data_6YA5 # _entry.id 6YA5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6YA5 pdb_00006ya5 10.2210/pdb6ya5/pdb WWPDB D_1292107234 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-09-09 2 'Structure model' 1 1 2020-09-16 3 'Structure model' 1 2 2021-03-17 4 'Structure model' 1 3 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' entity 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 3 'Structure model' '_entity.details' 7 4 'Structure model' '_database_2.pdbx_DOI' 8 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6YA5 _pdbx_database_status.recvd_initial_deposition_date 2020-03-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Radilova, K.' 1 0000-0001-8917-2359 'Brynda, J.' 2 0000-0003-3675-6769 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country FR _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Eur.J.Med.Chem. _citation.journal_id_ASTM EJMCA5 _citation.journal_id_CSD 0493 _citation.journal_id_ISSN 0223-5234 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 208 _citation.language ? _citation.page_first 112754 _citation.page_last 112754 _citation.title ;Unraveling the anti-influenza effect of flavonoids: Experimental validation of luteolin and its congeners as potent influenza endonuclease inhibitors. ; _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.ejmech.2020.112754 _citation.pdbx_database_id_PubMed 32883638 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zima, V.' 1 ? primary 'Radilova, K.' 2 ? primary 'Kozisek, M.' 3 ? primary 'Albinana, C.B.' 4 ? primary 'Karlukova, E.' 5 ? primary 'Brynda, J.' 6 ? primary 'Fanfrlik, J.' 7 ? primary 'Flieger, M.' 8 ? primary 'Hodek, J.' 9 ? primary 'Weber, J.' 10 ? primary 'Majer, P.' 11 ? primary 'Konvalinka, J.' 12 ? primary 'Machara, A.' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polymerase acidic protein,Polymerase acidic protein' 21121.104 1 3.1.-.-,3.1.-.- ? ? 'N-terminal of PA subunit of influenza A polymerase' 2 non-polymer syn 'MANGANESE (II) ION' 54.938 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 non-polymer syn '2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one' 286.236 1 ? ? ? ? 5 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 6 non-polymer syn 'DIMETHYL SULFOXIDE' 78.133 1 ? ? ? ? 7 non-polymer syn 'TRIETHYLENE GLYCOL' 150.173 1 ? ? ? ? 8 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 1 ? ? ? ? 9 water nat water 18.015 80 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNA-directed RNA polymerase subunit P2,RNA-directed RNA polymerase subunit P2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSKHRFEIIEGRDRIMAWTVVNSICNT TGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFT IRQEMASRSLWDSFRQSER ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSKHRFEIIEGRDRIMAWTVVNSICNT TGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFT IRQEMASRSLWDSFRQSER ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 'MAGNESIUM ION' MG 4 '2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one' LU2 5 'SULFATE ION' SO4 6 'DIMETHYL SULFOXIDE' DMS 7 'TRIETHYLENE GLYCOL' PGE 8 'DI(HYDROXYETHYL)ETHER' PEG 9 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 GLU n 1 5 ASP n 1 6 PHE n 1 7 VAL n 1 8 ARG n 1 9 GLN n 1 10 CYS n 1 11 PHE n 1 12 ASN n 1 13 PRO n 1 14 MET n 1 15 ILE n 1 16 VAL n 1 17 GLU n 1 18 LEU n 1 19 ALA n 1 20 GLU n 1 21 LYS n 1 22 ALA n 1 23 MET n 1 24 LYS n 1 25 GLU n 1 26 TYR n 1 27 GLY n 1 28 GLU n 1 29 ASP n 1 30 PRO n 1 31 LYS n 1 32 ILE n 1 33 GLU n 1 34 THR n 1 35 ASN n 1 36 LYS n 1 37 PHE n 1 38 ALA n 1 39 ALA n 1 40 ILE n 1 41 CYS n 1 42 THR n 1 43 HIS n 1 44 LEU n 1 45 GLU n 1 46 VAL n 1 47 CYS n 1 48 PHE n 1 49 MET n 1 50 TYR n 1 51 SER n 1 52 ASP n 1 53 GLY n 1 54 GLY n 1 55 SER n 1 56 LYS n 1 57 HIS n 1 58 ARG n 1 59 PHE n 1 60 GLU n 1 61 ILE n 1 62 ILE n 1 63 GLU n 1 64 GLY n 1 65 ARG n 1 66 ASP n 1 67 ARG n 1 68 ILE n 1 69 MET n 1 70 ALA n 1 71 TRP n 1 72 THR n 1 73 VAL n 1 74 VAL n 1 75 ASN n 1 76 SER n 1 77 ILE n 1 78 CYS n 1 79 ASN n 1 80 THR n 1 81 THR n 1 82 GLY n 1 83 VAL n 1 84 GLU n 1 85 LYS n 1 86 PRO n 1 87 LYS n 1 88 PHE n 1 89 LEU n 1 90 PRO n 1 91 ASP n 1 92 LEU n 1 93 TYR n 1 94 ASP n 1 95 TYR n 1 96 LYS n 1 97 GLU n 1 98 ASN n 1 99 ARG n 1 100 PHE n 1 101 ILE n 1 102 GLU n 1 103 ILE n 1 104 GLY n 1 105 VAL n 1 106 THR n 1 107 ARG n 1 108 ARG n 1 109 GLU n 1 110 VAL n 1 111 HIS n 1 112 ILE n 1 113 TYR n 1 114 TYR n 1 115 LEU n 1 116 GLU n 1 117 LYS n 1 118 ALA n 1 119 ASN n 1 120 LYS n 1 121 ILE n 1 122 LYS n 1 123 SER n 1 124 GLU n 1 125 LYS n 1 126 THR n 1 127 HIS n 1 128 ILE n 1 129 HIS n 1 130 ILE n 1 131 PHE n 1 132 SER n 1 133 PHE n 1 134 THR n 1 135 GLY n 1 136 GLU n 1 137 GLU n 1 138 MET n 1 139 ALA n 1 140 THR n 1 141 LYS n 1 142 ALA n 1 143 ASP n 1 144 TYR n 1 145 THR n 1 146 LEU n 1 147 ASP n 1 148 GLU n 1 149 GLU n 1 150 SER n 1 151 ARG n 1 152 ALA n 1 153 ARG n 1 154 ILE n 1 155 LYS n 1 156 THR n 1 157 ARG n 1 158 LEU n 1 159 PHE n 1 160 THR n 1 161 ILE n 1 162 ARG n 1 163 GLN n 1 164 GLU n 1 165 MET n 1 166 ALA n 1 167 SER n 1 168 ARG n 1 169 SER n 1 170 LEU n 1 171 TRP n 1 172 ASP n 1 173 SER n 1 174 PHE n 1 175 ARG n 1 176 GLN n 1 177 SER n 1 178 GLU n 1 179 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 55 ? ? PA ? ? ? ? ? ? 'Influenza A virus (A/California/07/2009(H1N1))' 641809 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 56 179 ? ? PA ? ? ? ? ? ? 'Influenza A virus (A/California/07/2009(H1N1))' 641809 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DMS non-polymer . 'DIMETHYL SULFOXIDE' ? 'C2 H6 O S' 78.133 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LU2 non-polymer . '2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one' Luteolin 'C15 H10 O6' 286.236 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PGE non-polymer . 'TRIETHYLENE GLYCOL' ? 'C6 H14 O4' 150.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 -1 GLY GLY A . n A 1 2 SER 2 0 0 SER SER A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 GLU 4 2 2 GLU GLU A . n A 1 5 ASP 5 3 3 ASP ASP A . n A 1 6 PHE 6 4 4 PHE PHE A . n A 1 7 VAL 7 5 5 VAL VAL A . n A 1 8 ARG 8 6 6 ARG ARG A . n A 1 9 GLN 9 7 7 GLN GLN A . n A 1 10 CYS 10 8 8 CYS CYS A . n A 1 11 PHE 11 9 9 PHE PHE A . n A 1 12 ASN 12 10 10 ASN ASN A . n A 1 13 PRO 13 11 11 PRO PRO A . n A 1 14 MET 14 12 12 MET MET A . n A 1 15 ILE 15 13 13 ILE ILE A . n A 1 16 VAL 16 14 14 VAL VAL A . n A 1 17 GLU 17 15 15 GLU GLU A . n A 1 18 LEU 18 16 16 LEU LEU A . n A 1 19 ALA 19 17 17 ALA ALA A . n A 1 20 GLU 20 18 18 GLU GLU A . n A 1 21 LYS 21 19 19 LYS LYS A . n A 1 22 ALA 22 20 20 ALA ALA A . n A 1 23 MET 23 21 21 MET MET A . n A 1 24 LYS 24 22 22 LYS LYS A . n A 1 25 GLU 25 23 23 GLU GLU A . n A 1 26 TYR 26 24 24 TYR TYR A . n A 1 27 GLY 27 25 25 GLY GLY A . n A 1 28 GLU 28 26 26 GLU GLU A . n A 1 29 ASP 29 27 27 ASP ASP A . n A 1 30 PRO 30 28 28 PRO PRO A . n A 1 31 LYS 31 29 29 LYS LYS A . n A 1 32 ILE 32 30 30 ILE ILE A . n A 1 33 GLU 33 31 31 GLU GLU A . n A 1 34 THR 34 32 32 THR THR A . n A 1 35 ASN 35 33 33 ASN ASN A . n A 1 36 LYS 36 34 34 LYS LYS A . n A 1 37 PHE 37 35 35 PHE PHE A . n A 1 38 ALA 38 36 36 ALA ALA A . n A 1 39 ALA 39 37 37 ALA ALA A . n A 1 40 ILE 40 38 38 ILE ILE A . n A 1 41 CYS 41 39 39 CYS CYS A . n A 1 42 THR 42 40 40 THR THR A . n A 1 43 HIS 43 41 41 HIS HIS A . n A 1 44 LEU 44 42 42 LEU LEU A . n A 1 45 GLU 45 43 43 GLU GLU A . n A 1 46 VAL 46 44 44 VAL VAL A . n A 1 47 CYS 47 45 45 CYS CYS A . n A 1 48 PHE 48 46 46 PHE PHE A . n A 1 49 MET 49 47 47 MET MET A . n A 1 50 TYR 50 48 48 TYR TYR A . n A 1 51 SER 51 49 49 SER SER A . n A 1 52 ASP 52 50 50 ASP ASP A . n A 1 53 GLY 53 51 51 GLY GLY A . n A 1 54 GLY 54 52 52 GLY GLY A . n A 1 55 SER 55 53 53 SER SER A . n A 1 56 LYS 56 73 73 LYS LYS A . n A 1 57 HIS 57 74 74 HIS HIS A . n A 1 58 ARG 58 75 75 ARG ARG A . n A 1 59 PHE 59 76 76 PHE PHE A . n A 1 60 GLU 60 77 77 GLU GLU A . n A 1 61 ILE 61 78 78 ILE ILE A . n A 1 62 ILE 62 79 79 ILE ILE A . n A 1 63 GLU 63 80 80 GLU GLU A . n A 1 64 GLY 64 81 81 GLY GLY A . n A 1 65 ARG 65 82 82 ARG ARG A . n A 1 66 ASP 66 83 83 ASP ASP A . n A 1 67 ARG 67 84 84 ARG ARG A . n A 1 68 ILE 68 85 85 ILE ILE A . n A 1 69 MET 69 86 86 MET MET A . n A 1 70 ALA 70 87 87 ALA ALA A . n A 1 71 TRP 71 88 88 TRP TRP A . n A 1 72 THR 72 89 89 THR THR A . n A 1 73 VAL 73 90 90 VAL VAL A . n A 1 74 VAL 74 91 91 VAL VAL A . n A 1 75 ASN 75 92 92 ASN ASN A . n A 1 76 SER 76 93 93 SER SER A . n A 1 77 ILE 77 94 94 ILE ILE A . n A 1 78 CYS 78 95 95 CYS CYS A . n A 1 79 ASN 79 96 96 ASN ASN A . n A 1 80 THR 80 97 97 THR THR A . n A 1 81 THR 81 98 98 THR THR A . n A 1 82 GLY 82 99 99 GLY GLY A . n A 1 83 VAL 83 100 100 VAL VAL A . n A 1 84 GLU 84 101 101 GLU GLU A . n A 1 85 LYS 85 102 102 LYS LYS A . n A 1 86 PRO 86 103 103 PRO PRO A . n A 1 87 LYS 87 104 104 LYS LYS A . n A 1 88 PHE 88 105 105 PHE PHE A . n A 1 89 LEU 89 106 106 LEU LEU A . n A 1 90 PRO 90 107 107 PRO PRO A . n A 1 91 ASP 91 108 108 ASP ASP A . n A 1 92 LEU 92 109 109 LEU LEU A . n A 1 93 TYR 93 110 110 TYR TYR A . n A 1 94 ASP 94 111 111 ASP ASP A . n A 1 95 TYR 95 112 112 TYR TYR A . n A 1 96 LYS 96 113 113 LYS LYS A . n A 1 97 GLU 97 114 114 GLU GLU A . n A 1 98 ASN 98 115 115 ASN ASN A . n A 1 99 ARG 99 116 116 ARG ARG A . n A 1 100 PHE 100 117 117 PHE PHE A . n A 1 101 ILE 101 118 118 ILE ILE A . n A 1 102 GLU 102 119 119 GLU GLU A . n A 1 103 ILE 103 120 120 ILE ILE A . n A 1 104 GLY 104 121 121 GLY GLY A . n A 1 105 VAL 105 122 122 VAL VAL A . n A 1 106 THR 106 123 123 THR THR A . n A 1 107 ARG 107 124 124 ARG ARG A . n A 1 108 ARG 108 125 125 ARG ARG A . n A 1 109 GLU 109 126 126 GLU GLU A . n A 1 110 VAL 110 127 127 VAL VAL A . n A 1 111 HIS 111 128 128 HIS HIS A . n A 1 112 ILE 112 129 129 ILE ILE A . n A 1 113 TYR 113 130 130 TYR TYR A . n A 1 114 TYR 114 131 131 TYR TYR A . n A 1 115 LEU 115 132 132 LEU LEU A . n A 1 116 GLU 116 133 133 GLU GLU A . n A 1 117 LYS 117 134 134 LYS LYS A . n A 1 118 ALA 118 135 135 ALA ALA A . n A 1 119 ASN 119 136 136 ASN ASN A . n A 1 120 LYS 120 137 137 LYS LYS A . n A 1 121 ILE 121 138 138 ILE ILE A . n A 1 122 LYS 122 139 139 LYS LYS A . n A 1 123 SER 123 140 140 SER SER A . n A 1 124 GLU 124 141 141 GLU GLU A . n A 1 125 LYS 125 142 142 LYS LYS A . n A 1 126 THR 126 143 143 THR THR A . n A 1 127 HIS 127 144 144 HIS HIS A . n A 1 128 ILE 128 145 145 ILE ILE A . n A 1 129 HIS 129 146 146 HIS HIS A . n A 1 130 ILE 130 147 147 ILE ILE A . n A 1 131 PHE 131 148 148 PHE PHE A . n A 1 132 SER 132 149 149 SER SER A . n A 1 133 PHE 133 150 150 PHE PHE A . n A 1 134 THR 134 151 151 THR THR A . n A 1 135 GLY 135 152 152 GLY GLY A . n A 1 136 GLU 136 153 153 GLU GLU A . n A 1 137 GLU 137 154 154 GLU GLU A . n A 1 138 MET 138 155 155 MET MET A . n A 1 139 ALA 139 156 156 ALA ALA A . n A 1 140 THR 140 157 157 THR THR A . n A 1 141 LYS 141 158 158 LYS LYS A . n A 1 142 ALA 142 159 159 ALA ALA A . n A 1 143 ASP 143 160 160 ASP ASP A . n A 1 144 TYR 144 161 161 TYR TYR A . n A 1 145 THR 145 162 162 THR THR A . n A 1 146 LEU 146 163 163 LEU LEU A . n A 1 147 ASP 147 164 164 ASP ASP A . n A 1 148 GLU 148 165 165 GLU GLU A . n A 1 149 GLU 149 166 166 GLU GLU A . n A 1 150 SER 150 167 167 SER SER A . n A 1 151 ARG 151 168 168 ARG ARG A . n A 1 152 ALA 152 169 169 ALA ALA A . n A 1 153 ARG 153 170 170 ARG ARG A . n A 1 154 ILE 154 171 171 ILE ILE A . n A 1 155 LYS 155 172 172 LYS LYS A . n A 1 156 THR 156 173 173 THR THR A . n A 1 157 ARG 157 174 174 ARG ARG A . n A 1 158 LEU 158 175 175 LEU LEU A . n A 1 159 PHE 159 176 176 PHE PHE A . n A 1 160 THR 160 177 177 THR THR A . n A 1 161 ILE 161 178 178 ILE ILE A . n A 1 162 ARG 162 179 179 ARG ARG A . n A 1 163 GLN 163 180 180 GLN GLN A . n A 1 164 GLU 164 181 181 GLU GLU A . n A 1 165 MET 165 182 182 MET MET A . n A 1 166 ALA 166 183 183 ALA ALA A . n A 1 167 SER 167 184 184 SER SER A . n A 1 168 ARG 168 185 185 ARG ARG A . n A 1 169 SER 169 186 186 SER SER A . n A 1 170 LEU 170 187 187 LEU LEU A . n A 1 171 TRP 171 188 188 TRP TRP A . n A 1 172 ASP 172 189 189 ASP ASP A . n A 1 173 SER 173 190 190 SER SER A . n A 1 174 PHE 174 191 191 PHE PHE A . n A 1 175 ARG 175 192 192 ARG ARG A . n A 1 176 GLN 176 193 193 GLN GLN A . n A 1 177 SER 177 194 194 SER SER A . n A 1 178 GLU 178 195 195 GLU GLU A . n A 1 179 ARG 179 196 196 ARG ARG A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 201 1 MN MN A . C 3 MG 1 202 2 MG MG A . D 4 LU2 1 203 1 LU2 LU2 A . E 5 SO4 1 204 1 SO4 SO4 A . F 5 SO4 1 205 2 SO4 SO4 A . G 6 DMS 1 206 1 DMS DMS A . H 7 PGE 1 207 1 PGE PG4 A . I 8 PEG 1 208 1 PEG PEG A . J 9 HOH 1 301 51 HOH HOH A . J 9 HOH 2 302 36 HOH HOH A . J 9 HOH 3 303 53 HOH HOH A . J 9 HOH 4 304 43 HOH HOH A . J 9 HOH 5 305 33 HOH HOH A . J 9 HOH 6 306 72 HOH HOH A . J 9 HOH 7 307 44 HOH HOH A . J 9 HOH 8 308 9 HOH HOH A . J 9 HOH 9 309 6 HOH HOH A . J 9 HOH 10 310 52 HOH HOH A . J 9 HOH 11 311 69 HOH HOH A . J 9 HOH 12 312 18 HOH HOH A . J 9 HOH 13 313 13 HOH HOH A . J 9 HOH 14 314 42 HOH HOH A . J 9 HOH 15 315 1 HOH HOH A . J 9 HOH 16 316 7 HOH HOH A . J 9 HOH 17 317 24 HOH HOH A . J 9 HOH 18 318 56 HOH HOH A . J 9 HOH 19 319 27 HOH HOH A . J 9 HOH 20 320 20 HOH HOH A . J 9 HOH 21 321 31 HOH HOH A . J 9 HOH 22 322 23 HOH HOH A . J 9 HOH 23 323 78 HOH HOH A . J 9 HOH 24 324 19 HOH HOH A . J 9 HOH 25 325 2 HOH HOH A . J 9 HOH 26 326 66 HOH HOH A . J 9 HOH 27 327 22 HOH HOH A . J 9 HOH 28 328 3 HOH HOH A . J 9 HOH 29 329 48 HOH HOH A . J 9 HOH 30 330 65 HOH HOH A . J 9 HOH 31 331 14 HOH HOH A . J 9 HOH 32 332 30 HOH HOH A . J 9 HOH 33 333 16 HOH HOH A . J 9 HOH 34 334 80 HOH HOH A . J 9 HOH 35 335 10 HOH HOH A . J 9 HOH 36 336 4 HOH HOH A . J 9 HOH 37 337 40 HOH HOH A . J 9 HOH 38 338 57 HOH HOH A . J 9 HOH 39 339 77 HOH HOH A . J 9 HOH 40 340 49 HOH HOH A . J 9 HOH 41 341 21 HOH HOH A . J 9 HOH 42 342 37 HOH HOH A . J 9 HOH 43 343 41 HOH HOH A . J 9 HOH 44 344 8 HOH HOH A . J 9 HOH 45 345 39 HOH HOH A . J 9 HOH 46 346 35 HOH HOH A . J 9 HOH 47 347 58 HOH HOH A . J 9 HOH 48 348 64 HOH HOH A . J 9 HOH 49 349 63 HOH HOH A . J 9 HOH 50 350 46 HOH HOH A . J 9 HOH 51 351 28 HOH HOH A . J 9 HOH 52 352 54 HOH HOH A . J 9 HOH 53 353 47 HOH HOH A . J 9 HOH 54 354 55 HOH HOH A . J 9 HOH 55 355 61 HOH HOH A . J 9 HOH 56 356 17 HOH HOH A . J 9 HOH 57 357 59 HOH HOH A . J 9 HOH 58 358 68 HOH HOH A . J 9 HOH 59 359 50 HOH HOH A . J 9 HOH 60 360 75 HOH HOH A . J 9 HOH 61 361 71 HOH HOH A . J 9 HOH 62 362 12 HOH HOH A . J 9 HOH 63 363 5 HOH HOH A . J 9 HOH 64 364 38 HOH HOH A . J 9 HOH 65 365 29 HOH HOH A . J 9 HOH 66 366 26 HOH HOH A . J 9 HOH 67 367 62 HOH HOH A . J 9 HOH 68 368 70 HOH HOH A . J 9 HOH 69 369 15 HOH HOH A . J 9 HOH 70 370 76 HOH HOH A . J 9 HOH 71 371 79 HOH HOH A . J 9 HOH 72 372 32 HOH HOH A . J 9 HOH 73 373 25 HOH HOH A . J 9 HOH 74 374 67 HOH HOH A . J 9 HOH 75 375 74 HOH HOH A . J 9 HOH 76 376 34 HOH HOH A . J 9 HOH 77 377 45 HOH HOH A . J 9 HOH 78 378 73 HOH HOH A . J 9 HOH 79 379 60 HOH HOH A . J 9 HOH 80 380 11 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ILE 30 ? CG2 ? A ILE 32 CG2 2 1 Y 1 A ILE 30 ? CD1 ? A ILE 32 CD1 3 1 Y 1 A ASP 50 ? OD1 ? A ASP 52 OD1 4 1 Y 1 A ASN 96 ? CG ? A ASN 79 CG 5 1 Y 1 A ASN 96 ? OD1 ? A ASN 79 OD1 6 1 Y 1 A ASN 96 ? ND2 ? A ASN 79 ND2 7 1 Y 1 A LYS 104 ? CD ? A LYS 87 CD 8 1 Y 1 A LYS 104 ? CE ? A LYS 87 CE 9 1 Y 1 A LYS 104 ? NZ ? A LYS 87 NZ 10 1 Y 1 A LYS 113 ? CG ? A LYS 96 CG 11 1 Y 1 A LYS 113 ? CD ? A LYS 96 CD 12 1 Y 1 A LYS 113 ? CE ? A LYS 96 CE 13 1 Y 1 A LYS 113 ? NZ ? A LYS 96 NZ 14 1 Y 1 A LYS 139 ? CG ? A LYS 122 CG 15 1 Y 1 A LYS 139 ? CD ? A LYS 122 CD 16 1 Y 1 A LYS 139 ? CE ? A LYS 122 CE 17 1 Y 1 A LYS 139 ? NZ ? A LYS 122 NZ 18 1 Y 1 A GLU 141 ? CB ? A GLU 124 CB 19 1 Y 1 A GLU 141 ? CG ? A GLU 124 CG 20 1 Y 1 A GLU 141 ? CD ? A GLU 124 CD 21 1 Y 1 A GLU 141 ? OE1 ? A GLU 124 OE1 22 1 Y 1 A GLU 141 ? OE2 ? A GLU 124 OE2 23 1 Y 1 A LYS 142 ? CG ? A LYS 125 CG 24 1 Y 1 A LYS 142 ? CD ? A LYS 125 CD 25 1 Y 1 A LYS 142 ? CE ? A LYS 125 CE 26 1 Y 1 A LYS 142 ? NZ ? A LYS 125 NZ 27 1 Y 1 A GLU 153 ? OE2 ? A GLU 136 OE2 28 1 Y 1 A LYS 158 ? CG ? A LYS 141 CG 29 1 Y 1 A LYS 158 ? CD ? A LYS 141 CD 30 1 Y 1 A LYS 158 ? CE ? A LYS 141 CE 31 1 Y 1 A LYS 158 ? NZ ? A LYS 141 NZ 32 1 Y 1 A GLU 166 ? OE2 ? A GLU 149 OE2 33 1 Y 1 A ARG 185 ? NH1 ? A ARG 168 NH1 34 1 Y 1 A ARG 196 ? CG ? A ARG 179 CG 35 1 Y 1 A ARG 196 ? CD ? A ARG 179 CD 36 1 Y 1 A ARG 196 ? NE ? A ARG 179 NE 37 1 Y 1 A ARG 196 ? CZ ? A ARG 179 CZ 38 1 Y 1 A ARG 196 ? NH1 ? A ARG 179 NH1 39 1 Y 1 A ARG 196 ? NH2 ? A ARG 179 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0103 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6YA5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 74.069 _cell.length_a_esd ? _cell.length_b 74.069 _cell.length_b_esd ? _cell.length_c 127.715 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6YA5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6YA5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.34 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.36 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'MPD, PEG 1000, PEG 3350, Sodium HEPES, MOPS (acid), Magnesium chloride, Calcium chloride' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 300K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-02-27 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54187 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54187 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 41.742 _reflns.entry_id 6YA5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.000 _reflns.d_resolution_low 42.570 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 24833 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 93.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.233 _reflns.pdbx_Rmerge_I_obs 0.031 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.740 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.401 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.034 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 129940 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.000 2.120 ? 1.640 ? 7575 4252 ? 3259 76.600 ? ? ? ? 0.508 ? ? ? ? ? ? ? ? 2.324 ? ? ? ? 0.633 ? ? 1 1 0.688 ? ? 2.120 2.270 ? 3.480 ? 13241 4011 ? 3743 93.300 ? ? ? ? 0.299 ? ? ? ? ? ? ? ? 3.538 ? ? ? ? 0.350 ? ? 2 1 0.896 ? ? 2.270 2.450 ? 5.730 ? 13597 3762 ? 3538 94.000 ? ? ? ? 0.195 ? ? ? ? ? ? ? ? 3.843 ? ? ? ? 0.227 ? ? 3 1 0.959 ? ? 2.450 2.680 ? 9.780 ? 13126 3434 ? 3315 96.500 ? ? ? ? 0.124 ? ? ? ? ? ? ? ? 3.960 ? ? ? ? 0.143 ? ? 4 1 0.983 ? ? 2.680 3.000 ? 17.070 ? 14239 3110 ? 3086 99.200 ? ? ? ? 0.077 ? ? ? ? ? ? ? ? 4.614 ? ? ? ? 0.086 ? ? 5 1 0.995 ? ? 3.000 3.460 ? 41.890 ? 20576 2750 ? 2749 100.000 ? ? ? ? 0.043 ? ? ? ? ? ? ? ? 7.485 ? ? ? ? 0.046 ? ? 6 1 0.999 ? ? 3.460 4.230 ? 74.290 ? 20234 2326 ? 2326 100.000 ? ? ? ? 0.026 ? ? ? ? ? ? ? ? 8.699 ? ? ? ? 0.027 ? ? 7 1 1.000 ? ? 4.230 5.950 ? 94.300 ? 17948 1809 ? 1809 100.000 ? ? ? ? 0.020 ? ? ? ? ? ? ? ? 9.922 ? ? ? ? 0.021 ? ? 8 1 1.000 ? ? 5.950 42.570 ? 105.820 ? 9404 1016 ? 1008 99.200 ? ? ? ? 0.016 ? ? ? ? ? ? ? ? 9.329 ? ? ? ? 0.017 ? ? 9 1 1.000 ? ? # _refine.aniso_B[1][1] 0.0100 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] 0.0100 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -0.0200 _refine.B_iso_max 101.100 _refine.B_iso_mean 43.2440 _refine.B_iso_min 22.270 _refine.correlation_coeff_Fo_to_Fc 0.9580 _refine.correlation_coeff_Fo_to_Fc_free 0.9260 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6YA5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.0000 _refine.ls_d_res_low 42.5700 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13266 _refine.ls_number_reflns_R_free 699 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.3600 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2053 _refine.ls_R_factor_R_free 0.2639 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2023 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.2401 _refine.ls_wR_factor_R_work 0.1833 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5CGV _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.2000 _refine.pdbx_overall_ESU_R_Free 0.1880 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 5.6850 _refine.overall_SU_ML 0.1510 _refine.overall_SU_R_Cruickshank_DPI 0.1999 _refine.overall_SU_R_free 0.1885 _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.7906 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.0000 _refine_hist.d_res_low 42.5700 _refine_hist.number_atoms_solvent 80 _refine_hist.number_atoms_total 1578 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 179 _refine_hist.pdbx_B_iso_mean_ligand 41.80 _refine_hist.pdbx_B_iso_mean_solvent 45.17 _refine_hist.pdbx_number_atoms_protein 1440 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 58 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.015 0.019 1530 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 1392 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.693 1.972 2053 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.055 3.000 3204 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.136 5.000 180 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 38.924 23.108 74 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.193 15.000 263 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 17.094 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.095 0.200 216 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 1687 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 361 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.0000 _refine_ls_shell.d_res_low 2.0520 _refine_ls_shell.number_reflns_all 712 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 36 _refine_ls_shell.number_reflns_R_work 676 _refine_ls_shell.percent_reflns_obs 68.6600 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3810 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3360 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6YA5 _struct.title '2009 H1N1 PA Endonuclease in complex with LU2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6YA5 _struct_keywords.text 'Influenza, polymerase, endonuclease, hydrolase, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? G N N 6 ? H N N 7 ? I N N 8 ? J N N 9 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP C3W5X6_9INFA C3W5X6 ? 1 MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 1 2 UNP C3W5X6_9INFA C3W5X6 ? 1 ;KHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTG EEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSER ; 73 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6YA5 A 3 ? 52 ? C3W5X6 1 ? 50 ? 1 50 2 2 6YA5 A 56 ? 179 ? C3W5X6 73 ? 196 ? 73 196 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6YA5 GLY A 1 ? UNP C3W5X6 ? ? 'expression tag' -1 1 1 6YA5 SER A 2 ? UNP C3W5X6 ? ? 'expression tag' 0 2 1 6YA5 GLY A 53 ? UNP C3W5X6 ? ? linker 51 3 1 6YA5 GLY A 54 ? UNP C3W5X6 ? ? linker 52 4 1 6YA5 SER A 55 ? UNP C3W5X6 ? ? linker 53 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1420 ? 1 MORE -26 ? 1 'SSA (A^2)' 9240 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 1 ? PHE A 11 ? GLY A -1 PHE A 9 1 ? 11 HELX_P HELX_P2 AA2 ASN A 12 ? GLU A 25 ? ASN A 10 GLU A 23 1 ? 14 HELX_P HELX_P3 AA3 GLU A 33 ? ASP A 52 ? GLU A 31 ASP A 50 1 ? 20 HELX_P HELX_P4 AA4 ASP A 66 ? GLY A 82 ? ASP A 83 GLY A 99 1 ? 17 HELX_P HELX_P5 AA5 GLU A 109 ? LYS A 122 ? GLU A 126 LYS A 139 1 ? 14 HELX_P HELX_P6 AA6 LYS A 141 ? ASP A 143 ? LYS A 158 ASP A 160 5 ? 3 HELX_P HELX_P7 AA7 ASP A 147 ? ARG A 168 ? ASP A 164 ARG A 185 1 ? 22 HELX_P HELX_P8 AA8 LEU A 170 ? GLU A 178 ? LEU A 187 GLU A 195 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 43 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 41 A MN 201 1_555 ? ? ? ? ? ? ? 2.387 ? ? metalc2 metalc ? ? A GLU 63 OE2 ? ? ? 1_555 C MG . MG ? ? A GLU 80 A MG 202 1_555 ? ? ? ? ? ? ? 1.995 ? ? metalc3 metalc ? ? A ASP 91 OD2 ? ? ? 1_555 B MN . MN ? ? A ASP 108 A MN 201 1_555 ? ? ? ? ? ? ? 2.158 ? ? metalc4 metalc ? ? A ASP 91 OD1 ? ? ? 1_555 C MG . MG ? ? A ASP 108 A MG 202 1_555 ? ? ? ? ? ? ? 1.995 ? ? metalc5 metalc ? ? A GLU 102 OE2 ? ? ? 1_555 B MN . MN ? ? A GLU 119 A MN 201 1_555 ? ? ? ? ? ? ? 2.164 ? ? metalc6 metalc ? ? A ILE 103 O ? ? ? 1_555 B MN . MN ? ? A ILE 120 A MN 201 1_555 ? ? ? ? ? ? ? 2.247 ? ? metalc7 metalc ? ? B MN . MN ? ? ? 1_555 D LU2 . O5 ? ? A MN 201 A LU2 203 1_555 ? ? ? ? ? ? ? 2.281 ? ? metalc8 metalc ? ? B MN . MN ? ? ? 1_555 D LU2 . O6 ? ? A MN 201 A LU2 203 1_555 ? ? ? ? ? ? ? 2.240 ? ? metalc9 metalc ? ? C MG . MG ? ? ? 1_555 D LU2 . O5 ? ? A MG 202 A LU2 203 1_555 ? ? ? ? ? ? ? 2.083 ? ? metalc10 metalc ? ? C MG . MG ? ? ? 1_555 J HOH . O ? ? A MG 202 A HOH 315 1_555 ? ? ? ? ? ? ? 1.990 ? ? metalc11 metalc ? ? C MG . MG ? ? ? 1_555 J HOH . O ? ? A MG 202 A HOH 325 1_555 ? ? ? ? ? ? ? 2.235 ? ? metalc12 metalc ? ? C MG . MG ? ? ? 1_555 J HOH . O ? ? A MG 202 A HOH 328 1_555 ? ? ? ? ? ? ? 2.086 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 43 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OD2 ? A ASP 91 ? A ASP 108 ? 1_555 95.4 ? 2 NE2 ? A HIS 43 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OE2 ? A GLU 102 ? A GLU 119 ? 1_555 173.7 ? 3 OD2 ? A ASP 91 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OE2 ? A GLU 102 ? A GLU 119 ? 1_555 88.3 ? 4 NE2 ? A HIS 43 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? A ILE 103 ? A ILE 120 ? 1_555 86.0 ? 5 OD2 ? A ASP 91 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? A ILE 103 ? A ILE 120 ? 1_555 88.4 ? 6 OE2 ? A GLU 102 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? A ILE 103 ? A ILE 120 ? 1_555 89.0 ? 7 NE2 ? A HIS 43 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O5 ? D LU2 . ? A LU2 203 ? 1_555 82.8 ? 8 OD2 ? A ASP 91 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O5 ? D LU2 . ? A LU2 203 ? 1_555 104.4 ? 9 OE2 ? A GLU 102 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O5 ? D LU2 . ? A LU2 203 ? 1_555 101.3 ? 10 O ? A ILE 103 ? A ILE 120 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O5 ? D LU2 . ? A LU2 203 ? 1_555 163.7 ? 11 NE2 ? A HIS 43 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O6 ? D LU2 . ? A LU2 203 ? 1_555 90.4 ? 12 OD2 ? A ASP 91 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O6 ? D LU2 . ? A LU2 203 ? 1_555 174.2 ? 13 OE2 ? A GLU 102 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O6 ? D LU2 . ? A LU2 203 ? 1_555 85.9 ? 14 O ? A ILE 103 ? A ILE 120 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O6 ? D LU2 . ? A LU2 203 ? 1_555 92.3 ? 15 O5 ? D LU2 . ? A LU2 203 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O6 ? D LU2 . ? A LU2 203 ? 1_555 76.0 ? 16 OE2 ? A GLU 63 ? A GLU 80 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 OD1 ? A ASP 91 ? A ASP 108 ? 1_555 94.8 ? 17 OE2 ? A GLU 63 ? A GLU 80 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O5 ? D LU2 . ? A LU2 203 ? 1_555 92.1 ? 18 OD1 ? A ASP 91 ? A ASP 108 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O5 ? D LU2 . ? A LU2 203 ? 1_555 91.8 ? 19 OE2 ? A GLU 63 ? A GLU 80 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 315 ? 1_555 168.8 ? 20 OD1 ? A ASP 91 ? A ASP 108 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 315 ? 1_555 85.0 ? 21 O5 ? D LU2 . ? A LU2 203 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 315 ? 1_555 99.2 ? 22 OE2 ? A GLU 63 ? A GLU 80 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 325 ? 1_555 84.9 ? 23 OD1 ? A ASP 91 ? A ASP 108 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 325 ? 1_555 90.2 ? 24 O5 ? D LU2 . ? A LU2 203 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 325 ? 1_555 176.5 ? 25 O ? J HOH . ? A HOH 315 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 325 ? 1_555 83.8 ? 26 OE2 ? A GLU 63 ? A GLU 80 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 328 ? 1_555 84.7 ? 27 OD1 ? A ASP 91 ? A ASP 108 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 328 ? 1_555 173.9 ? 28 O5 ? D LU2 . ? A LU2 203 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 328 ? 1_555 94.3 ? 29 O ? J HOH . ? A HOH 315 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 328 ? 1_555 94.3 ? 30 O ? J HOH . ? A HOH 325 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? J HOH . ? A HOH 328 ? 1_555 83.7 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 59 ? ILE A 61 ? PHE A 76 ILE A 78 AA1 2 LEU A 92 ? ASP A 94 ? LEU A 109 ASP A 111 AA1 3 ARG A 99 ? THR A 106 ? ARG A 116 THR A 123 AA1 4 HIS A 127 ? SER A 132 ? HIS A 144 SER A 149 AA1 5 GLU A 137 ? ALA A 139 ? GLU A 154 ALA A 156 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 60 ? N GLU A 77 O TYR A 93 ? O TYR A 110 AA1 2 3 N LEU A 92 ? N LEU A 109 O ILE A 101 ? O ILE A 118 AA1 3 4 N GLU A 102 ? N GLU A 119 O HIS A 127 ? O HIS A 144 AA1 4 5 N ILE A 130 ? N ILE A 147 O MET A 138 ? O MET A 155 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MN 201 ? 6 'binding site for residue MN A 201' AC2 Software A MG 202 ? 7 'binding site for residue MG A 202' AC3 Software A LU2 203 ? 21 'binding site for residue LU2 A 203' AC4 Software A SO4 204 ? 4 'binding site for residue SO4 A 204' AC5 Software A SO4 205 ? 6 'binding site for residue SO4 A 205' AC6 Software A DMS 206 ? 3 'binding site for residue DMS A 206' AC7 Software A PGE 207 ? 7 'binding site for residue PGE A 207' AC8 Software A PEG 208 ? 5 'binding site for residue PEG A 208' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HIS A 43 ? HIS A 41 . ? 1_555 ? 2 AC1 6 ASP A 91 ? ASP A 108 . ? 1_555 ? 3 AC1 6 GLU A 102 ? GLU A 119 . ? 1_555 ? 4 AC1 6 ILE A 103 ? ILE A 120 . ? 1_555 ? 5 AC1 6 MG C . ? MG A 202 . ? 1_555 ? 6 AC1 6 LU2 D . ? LU2 A 203 . ? 1_555 ? 7 AC2 7 GLU A 63 ? GLU A 80 . ? 1_555 ? 8 AC2 7 ASP A 91 ? ASP A 108 . ? 1_555 ? 9 AC2 7 MN B . ? MN A 201 . ? 1_555 ? 10 AC2 7 LU2 D . ? LU2 A 203 . ? 1_555 ? 11 AC2 7 HOH J . ? HOH A 315 . ? 1_555 ? 12 AC2 7 HOH J . ? HOH A 325 . ? 1_555 ? 13 AC2 7 HOH J . ? HOH A 328 . ? 1_555 ? 14 AC3 21 ALA A 22 ? ALA A 20 . ? 1_555 ? 15 AC3 21 MET A 23 ? MET A 21 . ? 1_555 ? 16 AC3 21 TYR A 26 ? TYR A 24 . ? 1_555 ? 17 AC3 21 GLU A 28 ? GLU A 26 . ? 1_555 ? 18 AC3 21 LYS A 36 ? LYS A 34 . ? 1_555 ? 19 AC3 21 ILE A 40 ? ILE A 38 . ? 1_555 ? 20 AC3 21 HIS A 43 ? HIS A 41 . ? 1_555 ? 21 AC3 21 GLU A 63 ? GLU A 80 . ? 1_555 ? 22 AC3 21 ASP A 91 ? ASP A 108 . ? 1_555 ? 23 AC3 21 GLU A 102 ? GLU A 119 . ? 1_555 ? 24 AC3 21 ILE A 103 ? ILE A 120 . ? 1_555 ? 25 AC3 21 TYR A 113 ? TYR A 130 . ? 1_555 ? 26 AC3 21 LYS A 117 ? LYS A 134 . ? 1_555 ? 27 AC3 21 MN B . ? MN A 201 . ? 1_555 ? 28 AC3 21 MG C . ? MG A 202 . ? 1_555 ? 29 AC3 21 DMS G . ? DMS A 206 . ? 1_555 ? 30 AC3 21 HOH J . ? HOH A 307 . ? 1_555 ? 31 AC3 21 HOH J . ? HOH A 313 . ? 1_555 ? 32 AC3 21 HOH J . ? HOH A 328 . ? 1_555 ? 33 AC3 21 HOH J . ? HOH A 332 . ? 1_555 ? 34 AC3 21 HOH J . ? HOH A 365 . ? 1_555 ? 35 AC4 4 TYR A 26 ? TYR A 24 . ? 11_655 ? 36 AC4 4 TYR A 26 ? TYR A 24 . ? 1_555 ? 37 AC4 4 ARG A 67 ? ARG A 84 . ? 1_555 ? 38 AC4 4 ARG A 67 ? ARG A 84 . ? 11_655 ? 39 AC5 6 ALA A 22 ? ALA A 20 . ? 1_555 ? 40 AC5 6 GLU A 25 ? GLU A 23 . ? 1_555 ? 41 AC5 6 ARG A 65 ? ARG A 82 . ? 1_555 ? 42 AC5 6 HOH J . ? HOH A 302 . ? 1_555 ? 43 AC5 6 HOH J . ? HOH A 304 . ? 1_555 ? 44 AC5 6 HOH J . ? HOH A 307 . ? 1_555 ? 45 AC6 3 GLU A 102 ? GLU A 119 . ? 1_555 ? 46 AC6 3 LYS A 117 ? LYS A 134 . ? 1_555 ? 47 AC6 3 LU2 D . ? LU2 A 203 . ? 1_555 ? 48 AC7 7 MET A 14 ? MET A 12 . ? 1_555 ? 49 AC7 7 LEU A 18 ? LEU A 16 . ? 1_555 ? 50 AC7 7 PHE A 48 ? PHE A 46 . ? 1_555 ? 51 AC7 7 ARG A 65 ? ARG A 82 . ? 8_555 ? 52 AC7 7 ARG A 65 ? ARG A 82 . ? 1_555 ? 53 AC7 7 HOH J . ? HOH A 301 . ? 1_555 ? 54 AC7 7 HOH J . ? HOH A 306 . ? 1_555 ? 55 AC8 5 ARG A 153 ? ARG A 170 . ? 1_555 ? 56 AC8 5 THR A 156 ? THR A 173 . ? 1_555 ? 57 AC8 5 ARG A 157 ? ARG A 174 . ? 1_555 ? 58 AC8 5 THR A 160 ? THR A 177 . ? 1_555 ? 59 AC8 5 HOH J . ? HOH A 329 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 139 ? ? 69.48 -51.09 2 1 THR A 162 ? ? 67.72 -59.07 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 375 ? J HOH . 2 1 A HOH 379 ? J HOH . # _pdbx_entry_details.entry_id 6YA5 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 DMS S S N N 88 DMS O O N N 89 DMS C1 C N N 90 DMS C2 C N N 91 DMS H11 H N N 92 DMS H12 H N N 93 DMS H13 H N N 94 DMS H21 H N N 95 DMS H22 H N N 96 DMS H23 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LU2 C1 C Y N 215 LU2 O1 O N N 216 LU2 C2 C Y N 217 LU2 O2 O N N 218 LU2 C3 C Y N 219 LU2 O3 O N N 220 LU2 C4 C Y N 221 LU2 O4 O N N 222 LU2 C5 C Y N 223 LU2 O5 O N N 224 LU2 C6 C Y N 225 LU2 O6 O N N 226 LU2 C7 C N N 227 LU2 C8 C N N 228 LU2 C9 C N N 229 LU2 C10 C Y N 230 LU2 C11 C Y N 231 LU2 C12 C Y N 232 LU2 C13 C Y N 233 LU2 C14 C Y N 234 LU2 C15 C Y N 235 LU2 H1 H N N 236 LU2 HO1 H N N 237 LU2 HO2 H N N 238 LU2 H3 H N N 239 LU2 HO5 H N N 240 LU2 HO6 H N N 241 LU2 H8 H N N 242 LU2 H11 H N N 243 LU2 H14 H N N 244 LU2 H15 H N N 245 LYS N N N N 246 LYS CA C N S 247 LYS C C N N 248 LYS O O N N 249 LYS CB C N N 250 LYS CG C N N 251 LYS CD C N N 252 LYS CE C N N 253 LYS NZ N N N 254 LYS OXT O N N 255 LYS H H N N 256 LYS H2 H N N 257 LYS HA H N N 258 LYS HB2 H N N 259 LYS HB3 H N N 260 LYS HG2 H N N 261 LYS HG3 H N N 262 LYS HD2 H N N 263 LYS HD3 H N N 264 LYS HE2 H N N 265 LYS HE3 H N N 266 LYS HZ1 H N N 267 LYS HZ2 H N N 268 LYS HZ3 H N N 269 LYS HXT H N N 270 MET N N N N 271 MET CA C N S 272 MET C C N N 273 MET O O N N 274 MET CB C N N 275 MET CG C N N 276 MET SD S N N 277 MET CE C N N 278 MET OXT O N N 279 MET H H N N 280 MET H2 H N N 281 MET HA H N N 282 MET HB2 H N N 283 MET HB3 H N N 284 MET HG2 H N N 285 MET HG3 H N N 286 MET HE1 H N N 287 MET HE2 H N N 288 MET HE3 H N N 289 MET HXT H N N 290 MG MG MG N N 291 MN MN MN N N 292 PEG C1 C N N 293 PEG O1 O N N 294 PEG C2 C N N 295 PEG O2 O N N 296 PEG C3 C N N 297 PEG C4 C N N 298 PEG O4 O N N 299 PEG H11 H N N 300 PEG H12 H N N 301 PEG HO1 H N N 302 PEG H21 H N N 303 PEG H22 H N N 304 PEG H31 H N N 305 PEG H32 H N N 306 PEG H41 H N N 307 PEG H42 H N N 308 PEG HO4 H N N 309 PGE C1 C N N 310 PGE O1 O N N 311 PGE C2 C N N 312 PGE O2 O N N 313 PGE C3 C N N 314 PGE C4 C N N 315 PGE O4 O N N 316 PGE C6 C N N 317 PGE C5 C N N 318 PGE O3 O N N 319 PGE H1 H N N 320 PGE H12 H N N 321 PGE HO1 H N N 322 PGE H2 H N N 323 PGE H22 H N N 324 PGE H3 H N N 325 PGE H32 H N N 326 PGE H4 H N N 327 PGE H42 H N N 328 PGE HO4 H N N 329 PGE H6 H N N 330 PGE H62 H N N 331 PGE H5 H N N 332 PGE H52 H N N 333 PHE N N N N 334 PHE CA C N S 335 PHE C C N N 336 PHE O O N N 337 PHE CB C N N 338 PHE CG C Y N 339 PHE CD1 C Y N 340 PHE CD2 C Y N 341 PHE CE1 C Y N 342 PHE CE2 C Y N 343 PHE CZ C Y N 344 PHE OXT O N N 345 PHE H H N N 346 PHE H2 H N N 347 PHE HA H N N 348 PHE HB2 H N N 349 PHE HB3 H N N 350 PHE HD1 H N N 351 PHE HD2 H N N 352 PHE HE1 H N N 353 PHE HE2 H N N 354 PHE HZ H N N 355 PHE HXT H N N 356 PRO N N N N 357 PRO CA C N S 358 PRO C C N N 359 PRO O O N N 360 PRO CB C N N 361 PRO CG C N N 362 PRO CD C N N 363 PRO OXT O N N 364 PRO H H N N 365 PRO HA H N N 366 PRO HB2 H N N 367 PRO HB3 H N N 368 PRO HG2 H N N 369 PRO HG3 H N N 370 PRO HD2 H N N 371 PRO HD3 H N N 372 PRO HXT H N N 373 SER N N N N 374 SER CA C N S 375 SER C C N N 376 SER O O N N 377 SER CB C N N 378 SER OG O N N 379 SER OXT O N N 380 SER H H N N 381 SER H2 H N N 382 SER HA H N N 383 SER HB2 H N N 384 SER HB3 H N N 385 SER HG H N N 386 SER HXT H N N 387 SO4 S S N N 388 SO4 O1 O N N 389 SO4 O2 O N N 390 SO4 O3 O N N 391 SO4 O4 O N N 392 THR N N N N 393 THR CA C N S 394 THR C C N N 395 THR O O N N 396 THR CB C N R 397 THR OG1 O N N 398 THR CG2 C N N 399 THR OXT O N N 400 THR H H N N 401 THR H2 H N N 402 THR HA H N N 403 THR HB H N N 404 THR HG1 H N N 405 THR HG21 H N N 406 THR HG22 H N N 407 THR HG23 H N N 408 THR HXT H N N 409 TRP N N N N 410 TRP CA C N S 411 TRP C C N N 412 TRP O O N N 413 TRP CB C N N 414 TRP CG C Y N 415 TRP CD1 C Y N 416 TRP CD2 C Y N 417 TRP NE1 N Y N 418 TRP CE2 C Y N 419 TRP CE3 C Y N 420 TRP CZ2 C Y N 421 TRP CZ3 C Y N 422 TRP CH2 C Y N 423 TRP OXT O N N 424 TRP H H N N 425 TRP H2 H N N 426 TRP HA H N N 427 TRP HB2 H N N 428 TRP HB3 H N N 429 TRP HD1 H N N 430 TRP HE1 H N N 431 TRP HE3 H N N 432 TRP HZ2 H N N 433 TRP HZ3 H N N 434 TRP HH2 H N N 435 TRP HXT H N N 436 TYR N N N N 437 TYR CA C N S 438 TYR C C N N 439 TYR O O N N 440 TYR CB C N N 441 TYR CG C Y N 442 TYR CD1 C Y N 443 TYR CD2 C Y N 444 TYR CE1 C Y N 445 TYR CE2 C Y N 446 TYR CZ C Y N 447 TYR OH O N N 448 TYR OXT O N N 449 TYR H H N N 450 TYR H2 H N N 451 TYR HA H N N 452 TYR HB2 H N N 453 TYR HB3 H N N 454 TYR HD1 H N N 455 TYR HD2 H N N 456 TYR HE1 H N N 457 TYR HE2 H N N 458 TYR HH H N N 459 TYR HXT H N N 460 VAL N N N N 461 VAL CA C N S 462 VAL C C N N 463 VAL O O N N 464 VAL CB C N N 465 VAL CG1 C N N 466 VAL CG2 C N N 467 VAL OXT O N N 468 VAL H H N N 469 VAL H2 H N N 470 VAL HA H N N 471 VAL HB H N N 472 VAL HG11 H N N 473 VAL HG12 H N N 474 VAL HG13 H N N 475 VAL HG21 H N N 476 VAL HG22 H N N 477 VAL HG23 H N N 478 VAL HXT H N N 479 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DMS S O doub N N 83 DMS S C1 sing N N 84 DMS S C2 sing N N 85 DMS C1 H11 sing N N 86 DMS C1 H12 sing N N 87 DMS C1 H13 sing N N 88 DMS C2 H21 sing N N 89 DMS C2 H22 sing N N 90 DMS C2 H23 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LU2 C1 C2 doub Y N 203 LU2 C1 C6 sing Y N 204 LU2 C1 H1 sing N N 205 LU2 O1 C2 sing N N 206 LU2 O1 HO1 sing N N 207 LU2 C2 C3 sing Y N 208 LU2 C4 O2 sing N N 209 LU2 O2 HO2 sing N N 210 LU2 C3 C4 doub Y N 211 LU2 C3 H3 sing N N 212 LU2 C7 O3 doub N N 213 LU2 C5 C4 sing Y N 214 LU2 O4 C6 sing N N 215 LU2 O4 C9 sing N N 216 LU2 C6 C5 doub Y N 217 LU2 C5 C7 sing N N 218 LU2 C12 O5 sing N N 219 LU2 O5 HO5 sing N N 220 LU2 O6 C13 sing N N 221 LU2 O6 HO6 sing N N 222 LU2 C8 C7 sing N N 223 LU2 C9 C8 doub N N 224 LU2 C8 H8 sing N N 225 LU2 C10 C9 sing N N 226 LU2 C15 C10 doub Y N 227 LU2 C10 C11 sing Y N 228 LU2 C12 C11 doub Y N 229 LU2 C11 H11 sing N N 230 LU2 C13 C12 sing Y N 231 LU2 C14 C13 doub Y N 232 LU2 C14 C15 sing Y N 233 LU2 C14 H14 sing N N 234 LU2 C15 H15 sing N N 235 LYS N CA sing N N 236 LYS N H sing N N 237 LYS N H2 sing N N 238 LYS CA C sing N N 239 LYS CA CB sing N N 240 LYS CA HA sing N N 241 LYS C O doub N N 242 LYS C OXT sing N N 243 LYS CB CG sing N N 244 LYS CB HB2 sing N N 245 LYS CB HB3 sing N N 246 LYS CG CD sing N N 247 LYS CG HG2 sing N N 248 LYS CG HG3 sing N N 249 LYS CD CE sing N N 250 LYS CD HD2 sing N N 251 LYS CD HD3 sing N N 252 LYS CE NZ sing N N 253 LYS CE HE2 sing N N 254 LYS CE HE3 sing N N 255 LYS NZ HZ1 sing N N 256 LYS NZ HZ2 sing N N 257 LYS NZ HZ3 sing N N 258 LYS OXT HXT sing N N 259 MET N CA sing N N 260 MET N H sing N N 261 MET N H2 sing N N 262 MET CA C sing N N 263 MET CA CB sing N N 264 MET CA HA sing N N 265 MET C O doub N N 266 MET C OXT sing N N 267 MET CB CG sing N N 268 MET CB HB2 sing N N 269 MET CB HB3 sing N N 270 MET CG SD sing N N 271 MET CG HG2 sing N N 272 MET CG HG3 sing N N 273 MET SD CE sing N N 274 MET CE HE1 sing N N 275 MET CE HE2 sing N N 276 MET CE HE3 sing N N 277 MET OXT HXT sing N N 278 PEG C1 O1 sing N N 279 PEG C1 C2 sing N N 280 PEG C1 H11 sing N N 281 PEG C1 H12 sing N N 282 PEG O1 HO1 sing N N 283 PEG C2 O2 sing N N 284 PEG C2 H21 sing N N 285 PEG C2 H22 sing N N 286 PEG O2 C3 sing N N 287 PEG C3 C4 sing N N 288 PEG C3 H31 sing N N 289 PEG C3 H32 sing N N 290 PEG C4 O4 sing N N 291 PEG C4 H41 sing N N 292 PEG C4 H42 sing N N 293 PEG O4 HO4 sing N N 294 PGE C1 O1 sing N N 295 PGE C1 C2 sing N N 296 PGE C1 H1 sing N N 297 PGE C1 H12 sing N N 298 PGE O1 HO1 sing N N 299 PGE C2 O2 sing N N 300 PGE C2 H2 sing N N 301 PGE C2 H22 sing N N 302 PGE O2 C3 sing N N 303 PGE C3 C4 sing N N 304 PGE C3 H3 sing N N 305 PGE C3 H32 sing N N 306 PGE C4 O3 sing N N 307 PGE C4 H4 sing N N 308 PGE C4 H42 sing N N 309 PGE O4 C6 sing N N 310 PGE O4 HO4 sing N N 311 PGE C6 C5 sing N N 312 PGE C6 H6 sing N N 313 PGE C6 H62 sing N N 314 PGE C5 O3 sing N N 315 PGE C5 H5 sing N N 316 PGE C5 H52 sing N N 317 PHE N CA sing N N 318 PHE N H sing N N 319 PHE N H2 sing N N 320 PHE CA C sing N N 321 PHE CA CB sing N N 322 PHE CA HA sing N N 323 PHE C O doub N N 324 PHE C OXT sing N N 325 PHE CB CG sing N N 326 PHE CB HB2 sing N N 327 PHE CB HB3 sing N N 328 PHE CG CD1 doub Y N 329 PHE CG CD2 sing Y N 330 PHE CD1 CE1 sing Y N 331 PHE CD1 HD1 sing N N 332 PHE CD2 CE2 doub Y N 333 PHE CD2 HD2 sing N N 334 PHE CE1 CZ doub Y N 335 PHE CE1 HE1 sing N N 336 PHE CE2 CZ sing Y N 337 PHE CE2 HE2 sing N N 338 PHE CZ HZ sing N N 339 PHE OXT HXT sing N N 340 PRO N CA sing N N 341 PRO N CD sing N N 342 PRO N H sing N N 343 PRO CA C sing N N 344 PRO CA CB sing N N 345 PRO CA HA sing N N 346 PRO C O doub N N 347 PRO C OXT sing N N 348 PRO CB CG sing N N 349 PRO CB HB2 sing N N 350 PRO CB HB3 sing N N 351 PRO CG CD sing N N 352 PRO CG HG2 sing N N 353 PRO CG HG3 sing N N 354 PRO CD HD2 sing N N 355 PRO CD HD3 sing N N 356 PRO OXT HXT sing N N 357 SER N CA sing N N 358 SER N H sing N N 359 SER N H2 sing N N 360 SER CA C sing N N 361 SER CA CB sing N N 362 SER CA HA sing N N 363 SER C O doub N N 364 SER C OXT sing N N 365 SER CB OG sing N N 366 SER CB HB2 sing N N 367 SER CB HB3 sing N N 368 SER OG HG sing N N 369 SER OXT HXT sing N N 370 SO4 S O1 doub N N 371 SO4 S O2 doub N N 372 SO4 S O3 sing N N 373 SO4 S O4 sing N N 374 THR N CA sing N N 375 THR N H sing N N 376 THR N H2 sing N N 377 THR CA C sing N N 378 THR CA CB sing N N 379 THR CA HA sing N N 380 THR C O doub N N 381 THR C OXT sing N N 382 THR CB OG1 sing N N 383 THR CB CG2 sing N N 384 THR CB HB sing N N 385 THR OG1 HG1 sing N N 386 THR CG2 HG21 sing N N 387 THR CG2 HG22 sing N N 388 THR CG2 HG23 sing N N 389 THR OXT HXT sing N N 390 TRP N CA sing N N 391 TRP N H sing N N 392 TRP N H2 sing N N 393 TRP CA C sing N N 394 TRP CA CB sing N N 395 TRP CA HA sing N N 396 TRP C O doub N N 397 TRP C OXT sing N N 398 TRP CB CG sing N N 399 TRP CB HB2 sing N N 400 TRP CB HB3 sing N N 401 TRP CG CD1 doub Y N 402 TRP CG CD2 sing Y N 403 TRP CD1 NE1 sing Y N 404 TRP CD1 HD1 sing N N 405 TRP CD2 CE2 doub Y N 406 TRP CD2 CE3 sing Y N 407 TRP NE1 CE2 sing Y N 408 TRP NE1 HE1 sing N N 409 TRP CE2 CZ2 sing Y N 410 TRP CE3 CZ3 doub Y N 411 TRP CE3 HE3 sing N N 412 TRP CZ2 CH2 doub Y N 413 TRP CZ2 HZ2 sing N N 414 TRP CZ3 CH2 sing Y N 415 TRP CZ3 HZ3 sing N N 416 TRP CH2 HH2 sing N N 417 TRP OXT HXT sing N N 418 TYR N CA sing N N 419 TYR N H sing N N 420 TYR N H2 sing N N 421 TYR CA C sing N N 422 TYR CA CB sing N N 423 TYR CA HA sing N N 424 TYR C O doub N N 425 TYR C OXT sing N N 426 TYR CB CG sing N N 427 TYR CB HB2 sing N N 428 TYR CB HB3 sing N N 429 TYR CG CD1 doub Y N 430 TYR CG CD2 sing Y N 431 TYR CD1 CE1 sing Y N 432 TYR CD1 HD1 sing N N 433 TYR CD2 CE2 doub Y N 434 TYR CD2 HD2 sing N N 435 TYR CE1 CZ doub Y N 436 TYR CE1 HE1 sing N N 437 TYR CE2 CZ sing Y N 438 TYR CE2 HE2 sing N N 439 TYR CZ OH sing N N 440 TYR OH HH sing N N 441 TYR OXT HXT sing N N 442 VAL N CA sing N N 443 VAL N H sing N N 444 VAL N H2 sing N N 445 VAL CA C sing N N 446 VAL CA CB sing N N 447 VAL CA HA sing N N 448 VAL C O doub N N 449 VAL C OXT sing N N 450 VAL CB CG1 sing N N 451 VAL CB CG2 sing N N 452 VAL CB HB sing N N 453 VAL CG1 HG11 sing N N 454 VAL CG1 HG12 sing N N 455 VAL CG1 HG13 sing N N 456 VAL CG2 HG21 sing N N 457 VAL CG2 HG22 sing N N 458 VAL CG2 HG23 sing N N 459 VAL OXT HXT sing N N 460 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Ministry of Education (MoE, Czech Republic)' 'Czech Republic' LM2015064 1 'European Regional Development Fund' 'Czech Republic' CZ.02.1.01/0.0/0.0/16_019/0000729 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id LU2 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id LU2 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5CGV _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6YA5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013501 _atom_sites.fract_transf_matrix[1][2] 0.007795 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015590 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007830 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C MG MN N O S # loop_