694-1896 
primary 'Nieminen, T.'    4  0000-0003-2641-9929 
primary 'Lehtimaki, M.'   5  ?                   
primary 'Raasakka, A.'    6  0000-0002-9443-9959 
primary 'Dandey, V.P.'    7  ?                   
primary 'Vattulainen, I.' 8  0000-0001-7408-3214 
primary 'Stahlberg, H.'   9  0000-0002-1185-4592 
primary 'Kursula, P.'     10 0000-0001-8529-3751 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Myelin P2 protein' 14949.368 1 ? K120S ? ? 
2 non-polymer syn 'CHLORIDE ION'      35.453    1 ? ?     ? ? 
3 non-polymer syn 'PALMITIC ACID'     256.424   1 ? ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Peripheral myelin protein 2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GMSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNR
KTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMSGVVCTRIYEKV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GMSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNR
KTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMSGVVCTRIYEKV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION'  CL  
3 'PALMITIC ACID' PLM 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   MET n 
1 3   SER n 
1 4   ASN n 
1 5   LYS n 
1 6   PHE n 
1 7   LEU n 
1 8   GLY n 
1 9   THR n 
1 10  TRP n 
1 11  LYS n 
1 12  LEU n 
1 13  VAL n 
1 14  SER n 
1 15  SER n 
1 16  GLU n 
1 17  ASN n 
1 18  PHE n 
1 19  ASP n 
1 20  ASP n 
1 21  TYR n 
1 22  MET n 
1 23  LYS n 
1 24  ALA n 
1 25  LEU n 
1 26  GLY n 
1 27  VAL n 
1 28  GLY n 
1 29  LEU n 
1 30  ALA n 
1 31  THR n 
1 32  ARG n 
1 33  LYS n 
1 34  LEU n 
1 35  GLY n 
1 36  ASN n 
1 37  LEU n 
1 38  ALA n 
1 39  LYS n 
1 40  PRO n 
1 41  THR n 
1 42  VAL n 
1 43  ILE n 
1 44  ILE n 
1 45  SER n 
1 46  LYS n 
1 47  LYS n 
1 48  GLY n 
1 49  ASP n 
1 50  ILE n 
1 51  ILE n 
1 52  THR n 
1 53  ILE n 
1 54  ARG n 
1 55  THR n 
1 56  GLU n 
1 57  SER n 
1 58  THR n 
1 59  PHE n 
1 60  LYS n 
1 61  ASN n 
1 62  THR n 
1 63  GLU n 
1 64  ILE n 
1 65  SER n 
1 66  PHE n 
1 67  LYS n 
1 68  LEU n 
1 69  GLY n 
1 70  GLN n 
1 71  GLU n 
1 72  PHE n 
1 73  GLU n 
1 74  GLU n 
1 75  THR n 
1 76  THR n 
1 77  ALA n 
1 78  ASP n 
1 79  ASN n 
1 80  ARG n 
1 81  LYS n 
1 82  THR n 
1 83  LYS n 
1 84  SER n 
1 85  ILE n 
1 86  VAL n 
1 87  THR n 
1 88  LEU n 
1 89  GLN n 
1 90  ARG n 
1 91  GLY n 
1 92  SER n 
1 93  LEU n 
1 94  ASN n 
1 95  GLN n 
1 96  VAL n 
1 97  GLN n 
1 98  ARG n 
1 99  TRP n 
1 100 ASP n 
1 101 GLY n 
1 102 LYS n 
1 103 GLU n 
1 104 THR n 
1 105 THR n 
1 106 ILE n 
1 107 LYS n 
1 108 ARG n 
1 109 LYS n 
1 110 LEU n 
1 111 VAL n 
1 112 ASN n 
1 113 GLY n 
1 114 LYS n 
1 115 MET n 
1 116 VAL n 
1 117 ALA n 
1 118 GLU n 
1 119 CYS n 
1 120 LYS n 
1 121 MET n 
1 122 SER n 
1 123 GLY n 
1 124 VAL n 
1 125 VAL n 
1 126 CYS n 
1 127 THR n 
1 128 ARG n 
1 129 ILE n 
1 130 TYR n 
1 131 GLU n 
1 132 LYS n 
1 133 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   133 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PMP2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PLM non-polymer         . 'PALMITIC ACID' ? 'C16 H32 O2'     256.424 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -1  -1  GLY GLY A . n 
A 1 2   MET 2   0   0   MET MET A . n 
A 1 3   SER 3   1   1   SER SER A . n 
A 1 4   ASN 4   2   2   ASN ASN A . n 
A 1 5   LYS 5   3   3   LYS LYS A . n 
A 1 6   PHE 6   4   4   PHE PHE A . n 
A 1 7   LEU 7   5   5   LEU LEU A . n 
A 1 8   GLY 8   6   6   GLY GLY A . n 
A 1 9   THR 9   7   7   THR THR A . n 
A 1 10  TRP 10  8   8   TRP TRP A . n 
A 1 11  LYS 11  9   9   LYS LYS A . n 
A 1 12  LEU 12  10  10  LEU LEU A . n 
A 1 13  VAL 13  11  11  VAL VAL A . n 
A 1 14  SER 14  12  12  SER SER A . n 
A 1 15  SER 15  13  13  SER SER A . n 
A 1 16  GLU 16  14  14  GLU GLU A . n 
A 1 17  ASN 17  15  15  ASN ASN A . n 
A 1 18  PHE 18  16  16  PHE PHE A . n 
A 1 19  ASP 19  17  17  ASP ASP A . n 
A 1 20  ASP 20  18  18  ASP ASP A . n 
A 1 21  TYR 21  19  19  TYR TYR A . n 
A 1 22  MET 22  20  20  MET MET A . n 
A 1 23  LYS 23  21  21  LYS LYS A . n 
A 1 24  ALA 24  22  22  ALA ALA A . n 
A 1 25  LEU 25  23  23  LEU LEU A . n 
A 1 26  GLY 26  24  24  GLY GLY A . n 
A 1 27  VAL 27  25  25  VAL VAL A . n 
A 1 28  GLY 28  26  26  GLY GLY A . n 
A 1 29  LEU 29  27  27  LEU LEU A . n 
A 1 30  ALA 30  28  28  ALA ALA A . n 
A 1 31  THR 31  29  29  THR THR A . n 
A 1 32  ARG 32  30  30  ARG ARG A . n 
A 1 33  LYS 33  31  31  LYS LYS A . n 
A 1 34  LEU 34  32  32  LEU LEU A . n 
A 1 35  GLY 35  33  33  GLY GLY A . n 
A 1 36  ASN 36  34  34  ASN ASN A . n 
A 1 37  LEU 37  35  35  LEU LEU A . n 
A 1 38  ALA 38  36  36  ALA ALA A . n 
A 1 39  LYS 39  37  37  LYS LYS A . n 
A 1 40  PRO 40  38  38  PRO PRO A . n 
A 1 41  THR 41  39  39  THR THR A . n 
A 1 42  VAL 42  40  40  VAL VAL A . n 
A 1 43  ILE 43  41  41  ILE ILE A . n 
A 1 44  ILE 44  42  42  ILE ILE A . n 
A 1 45  SER 45  43  43  SER SER A . n 
A 1 46  LYS 46  44  44  LYS LYS A . n 
A 1 47  LYS 47  45  45  LYS LYS A . n 
A 1 48  GLY 48  46  46  GLY GLY A . n 
A 1 49  ASP 49  47  47  ASP ASP A . n 
A 1 50  ILE 50  48  48  ILE ILE A . n 
A 1 51  ILE 51  49  49  ILE ILE A . n 
A 1 52  THR 52  50  50  THR THR A . n 
A 1 53  ILE 53  51  51  ILE ILE A . n 
A 1 54  ARG 54  52  52  ARG ARG A . n 
A 1 55  THR 55  53  53  THR THR A . n 
A 1 56  GLU 56  54  54  GLU GLU A . n 
A 1 57  SER 57  55  55  SER SER A . n 
A 1 58  THR 58  56  56  THR THR A . n 
A 1 59  PHE 59  57  57  PHE PHE A . n 
A 1 60  LYS 60  58  58  LYS LYS A . n 
A 1 61  ASN 61  59  59  ASN ASN A . n 
A 1 62  THR 62  60  60  THR THR A . n 
A 1 63  GLU 63  61  61  GLU GLU A . n 
A 1 64  ILE 64  62  62  ILE ILE A . n 
A 1 65  SER 65  63  63  SER SER A . n 
A 1 66  PHE 66  64  64  PHE PHE A . n 
A 1 67  LYS 67  65  65  LYS LYS A . n 
A 1 68  LEU 68  66  66  LEU LEU A . n 
A 1 69  GLY 69  67  67  GLY GLY A . n 
A 1 70  GLN 70  68  68  GLN GLN A . n 
A 1 71  GLU 71  69  69  GLU GLU A . n 
A 1 72  PHE 72  70  70  PHE PHE A . n 
A 1 73  GLU 73  71  71  GLU GLU A . n 
A 1 74  GLU 74  72  72  GLU GLU A . n 
A 1 75  THR 75  73  73  THR THR A . n 
A 1 76  THR 76  74  74  THR THR A . n 
A 1 77  ALA 77  75  75  ALA ALA A . n 
A 1 78  ASP 78  76  76  ASP ASP A . n 
A 1 79  ASN 79  77  77  ASN ASN A . n 
A 1 80  ARG 80  78  78  ARG ARG A . n 
A 1 81  LYS 81  79  79  LYS LYS A . n 
A 1 82  THR 82  80  80  THR THR A . n 
A 1 83  LYS 83  81  81  LYS LYS A . n 
A 1 84  SER 84  82  82  SER SER A . n 
A 1 85  ILE 85  83  83  ILE ILE A . n 
A 1 86  VAL 86  84  84  VAL VAL A . n 
A 1 87  THR 87  85  85  THR THR A . n 
A 1 88  LEU 88  86  86  LEU LEU A . n 
A 1 89  GLN 89  87  87  GLN GLN A . n 
A 1 90  ARG 90  88  88  ARG ARG A . n 
A 1 91  GLY 91  89  89  GLY GLY A . n 
A 1 92  SER 92  90  90  SER SER A . n 
A 1 93  LEU 93  91  91  LEU LEU A . n 
A 1 94  ASN 94  92  92  ASN ASN A . n 
A 1 95  GLN 95  93  93  GLN GLN A . n 
A 1 96  VAL 96  94  94  VAL VAL A . n 
A 1 97  GLN 97  95  95  GLN GLN A . n 
A 1 98  ARG 98  96  96  ARG ARG A . n 
A 1 99  TRP 99  97  97  TRP TRP A . n 
A 1 100 ASP 100 98  98  ASP ASP A . n 
A 1 101 GLY 101 99  99  GLY GLY A . n 
A 1 102 LYS 102 100 100 LYS LYS A . n 
A 1 103 GLU 103 101 101 GLU GLU A . n 
A 1 104 THR 104 102 102 THR THR A . n 
A 1 105 THR 105 103 103 THR THR A . n 
A 1 106 ILE 106 104 104 ILE ILE A . n 
A 1 107 LYS 107 105 105 LYS LYS A . n 
A 1 108 ARG 108 106 106 ARG ARG A . n 
A 1 109 LYS 109 107 107 LYS LYS A . n 
A 1 110 LEU 110 108 108 LEU LEU A . n 
A 1 111 VAL 111 109 109 VAL VAL A . n 
A 1 112 ASN 112 110 110 ASN ASN A . n 
A 1 113 GLY 113 111 111 GLY GLY A . n 
A 1 114 LYS 114 112 112 LYS LYS A . n 
A 1 115 MET 115 113 113 MET MET A . n 
A 1 116 VAL 116 114 114 VAL VAL A . n 
A 1 117 ALA 117 115 115 ALA ALA A . n 
A 1 118 GLU 118 116 116 GLU GLU A . n 
A 1 119 CYS 119 117 117 CYS CYS A . n 
A 1 120 LYS 120 118 118 LYS LYS A . n 
A 1 121 MET 121 119 119 MET MET A . n 
A 1 122 SER 122 120 120 SER SER A . n 
A 1 123 GLY 123 121 121 GLY GLY A . n 
A 1 124 VAL 124 122 122 VAL VAL A . n 
A 1 125 VAL 125 123 123 VAL VAL A . n 
A 1 126 CYS 126 124 124 CYS CYS A . n 
A 1 127 THR 127 125 125 THR THR A . n 
A 1 128 ARG 128 126 126 ARG ARG A . n 
A 1 129 ILE 129 127 127 ILE ILE A . n 
A 1 130 TYR 130 128 128 TYR TYR A . n 
A 1 131 GLU 131 129 129 GLU GLU A . n 
A 1 132 LYS 132 130 130 LYS LYS A . n 
A 1 133 VAL 133 131 131 VAL VAL A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CL  1 201 1 CL  CL  A . 
C 3 PLM 1 202 1 PLM PLM A . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_2247 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .        4 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6XW9 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     63.680 
_cell.length_a_esd                 ? 
_cell.length_b                     63.680 
_cell.length_b_esd                 ? 
_cell.length_c                     101.400 
_cell.length_c_esd                 ? 
_cell.volume                       411191.439 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6XW9 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            'P 4abw 2nw' 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6XW9 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.44 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         64.23 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '30% PEG 6000, 0.1 M citrate pH 5.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX-225' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-03-24 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.91 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE X12' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.91 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X12 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, HAMBURG' 
# 
_reflns.B_iso_Wilson_estimate            72 
_reflns.entry_id                         6XW9 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.90 
_reflns.d_resolution_low                 40 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       4976 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.2 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.133 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.144 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.90 
_reflns_shell.d_res_low                   2.98 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.8 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           336 
_reflns_shell.percent_possible_all        97.4 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             1.065 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             1.145 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.859 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               73.31 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6XW9 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.90 
_refine.ls_d_res_low                             40 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     4958 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.3 
_refine.ls_percent_reflns_R_free                 5 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2125 
_refine.ls_R_factor_R_free                       0.2570 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2102 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2wut 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1045 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         19 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1064 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        40 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0029  ? 1073 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.5307  ? 1430 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0455  ? 165  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0016  ? 176  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 15.9895 ? 665  ? f_dihedral_angle_d ? ? 
# 
_struct.entry_id                     6XW9 
_struct.title                        'Human myelin protein P2 mutant K120S' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6XW9 
_struct_keywords.text            'mutant, peripheral membrane protein, FABP, beta barrel, LIPID BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'LIPID BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MYP2_HUMAN 
_struct_ref.pdbx_db_accession          P02689 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRK
TKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6XW9 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 133 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P02689 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  132 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       0 
_struct_ref_seq.pdbx_auth_seq_align_end       131 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6XW9 GLY A 1   ? UNP P02689 ?   ?   'expression tag'      -1  1 
1 6XW9 SER A 122 ? UNP P02689 LYS 121 'engineered mutation' 120 2 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 940  ? 
1 MORE         -7   ? 
1 'SSA (A^2)'  7270 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   SAXS 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ASN A 17 ? LEU A 25 ? ASN A 15 LEU A 23 1 ? 9  
HELX_P HELX_P2 AA2 GLY A 28 ? ALA A 38 ? GLY A 26 ALA A 36 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   10 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? anti-parallel 
AA1 2 3  ? anti-parallel 
AA1 3 4  ? anti-parallel 
AA1 4 5  ? anti-parallel 
AA1 5 6  ? anti-parallel 
AA1 6 7  ? anti-parallel 
AA1 7 8  ? anti-parallel 
AA1 8 9  ? anti-parallel 
AA1 9 10 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  THR A 62  ? PHE A 66  ? THR A 60  PHE A 64  
AA1 2  ILE A 50  ? GLU A 56  ? ILE A 48  GLU A 54  
AA1 3  THR A 41  ? LYS A 47  ? THR A 39  LYS A 45  
AA1 4  GLY A 8   ? GLU A 16  ? GLY A 6   GLU A 14  
AA1 5  VAL A 124 ? LYS A 132 ? VAL A 122 LYS A 130 
AA1 6  LYS A 114 ? MET A 121 ? LYS A 112 MET A 119 
AA1 7  LYS A 102 ? VAL A 111 ? LYS A 100 VAL A 109 
AA1 8  SER A 92  ? TRP A 99  ? SER A 90  TRP A 97  
AA1 9  LYS A 81  ? GLN A 89  ? LYS A 79  GLN A 87  
AA1 10 PHE A 72  ? THR A 75  ? PHE A 70  THR A 73  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  O PHE A 66  ? O PHE A 64  N ILE A 51  ? N ILE A 49  
AA1 2 3  O THR A 52  ? O THR A 50  N SER A 45  ? N SER A 43  
AA1 3 4  O VAL A 42  ? O VAL A 40  N TRP A 10  ? N TRP A 8   
AA1 4 5  N VAL A 13  ? N VAL A 11  O ILE A 129 ? O ILE A 127 
AA1 5 6  O CYS A 126 ? O CYS A 124 N CYS A 119 ? N CYS A 117 
AA1 6 7  O LYS A 114 ? O LYS A 112 N VAL A 111 ? N VAL A 109 
AA1 7 8  O ARG A 108 ? O ARG A 106 N LEU A 93  ? N LEU A 91  
AA1 8 9  O SER A 92  ? O SER A 90  N GLN A 89  ? N GLN A 87  
AA1 9 10 O THR A 82  ? O THR A 80  N GLU A 74  ? N GLU A 72  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CL  201 ? 2 'binding site for residue CL A 201'  
AC2 Software A PLM 202 ? 5 'binding site for residue PLM A 202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 LYS A 39  ? LYS A 37  . ? 1_555 ? 
2 AC1 2 THR A 58  ? THR A 56  . ? 1_555 ? 
3 AC2 5 MET A 22  ? MET A 20  . ? 1_555 ? 
4 AC2 5 ASP A 78  ? ASP A 76  . ? 1_555 ? 
5 AC2 5 ARG A 108 ? ARG A 106 . ? 1_555 ? 
6 AC2 5 ARG A 128 ? ARG A 126 . ? 1_555 ? 
7 AC2 5 TYR A 130 ? TYR A 128 . ? 1_555 ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 HH A TYR 128 ? ? O1 A PLM 202 ? ? 1.42 
2 1 HG A SER 55  ? ? O  A LYS 58  ? ? 1.58 
3 1 OH A TYR 128 ? ? O1 A PLM 202 ? ? 1.85 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    LEU 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     27 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -50.55 
_pdbx_validate_torsion.psi             -71.18 
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z               
2 -y+1/2,x+1/2,z+1/4  
3 y+1/2,-x+1/2,z+3/4  
4 x+1/2,-y+1/2,-z+3/4 
5 -x+1/2,y+1/2,-z+1/4 
6 -x,-y,z+1/2         
7 y,x,-z              
8 -y,-x,-z+1/2        
# 
_pdbx_entry_details.entry_id                 6XW9 
_pdbx_entry_details.has_ligand_of_interest   N 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CL  CL   CL N N 74  
CYS N    N  N N 75  
CYS CA   C  N R 76  
CYS C    C  N N 77  
CYS O    O  N N 78  
CYS CB   C  N N 79  
CYS SG   S  N N 80  
CYS OXT  O  N N 81  
CYS H    H  N N 82  
CYS H2   H  N N 83  
CYS HA   H  N N 84  
CYS HB2  H  N N 85  
CYS HB3  H  N N 86  
CYS HG   H  N N 87  
CYS HXT  H  N N 88  
GLN N    N  N N 89  
GLN CA   C  N S 90  
GLN C    C  N N 91  
GLN O    O  N N 92  
GLN CB   C  N N 93  
GLN CG   C  N N 94  
GLN CD   C  N N 95  
GLN OE1  O  N N 96  
GLN NE2  N  N N 97  
GLN OXT  O  N N 98  
GLN H    H  N N 99  
GLN H2   H  N N 100 
GLN HA   H  N N 101 
GLN HB2  H  N N 102 
GLN HB3  H  N N 103 
GLN HG2  H  N N 104 
GLN HG3  H  N N 105 
GLN HE21 H  N N 106 
GLN HE22 H  N N 107 
GLN HXT  H  N N 108 
GLU N    N  N N 109 
GLU CA   C  N S 110 
GLU C    C  N N 111 
GLU O    O  N N 112 
GLU CB   C  N N 113 
GLU CG   C  N N 114 
GLU CD   C  N N 115 
GLU OE1  O  N N 116 
GLU OE2  O  N N 117 
GLU OXT  O  N N 118 
GLU H    H  N N 119 
GLU H2   H  N N 120 
GLU HA   H  N N 121 
GLU HB2  H  N N 122 
GLU HB3  H  N N 123 
GLU HG2  H  N N 124 
GLU HG3  H  N N 125 
GLU HE2  H  N N 126 
GLU HXT  H  N N 127 
GLY N    N  N N 128 
GLY CA   C  N N 129 
GLY C    C  N N 130 
GLY O    O  N N 131 
GLY OXT  O  N N 132 
GLY H    H  N N 133 
GLY H2   H  N N 134 
GLY HA2  H  N N 135 
GLY HA3  H  N N 136 
GLY HXT  H  N N 137 
ILE N    N  N N 138 
ILE CA   C  N S 139 
ILE C    C  N N 140 
ILE O    O  N N 141 
ILE CB   C  N S 142 
ILE CG1  C  N N 143 
ILE CG2  C  N N 144 
ILE CD1  C  N N 145 
ILE OXT  O  N N 146 
ILE H    H  N N 147 
ILE H2   H  N N 148 
ILE HA   H  N N 149 
ILE HB   H  N N 150 
ILE HG12 H  N N 151 
ILE HG13 H  N N 152 
ILE HG21 H  N N 153 
ILE HG22 H  N N 154 
ILE HG23 H  N N 155 
ILE HD11 H  N N 156 
ILE HD12 H  N N 157 
ILE HD13 H  N N 158 
ILE HXT  H  N N 159 
LEU N    N  N N 160 
LEU CA   C  N S 161 
LEU C    C  N N 162 
LEU O    O  N N 163 
LEU CB   C  N N 164 
LEU CG   C  N N 165 
LEU CD1  C  N N 166 
LEU CD2  C  N N 167 
LEU OXT  O  N N 168 
LEU H    H  N N 169 
LEU H2   H  N N 170 
LEU HA   H  N N 171 
LEU HB2  H  N N 172 
LEU HB3  H  N N 173 
LEU HG   H  N N 174 
LEU HD11 H  N N 175 
LEU HD12 H  N N 176 
LEU HD13 H  N N 177 
LEU HD21 H  N N 178 
LEU HD22 H  N N 179 
LEU HD23 H  N N 180 
LEU HXT  H  N N 181 
LYS N    N  N N 182 
LYS CA   C  N S 183 
LYS C    C  N N 184 
LYS O    O  N N 185 
LYS CB   C  N N 186 
LYS CG   C  N N 187 
LYS CD   C  N N 188 
LYS CE   C  N N 189 
LYS NZ   N  N N 190 
LYS OXT  O  N N 191 
LYS H    H  N N 192 
LYS H2   H  N N 193 
LYS HA   H  N N 194 
LYS HB2  H  N N 195 
LYS HB3  H  N N 196 
LYS HG2  H  N N 197 
LYS HG3  H  N N 198 
LYS HD2  H  N N 199 
LYS HD3  H  N N 200 
LYS HE2  H  N N 201 
LYS HE3  H  N N 202 
LYS HZ1  H  N N 203 
LYS HZ2  H  N N 204 
LYS HZ3  H  N N 205 
LYS HXT  H  N N 206 
MET N    N  N N 207 
MET CA   C  N S 208 
MET C    C  N N 209 
MET O    O  N N 210 
MET CB   C  N N 211 
MET CG   C  N N 212 
MET SD   S  N N 213 
MET CE   C  N N 214 
MET OXT  O  N N 215 
MET H    H  N N 216 
MET H2   H  N N 217 
MET HA   H  N N 218 
MET HB2  H  N N 219 
MET HB3  H  N N 220 
MET HG2  H  N N 221 
MET HG3  H  N N 222 
MET HE1  H  N N 223 
MET HE2  H  N N 224 
MET HE3  H  N N 225 
MET HXT  H  N N 226 
PHE N    N  N N 227 
PHE CA   C  N S 228 
PHE C    C  N N 229 
PHE O    O  N N 230 
PHE CB   C  N N 231 
PHE CG   C  Y N 232 
PHE CD1  C  Y N 233 
PHE CD2  C  Y N 234 
PHE CE1  C  Y N 235 
PHE CE2  C  Y N 236 
PHE CZ   C  Y N 237 
PHE OXT  O  N N 238 
PHE H    H  N N 239 
PHE H2   H  N N 240 
PHE HA   H  N N 241 
PHE HB2  H  N N 242 
PHE HB3  H  N N 243 
PHE HD1  H  N N 244 
PHE HD2  H  N N 245 
PHE HE1  H  N N 246 
PHE HE2  H  N N 247 
PHE HZ   H  N N 248 
PHE HXT  H  N N 249 
PLM C1   C  N N 250 
PLM O1   O  N N 251 
PLM O2   O  N N 252 
PLM C2   C  N N 253 
PLM C3   C  N N 254 
PLM C4   C  N N 255 
PLM C5   C  N N 256 
PLM C6   C  N N 257 
PLM C7   C  N N 258 
PLM C8   C  N N 259 
PLM C9   C  N N 260 
PLM CA   C  N N 261 
PLM CB   C  N N 262 
PLM CC   C  N N 263 
PLM CD   C  N N 264 
PLM CE   C  N N 265 
PLM CF   C  N N 266 
PLM CG   C  N N 267 
PLM H    H  N N 268 
PLM H21  H  N N 269 
PLM H22  H  N N 270 
PLM H31  H  N N 271 
PLM H32  H  N N 272 
PLM H41  H  N N 273 
PLM H42  H  N N 274 
PLM H51  H  N N 275 
PLM H52  H  N N 276 
PLM H61  H  N N 277 
PLM H62  H  N N 278 
PLM H71  H  N N 279 
PLM H72  H  N N 280 
PLM H81  H  N N 281 
PLM H82  H  N N 282 
PLM H91  H  N N 283 
PLM H92  H  N N 284 
PLM HA1  H  N N 285 
PLM HA2  H  N N 286 
PLM HB1  H  N N 287 
PLM HB2  H  N N 288 
PLM HC1  H  N N 289 
PLM HC2  H  N N 290 
PLM HD1  H  N N 291 
PLM HD2  H  N N 292 
PLM HE1  H  N N 293 
PLM HE2  H  N N 294 
PLM HF1  H  N N 295 
PLM HF2  H  N N 296 
PLM HG1  H  N N 297 
PLM HG2  H  N N 298 
PLM HG3  H  N N 299 
PRO N    N  N N 300 
PRO CA   C  N S 301 
PRO C    C  N N 302 
PRO O    O  N N 303 
PRO CB   C  N N 304 
PRO CG   C  N N 305 
PRO CD   C  N N 306 
PRO OXT  O  N N 307 
PRO H    H  N N 308 
PRO HA   H  N N 309 
PRO HB2  H  N N 310 
PRO HB3  H  N N 311 
PRO HG2  H  N N 312 
PRO HG3  H  N N 313 
PRO HD2  H  N N 314 
PRO HD3  H  N N 315 
PRO HXT  H  N N 316 
SER N    N  N N 317 
SER CA   C  N S 318 
SER C    C  N N 319 
SER O    O  N N 320 
SER CB   C  N N 321 
SER OG   O  N N 322 
SER OXT  O  N N 323 
SER H    H  N N 324 
SER H2   H  N N 325 
SER HA   H  N N 326 
SER HB2  H  N N 327 
SER HB3  H  N N 328 
SER HG   H  N N 329 
SER HXT  H  N N 330 
THR N    N  N N 331 
THR CA   C  N S 332 
THR C    C  N N 333 
THR O    O  N N 334 
THR CB   C  N R 335 
THR OG1  O  N N 336 
THR CG2  C  N N 337 
THR OXT  O  N N 338 
THR H    H  N N 339 
THR H2   H  N N 340 
THR HA   H  N N 341 
THR HB   H  N N 342 
THR HG1  H  N N 343 
THR HG21 H  N N 344 
THR HG22 H  N N 345 
THR HG23 H  N N 346 
THR HXT  H  N N 347 
TRP N    N  N N 348 
TRP CA   C  N S 349 
TRP C    C  N N 350 
TRP O    O  N N 351 
TRP CB   C  N N 352 
TRP CG   C  Y N 353 
TRP CD1  C  Y N 354 
TRP CD2  C  Y N 355 
TRP NE1  N  Y N 356 
TRP CE2  C  Y N 357 
TRP CE3  C  Y N 358 
TRP CZ2  C  Y N 359 
TRP CZ3  C  Y N 360 
TRP CH2  C  Y N 361 
TRP OXT  O  N N 362 
TRP H    H  N N 363 
TRP H2   H  N N 364 
TRP HA   H  N N 365 
TRP HB2  H  N N 366 
TRP HB3  H  N N 367 
TRP HD1  H  N N 368 
TRP HE1  H  N N 369 
TRP HE3  H  N N 370 
TRP HZ2  H  N N 371 
TRP HZ3  H  N N 372 
TRP HH2  H  N N 373 
TRP HXT  H  N N 374 
TYR N    N  N N 375 
TYR CA   C  N S 376 
TYR C    C  N N 377 
TYR O    O  N N 378 
TYR CB   C  N N 379 
TYR CG   C  Y N 380 
TYR CD1  C  Y N 381 
TYR CD2  C  Y N 382 
TYR CE1  C  Y N 383 
TYR CE2  C  Y N 384 
TYR CZ   C  Y N 385 
TYR OH   O  N N 386 
TYR OXT  O  N N 387 
TYR H    H  N N 388 
TYR H2   H  N N 389 
TYR HA   H  N N 390 
TYR HB2  H  N N 391 
TYR HB3  H  N N 392 
TYR HD1  H  N N 393 
TYR HD2  H  N N 394 
TYR HE1  H  N N 395 
TYR HE2  H  N N 396 
TYR HH   H  N N 397 
TYR HXT  H  N N 398 
VAL N    N  N N 399 
VAL CA   C  N S 400 
VAL C    C  N N 401 
VAL O    O  N N 402 
VAL CB   C  N N 403 
VAL CG1  C  N N 404 
VAL CG2  C  N N 405 
VAL OXT  O  N N 406 
VAL H    H  N N 407 
VAL H2   H  N N 408 
VAL HA   H  N N 409 
VAL HB   H  N N 410 
VAL HG11 H  N N 411 
VAL HG12 H  N N 412 
VAL HG13 H  N N 413 
VAL HG21 H  N N 414 
VAL HG22 H  N N 415 
VAL HG23 H  N N 416 
VAL HXT  H  N N 417 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
ILE N   CA   sing N N 129 
ILE N   H    sing N N 130 
ILE N   H2   sing N N 131 
ILE CA  C    sing N N 132 
ILE CA  CB   sing N N 133 
ILE CA  HA   sing N N 134 
ILE C   O    doub N N 135 
ILE C   OXT  sing N N 136 
ILE CB  CG1  sing N N 137 
ILE CB  CG2  sing N N 138 
ILE CB  HB   sing N N 139 
ILE CG1 CD1  sing N N 140 
ILE CG1 HG12 sing N N 141 
ILE CG1 HG13 sing N N 142 
ILE CG2 HG21 sing N N 143 
ILE CG2 HG22 sing N N 144 
ILE CG2 HG23 sing N N 145 
ILE CD1 HD11 sing N N 146 
ILE CD1 HD12 sing N N 147 
ILE CD1 HD13 sing N N 148 
ILE OXT HXT  sing N N 149 
LEU N   CA   sing N N 150 
LEU N   H    sing N N 151 
LEU N   H2   sing N N 152 
LEU CA  C    sing N N 153 
LEU CA  CB   sing N N 154 
LEU CA  HA   sing N N 155 
LEU C   O    doub N N 156 
LEU C   OXT  sing N N 157 
LEU CB  CG   sing N N 158 
LEU CB  HB2  sing N N 159 
LEU CB  HB3  sing N N 160 
LEU CG  CD1  sing N N 161 
LEU CG  CD2  sing N N 162 
LEU CG  HG   sing N N 163 
LEU CD1 HD11 sing N N 164 
LEU CD1 HD12 sing N N 165 
LEU CD1 HD13 sing N N 166 
LEU CD2 HD21 sing N N 167 
LEU CD2 HD22 sing N N 168 
LEU CD2 HD23 sing N N 169 
LEU OXT HXT  sing N N 170 
LYS N   CA   sing N N 171 
LYS N   H    sing N N 172 
LYS N   H2   sing N N 173 
LYS CA  C    sing N N 174 
LYS CA  CB   sing N N 175 
LYS CA  HA   sing N N 176 
LYS C   O    doub N N 177 
LYS C   OXT  sing N N 178 
LYS CB  CG   sing N N 179 
LYS CB  HB2  sing N N 180 
LYS CB  HB3  sing N N 181 
LYS CG  CD   sing N N 182 
LYS CG  HG2  sing N N 183 
LYS CG  HG3  sing N N 184 
LYS CD  CE   sing N N 185 
LYS CD  HD2  sing N N 186 
LYS CD  HD3  sing N N 187 
LYS CE  NZ   sing N N 188 
LYS CE  HE2  sing N N 189 
LYS CE  HE3  sing N N 190 
LYS NZ  HZ1  sing N N 191 
LYS NZ  HZ2  sing N N 192 
LYS NZ  HZ3  sing N N 193 
LYS OXT HXT  sing N N 194 
MET N   CA   sing N N 195 
MET N   H    sing N N 196 
MET N   H2   sing N N 197 
MET CA  C    sing N N 198 
MET CA  CB   sing N N 199 
MET CA  HA   sing N N 200 
MET C   O    doub N N 201 
MET C   OXT  sing N N 202 
MET CB  CG   sing N N 203 
MET CB  HB2  sing N N 204 
MET CB  HB3  sing N N 205 
MET CG  SD   sing N N 206 
MET CG  HG2  sing N N 207 
MET CG  HG3  sing N N 208 
MET SD  CE   sing N N 209 
MET CE  HE1  sing N N 210 
MET CE  HE2  sing N N 211 
MET CE  HE3  sing N N 212 
MET OXT HXT  sing N N 213 
PHE N   CA   sing N N 214 
PHE N   H    sing N N 215 
PHE N   H2   sing N N 216 
PHE CA  C    sing N N 217 
PHE CA  CB   sing N N 218 
PHE CA  HA   sing N N 219 
PHE C   O    doub N N 220 
PHE C   OXT  sing N N 221 
PHE CB  CG   sing N N 222 
PHE CB  HB2  sing N N 223 
PHE CB  HB3  sing N N 224 
PHE CG  CD1  doub Y N 225 
PHE CG  CD2  sing Y N 226 
PHE CD1 CE1  sing Y N 227 
PHE CD1 HD1  sing N N 228 
PHE CD2 CE2  doub Y N 229 
PHE CD2 HD2  sing N N 230 
PHE CE1 CZ   doub Y N 231 
PHE CE1 HE1  sing N N 232 
PHE CE2 CZ   sing Y N 233 
PHE CE2 HE2  sing N N 234 
PHE CZ  HZ   sing N N 235 
PHE OXT HXT  sing N N 236 
PLM C1  O1   sing N N 237 
PLM C1  O2   doub N N 238 
PLM C1  C2   sing N N 239 
PLM O1  H    sing N N 240 
PLM C2  C3   sing N N 241 
PLM C2  H21  sing N N 242 
PLM C2  H22  sing N N 243 
PLM C3  C4   sing N N 244 
PLM C3  H31  sing N N 245 
PLM C3  H32  sing N N 246 
PLM C4  C5   sing N N 247 
PLM C4  H41  sing N N 248 
PLM C4  H42  sing N N 249 
PLM C5  C6   sing N N 250 
PLM C5  H51  sing N N 251 
PLM C5  H52  sing N N 252 
PLM C6  C7   sing N N 253 
PLM C6  H61  sing N N 254 
PLM C6  H62  sing N N 255 
PLM C7  C8   sing N N 256 
PLM C7  H71  sing N N 257 
PLM C7  H72  sing N N 258 
PLM C8  C9   sing N N 259 
PLM C8  H81  sing N N 260 
PLM C8  H82  sing N N 261 
PLM C9  CA   sing N N 262 
PLM C9  H91  sing N N 263 
PLM C9  H92  sing N N 264 
PLM CA  CB   sing N N 265 
PLM CA  HA1  sing N N 266 
PLM CA  HA2  sing N N 267 
PLM CB  CC   sing N N 268 
PLM CB  HB1  sing N N 269 
PLM CB  HB2  sing N N 270 
PLM CC  CD   sing N N 271 
PLM CC  HC1  sing N N 272 
PLM CC  HC2  sing N N 273 
PLM CD  CE   sing N N 274 
PLM CD  HD1  sing N N 275 
PLM CD  HD2  sing N N 276 
PLM CE  CF   sing N N 277 
PLM CE  HE1  sing N N 278 
PLM CE  HE2  sing N N 279 
PLM CF  CG   sing N N 280 
PLM CF  HF1  sing N N 281 
PLM CF  HF2  sing N N 282 
PLM CG  HG1  sing N N 283 
PLM CG  HG2  sing N N 284 
PLM CG  HG3  sing N N 285 
PRO N   CA   sing N N 286 
PRO N   CD   sing N N 287 
PRO N   H    sing N N 288 
PRO CA  C    sing N N 289 
PRO CA  CB   sing N N 290 
PRO CA  HA   sing N N 291 
PRO C   O    doub N N 292 
PRO C   OXT  sing N N 293 
PRO CB  CG   sing N N 294 
PRO CB  HB2  sing N N 295 
PRO CB  HB3  sing N N 296 
PRO CG  CD   sing N N 297 
PRO CG  HG2  sing N N 298 
PRO CG  HG3  sing N N 299 
PRO CD  HD2  sing N N 300 
PRO CD  HD3  sing N N 301 
PRO OXT HXT  sing N N 302 
SER N   CA   sing N N 303 
SER N   H    sing N N 304 
SER N   H2   sing N N 305 
SER CA  C    sing N N 306 
SER CA  CB   sing N N 307 
SER CA  HA   sing N N 308 
SER C   O    doub N N 309 
SER C   OXT  sing N N 310 
SER CB  OG   sing N N 311 
SER CB  HB2  sing N N 312 
SER CB  HB3  sing N N 313 
SER OG  HG   sing N N 314 
SER OXT HXT  sing N N 315 
THR N   CA   sing N N 316 
THR N   H    sing N N 317 
THR N   H2   sing N N 318 
THR CA  C    sing N N 319 
THR CA  CB   sing N N 320 
THR CA  HA   sing N N 321 
THR C   O    doub N N 322 
THR C   OXT  sing N N 323 
THR CB  OG1  sing N N 324 
THR CB  CG2  sing N N 325 
THR CB  HB   sing N N 326 
THR OG1 HG1  sing N N 327 
THR CG2 HG21 sing N N 328 
THR CG2 HG22 sing N N 329 
THR CG2 HG23 sing N N 330 
THR OXT HXT  sing N N 331 
TRP N   CA   sing N N 332 
TRP N   H    sing N N 333 
TRP N   H2   sing N N 334 
TRP CA  C    sing N N 335 
TRP CA  CB   sing N N 336 
TRP CA  HA   sing N N 337 
TRP C   O    doub N N 338 
TRP C   OXT  sing N N 339 
TRP CB  CG   sing N N 340 
TRP CB  HB2  sing N N 341 
TRP CB  HB3  sing N N 342 
TRP CG  CD1  doub Y N 343 
TRP CG  CD2  sing Y N 344 
TRP CD1 NE1  sing Y N 345 
TRP CD1 HD1  sing N N 346 
TRP CD2 CE2  doub Y N 347 
TRP CD2 CE3  sing Y N 348 
TRP NE1 CE2  sing Y N 349 
TRP NE1 HE1  sing N N 350 
TRP CE2 CZ2  sing Y N 351 
TRP CE3 CZ3  doub Y N 352 
TRP CE3 HE3  sing N N 353 
TRP CZ2 CH2  doub Y N 354 
TRP CZ2 HZ2  sing N N 355 
TRP CZ3 CH2  sing Y N 356 
TRP CZ3 HZ3  sing N N 357 
TRP CH2 HH2  sing N N 358 
TRP OXT HXT  sing N N 359 
TYR N   CA   sing N N 360 
TYR N   H    sing N N 361 
TYR N   H2   sing N N 362 
TYR CA  C    sing N N 363 
TYR CA  CB   sing N N 364 
TYR CA  HA   sing N N 365 
TYR C   O    doub N N 366 
TYR C   OXT  sing N N 367 
TYR CB  CG   sing N N 368 
TYR CB  HB2  sing N N 369 
TYR CB  HB3  sing N N 370 
TYR CG  CD1  doub Y N 371 
TYR CG  CD2  sing Y N 372 
TYR CD1 CE1  sing Y N 373 
TYR CD1 HD1  sing N N 374 
TYR CD2 CE2  doub Y N 375 
TYR CD2 HD2  sing N N 376 
TYR CE1 CZ   doub Y N 377 
TYR CE1 HE1  sing N N 378 
TYR CE2 CZ   sing Y N 379 
TYR CE2 HE2  sing N N 380 
TYR CZ  OH   sing N N 381 
TYR OH  HH   sing N N 382 
TYR OXT HXT  sing N N 383 
VAL N   CA   sing N N 384 
VAL N   H    sing N N 385 
VAL N   H2   sing N N 386 
VAL CA  C    sing N N 387 
VAL CA  CB   sing N N 388 
VAL CA  HA   sing N N 389 
VAL C   O    doub N N 390 
VAL C   OXT  sing N N 391 
VAL CB  CG1  sing N N 392 
VAL CB  CG2  sing N N 393 
VAL CB  HB   sing N N 394 
VAL CG1 HG11 sing N N 395 
VAL CG1 HG12 sing N N 396 
VAL CG1 HG13 sing N N 397 
VAL CG2 HG21 sing N N 398 
VAL CG2 HG22 sing N N 399 
VAL CG2 HG23 sing N N 400 
VAL OXT HXT  sing N N 401 
# 
_pdbx_audit_support.funding_organization   'Sigrid Juselius Foundation' 
_pdbx_audit_support.country                Finland 
_pdbx_audit_support.grant_number           ? 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   2WUT 
_pdbx_initial_refinement_model.details          ? 
# 
_space_group.crystal_system   tetragonal 
_space_group.name_H-M_alt     'P 41 21 2' 
_space_group.IT_number        92 
_space_group.name_Hall        'P 4abw 2nw' 
_space_group.id               1 
# 
_atom_sites.entry_id                    6XW9 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.015704 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015704 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009862 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
CL 
H  
N  
O  
S  
# 
loop_