data_6YDK # _entry.id 6YDK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6YDK pdb_00006ydk 10.2210/pdb6ydk/pdb WWPDB D_1292107424 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-10-28 2 'Structure model' 1 1 2020-11-18 3 'Structure model' 1 2 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_DOI' 5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation_author.identifier_ORCID' 8 3 'Structure model' '_database_2.pdbx_DOI' 9 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6YDK _pdbx_database_status.recvd_initial_deposition_date 2020-03-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wood, H.P.' 1 0000-0003-1820-2295 'Cruz-Navarrete, F.A.' 2 0000-0002-5233-581X 'Baxter, N.J.' 3 ? 'Trevitt, C.R.' 4 ? 'Robertson, A.J.' 5 0000-0002-3762-3450 'Dix, S.R.' 6 0000-0002-6907-1435 'Hounslow, A.M.' 7 ? 'Cliff, M.J.' 8 0000-0002-7482-0234 'Waltho, J.P.' 9 0000-0002-7402-5492 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 5538 _citation.page_last 5538 _citation.title 'Allomorphy as a mechanism of post-translational control of enzyme activity.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-020-19215-9 _citation.pdbx_database_id_PubMed 33139716 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wood, H.P.' 1 ? primary 'Cruz-Navarrete, F.A.' 2 0000-0002-5233-581X primary 'Baxter, N.J.' 3 ? primary 'Trevitt, C.R.' 4 ? primary 'Robertson, A.J.' 5 ? primary 'Dix, S.R.' 6 0000-0002-6907-1435 primary 'Hounslow, A.M.' 7 ? primary 'Cliff, M.J.' 8 0000-0002-7482-0234 primary 'Waltho, J.P.' 9 0000-0002-7402-5492 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Beta-phosphoglucomutase 24213.557 1 5.4.2.6 'P146A, K125R, Y206H' ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 water nat water 18.015 34 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Beta-PGM # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNY VKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKAAPDIFIAAAHAVGV APSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK ; _entity_poly.pdbx_seq_one_letter_code_can ;MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNY VKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKAAPDIFIAAAHAVGV APSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PHE n 1 3 LYS n 1 4 ALA n 1 5 VAL n 1 6 LEU n 1 7 PHE n 1 8 ASP n 1 9 LEU n 1 10 ASP n 1 11 GLY n 1 12 VAL n 1 13 ILE n 1 14 THR n 1 15 ASP n 1 16 THR n 1 17 ALA n 1 18 GLU n 1 19 TYR n 1 20 HIS n 1 21 PHE n 1 22 ARG n 1 23 ALA n 1 24 TRP n 1 25 LYS n 1 26 ALA n 1 27 LEU n 1 28 ALA n 1 29 GLU n 1 30 GLU n 1 31 ILE n 1 32 GLY n 1 33 ILE n 1 34 ASN n 1 35 GLY n 1 36 VAL n 1 37 ASP n 1 38 ARG n 1 39 GLN n 1 40 PHE n 1 41 ASN n 1 42 GLU n 1 43 GLN n 1 44 LEU n 1 45 LYS n 1 46 GLY n 1 47 VAL n 1 48 SER n 1 49 ARG n 1 50 GLU n 1 51 ASP n 1 52 SER n 1 53 LEU n 1 54 GLN n 1 55 LYS n 1 56 ILE n 1 57 LEU n 1 58 ASP n 1 59 LEU n 1 60 ALA n 1 61 ASP n 1 62 LYS n 1 63 LYS n 1 64 VAL n 1 65 SER n 1 66 ALA n 1 67 GLU n 1 68 GLU n 1 69 PHE n 1 70 LYS n 1 71 GLU n 1 72 LEU n 1 73 ALA n 1 74 LYS n 1 75 ARG n 1 76 LYS n 1 77 ASN n 1 78 ASP n 1 79 ASN n 1 80 TYR n 1 81 VAL n 1 82 LYS n 1 83 MET n 1 84 ILE n 1 85 GLN n 1 86 ASP n 1 87 VAL n 1 88 SER n 1 89 PRO n 1 90 ALA n 1 91 ASP n 1 92 VAL n 1 93 TYR n 1 94 PRO n 1 95 GLY n 1 96 ILE n 1 97 LEU n 1 98 GLN n 1 99 LEU n 1 100 LEU n 1 101 LYS n 1 102 ASP n 1 103 LEU n 1 104 ARG n 1 105 SER n 1 106 ASN n 1 107 LYS n 1 108 ILE n 1 109 LYS n 1 110 ILE n 1 111 ALA n 1 112 LEU n 1 113 ALA n 1 114 SER n 1 115 ALA n 1 116 SER n 1 117 LYS n 1 118 ASN n 1 119 GLY n 1 120 PRO n 1 121 PHE n 1 122 LEU n 1 123 LEU n 1 124 GLU n 1 125 ARG n 1 126 MET n 1 127 ASN n 1 128 LEU n 1 129 THR n 1 130 GLY n 1 131 TYR n 1 132 PHE n 1 133 ASP n 1 134 ALA n 1 135 ILE n 1 136 ALA n 1 137 ASP n 1 138 PRO n 1 139 ALA n 1 140 GLU n 1 141 VAL n 1 142 ALA n 1 143 ALA n 1 144 SER n 1 145 LYS n 1 146 ALA n 1 147 ALA n 1 148 PRO n 1 149 ASP n 1 150 ILE n 1 151 PHE n 1 152 ILE n 1 153 ALA n 1 154 ALA n 1 155 ALA n 1 156 HIS n 1 157 ALA n 1 158 VAL n 1 159 GLY n 1 160 VAL n 1 161 ALA n 1 162 PRO n 1 163 SER n 1 164 GLU n 1 165 SER n 1 166 ILE n 1 167 GLY n 1 168 LEU n 1 169 GLU n 1 170 ASP n 1 171 SER n 1 172 GLN n 1 173 ALA n 1 174 GLY n 1 175 ILE n 1 176 GLN n 1 177 ALA n 1 178 ILE n 1 179 LYS n 1 180 ASP n 1 181 SER n 1 182 GLY n 1 183 ALA n 1 184 LEU n 1 185 PRO n 1 186 ILE n 1 187 GLY n 1 188 VAL n 1 189 GLY n 1 190 ARG n 1 191 PRO n 1 192 GLU n 1 193 ASP n 1 194 LEU n 1 195 GLY n 1 196 ASP n 1 197 ASP n 1 198 ILE n 1 199 VAL n 1 200 ILE n 1 201 VAL n 1 202 PRO n 1 203 ASP n 1 204 THR n 1 205 SER n 1 206 HIS n 1 207 TYR n 1 208 THR n 1 209 LEU n 1 210 GLU n 1 211 PHE n 1 212 LEU n 1 213 LYS n 1 214 GLU n 1 215 VAL n 1 216 TRP n 1 217 LEU n 1 218 GLN n 1 219 LYS n 1 220 GLN n 1 221 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 221 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'pgmB, LL0429, L0001' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain IL1403 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lactococcus lactis subsp. lactis (strain IL1403)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 272623 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 MET 126 126 126 MET MET A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 TYR 131 131 131 TYR TYR A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 PRO 148 148 148 PRO PRO A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 HIS 156 156 156 HIS HIS A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 PRO 162 162 162 PRO PRO A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 GLN 172 172 172 GLN GLN A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 GLN 176 176 176 GLN GLN A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 ILE 178 178 178 ILE ILE A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 SER 181 181 181 SER SER A . n A 1 182 GLY 182 182 182 GLY GLY A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 ASP 193 193 193 ASP ASP A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 ASP 196 196 196 ASP ASP A . n A 1 197 ASP 197 197 197 ASP ASP A . n A 1 198 ILE 198 198 198 ILE ILE A . n A 1 199 VAL 199 199 199 VAL VAL A . n A 1 200 ILE 200 200 200 ILE ILE A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 PRO 202 202 202 PRO PRO A . n A 1 203 ASP 203 203 203 ASP ASP A . n A 1 204 THR 204 204 204 THR THR A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 HIS 206 206 206 HIS HIS A . n A 1 207 TYR 207 207 207 TYR TYR A . n A 1 208 THR 208 208 208 THR THR A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 GLU 210 210 210 GLU GLU A . n A 1 211 PHE 211 211 211 PHE PHE A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 LYS 213 213 213 LYS LYS A . n A 1 214 GLU 214 214 214 GLU GLU A . n A 1 215 VAL 215 215 215 VAL VAL A . n A 1 216 TRP 216 216 216 TRP TRP A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 GLN 218 218 218 GLN GLN A . n A 1 219 LYS 219 219 219 LYS LYS A . n A 1 220 GLN 220 220 220 GLN GLN A . n A 1 221 LYS 221 221 221 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 301 1 MG MG A . C 3 HOH 1 401 12 HOH HOH A . C 3 HOH 2 402 7 HOH HOH A . C 3 HOH 3 403 18 HOH HOH A . C 3 HOH 4 404 3 HOH HOH A . C 3 HOH 5 405 17 HOH HOH A . C 3 HOH 6 406 30 HOH HOH A . C 3 HOH 7 407 2 HOH HOH A . C 3 HOH 8 408 9 HOH HOH A . C 3 HOH 9 409 29 HOH HOH A . C 3 HOH 10 410 20 HOH HOH A . C 3 HOH 11 411 27 HOH HOH A . C 3 HOH 12 412 13 HOH HOH A . C 3 HOH 13 413 15 HOH HOH A . C 3 HOH 14 414 26 HOH HOH A . C 3 HOH 15 415 24 HOH HOH A . C 3 HOH 16 416 4 HOH HOH A . C 3 HOH 17 417 22 HOH HOH A . C 3 HOH 18 418 16 HOH HOH A . C 3 HOH 19 419 33 HOH HOH A . C 3 HOH 20 420 11 HOH HOH A . C 3 HOH 21 421 5 HOH HOH A . C 3 HOH 22 422 34 HOH HOH A . C 3 HOH 23 423 6 HOH HOH A . C 3 HOH 24 424 1 HOH HOH A . C 3 HOH 25 425 10 HOH HOH A . C 3 HOH 26 426 21 HOH HOH A . C 3 HOH 27 427 25 HOH HOH A . C 3 HOH 28 428 14 HOH HOH A . C 3 HOH 29 429 23 HOH HOH A . C 3 HOH 30 430 28 HOH HOH A . C 3 HOH 31 431 8 HOH HOH A . C 3 HOH 32 432 31 HOH HOH A . C 3 HOH 33 433 32 HOH HOH A . C 3 HOH 34 434 19 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? 'Wolfgang Kabsch' Wolfgang.Kabsch@mpimf-heidelberg.mpg.de ? ? ? ? ? http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/ ? XDS ? ? package . 1 ? 'data scaling' ? ? 'Graeme Winter' ? ? ? ? ? ? http://www.ccp4.ac.uk/html/xia2.html ? xia2 ? ? program . 2 ? phasing ? ? 'Randy J. Read' cimr-phaser@lists.cam.ac.uk 'Fri Aug 26 16:52:48 2016 (svn exported)' ? ? ? ? http://www-structmed.cimr.cam.ac.uk/phaser/ ? PHASER ? ? program 2.6.1 3 ? refinement ? ? 'Garib N. Murshudov' garib@ysbl.york.ac.uk ? ? ? ? Fortran_77 http://www.ccp4.ac.uk/dist/html/refmac5.html ? REFMAC ? ? program 5.8.0155 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Apr. 1, 2019' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.25 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6YDK _cell.details ? _cell.formula_units_Z ? _cell.length_a 53.300 _cell.length_a_esd ? _cell.length_b 56.240 _cell.length_b_esd ? _cell.length_c 77.660 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6YDK _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6YDK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 9.62 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 87.21 _exptl_crystal.description 'Thin rod shaped' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;PEG 4000 (24% w/v), sodium acetate (200 mM), TRIS (100 mM), HEPES (50 mM), magnesium chloride (5 mM), EDTA (1 mM), sodium azide (2 mM), beta-phosphoglucomutase (0.5 mM). Seeded with 10,000x dilution of much smaller protein crystals grown under the same conditions but with 0.2 mM beta-phosphoglucomutase. ; _exptl_crystal_grow.pdbx_pH_range 7.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-02-24 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 0.97950 _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97950 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97950 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 32.196 _reflns.entry_id 6YDK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.020 _reflns.d_resolution_low 43.950 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15683 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.600 _reflns.pdbx_Rmerge_I_obs 0.075 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.081 _reflns.pdbx_Rpim_I_all 0.031 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.020 2.050 ? 1.200 ? ? ? ? 686 88.900 ? ? ? ? 0.953 ? ? ? ? ? ? ? ? 3.700 ? ? ? ? 1.090 0.506 ? 1 1 0.556 ? ? 5.480 43.960 ? 41.900 ? ? ? ? 895 100.000 ? ? ? ? ? ? ? ? ? ? ? ? ? 6.400 ? ? ? ? 0.032 0.012 ? 2 1 1.0 ? ? # _refine.aniso_B[1][1] -0.2700 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -0.3600 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.6300 _refine.B_iso_max 106.670 _refine.B_iso_mean 42.7070 _refine.B_iso_min 23.100 _refine.correlation_coeff_Fo_to_Fc 0.9500 _refine.correlation_coeff_Fo_to_Fc_free 0.9370 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6YDK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.0200 _refine.ls_d_res_low 43.9500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14863 _refine.ls_number_reflns_R_free 777 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.4900 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2174 _refine.ls_R_factor_R_free 0.2507 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2156 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2WHE _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.2100 _refine.pdbx_overall_ESU_R_Free 0.1780 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 5.4170 _refine.overall_SU_ML 0.1430 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.0200 _refine_hist.d_res_low 43.9500 _refine_hist.number_atoms_solvent 34 _refine_hist.number_atoms_total 1741 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 221 _refine_hist.pdbx_B_iso_mean_ligand 45.54 _refine_hist.pdbx_B_iso_mean_solvent 38.25 _refine_hist.pdbx_number_atoms_protein 1706 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 0.019 1742 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1709 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.489 1.977 2357 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.958 3.000 3947 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.164 5.000 222 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 41.886 25.769 78 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.025 15.000 313 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 22.923 15.000 7 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.080 0.200 267 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.021 1978 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 363 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.0200 _refine_ls_shell.d_res_low 2.0720 _refine_ls_shell.number_reflns_all 1020 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 60 _refine_ls_shell.number_reflns_R_work 960 _refine_ls_shell.percent_reflns_obs 88.7000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3160 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3170 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6YDK _struct.title 'Substrate-free P146A variant of beta-phosphoglucomutase from Lactococcus lactis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6YDK _struct_keywords.text 'cis-trans proline isomerization, allomorphy, phosphoryl transfer, enzyme regulation, ISOMERASE' _struct_keywords.pdbx_keywords ISOMERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PGMB_LACLA _struct_ref.pdbx_db_accession P71447 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNY VKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLEKMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGV APSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSYYTLEFLKEVWLQKQK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6YDK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 221 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P71447 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 221 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 221 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6YDK ARG A 125 ? UNP P71447 LYS 125 'engineered mutation' 125 1 1 6YDK ALA A 146 ? UNP P71447 PRO 146 'engineered mutation' 146 2 1 6YDK HIS A 206 ? UNP P71447 TYR 206 'engineered mutation' 206 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 100 ? 1 MORE -8 ? 1 'SSA (A^2)' 11070 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 16 ? GLY A 32 ? THR A 16 GLY A 32 1 ? 17 HELX_P HELX_P2 AA2 ASP A 37 ? GLU A 42 ? ASP A 37 GLU A 42 1 ? 6 HELX_P HELX_P3 AA3 GLN A 43 ? LYS A 45 ? GLN A 43 LYS A 45 5 ? 3 HELX_P HELX_P4 AA4 SER A 48 ? LEU A 59 ? SER A 48 LEU A 59 1 ? 12 HELX_P HELX_P5 AA5 SER A 65 ? ILE A 84 ? SER A 65 ILE A 84 1 ? 20 HELX_P HELX_P6 AA6 GLN A 85 ? VAL A 87 ? GLN A 85 VAL A 87 5 ? 3 HELX_P HELX_P7 AA7 SER A 88 ? VAL A 92 ? SER A 88 VAL A 92 5 ? 5 HELX_P HELX_P8 AA8 GLY A 95 ? ASN A 106 ? GLY A 95 ASN A 106 1 ? 12 HELX_P HELX_P9 AA9 ASN A 118 ? MET A 126 ? ASN A 118 MET A 126 1 ? 9 HELX_P HELX_P10 AB1 LEU A 128 ? PHE A 132 ? LEU A 128 PHE A 132 5 ? 5 HELX_P HELX_P11 AB2 PRO A 148 ? VAL A 158 ? PRO A 148 VAL A 158 1 ? 11 HELX_P HELX_P12 AB3 ALA A 161 ? SER A 163 ? ALA A 161 SER A 163 5 ? 3 HELX_P HELX_P13 AB4 SER A 171 ? GLY A 182 ? SER A 171 GLY A 182 1 ? 12 HELX_P HELX_P14 AB5 ARG A 190 ? GLY A 195 ? ARG A 190 GLY A 195 1 ? 6 HELX_P HELX_P15 AB6 ASP A 203 ? TYR A 207 ? ASP A 203 TYR A 207 5 ? 5 HELX_P HELX_P16 AB7 THR A 208 ? LYS A 221 ? THR A 208 LYS A 221 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 8 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 8 A MG 301 1_555 ? ? ? ? ? ? ? 1.946 ? ? metalc2 metalc ? ? A ASP 10 O ? ? ? 1_555 B MG . MG ? ? A ASP 10 A MG 301 1_555 ? ? ? ? ? ? ? 1.995 ? ? metalc3 metalc ? ? A ASP 170 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 170 A MG 301 1_555 ? ? ? ? ? ? ? 2.179 ? ? metalc4 metalc ? ? B MG . MG ? ? ? 1_555 C HOH . O ? ? A MG 301 A HOH 410 1_555 ? ? ? ? ? ? ? 2.134 ? ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 C HOH . O ? ? A MG 301 A HOH 419 1_555 ? ? ? ? ? ? ? 2.227 ? ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 C HOH . O ? ? A MG 301 A HOH 422 1_555 ? ? ? ? ? ? ? 2.196 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 8 ? A ASP 8 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? A ASP 10 ? A ASP 10 ? 1_555 95.9 ? 2 OD2 ? A ASP 8 ? A ASP 8 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 OD1 ? A ASP 170 ? A ASP 170 ? 1_555 106.3 ? 3 O ? A ASP 10 ? A ASP 10 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 OD1 ? A ASP 170 ? A ASP 170 ? 1_555 99.4 ? 4 OD2 ? A ASP 8 ? A ASP 8 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 410 ? 1_555 87.9 ? 5 O ? A ASP 10 ? A ASP 10 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 410 ? 1_555 175.9 ? 6 OD1 ? A ASP 170 ? A ASP 170 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 410 ? 1_555 80.9 ? 7 OD2 ? A ASP 8 ? A ASP 8 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 419 ? 1_555 83.4 ? 8 O ? A ASP 10 ? A ASP 10 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 419 ? 1_555 94.5 ? 9 OD1 ? A ASP 170 ? A ASP 170 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 419 ? 1_555 162.0 ? 10 O ? C HOH . ? A HOH 410 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 419 ? 1_555 84.5 ? 11 OD2 ? A ASP 8 ? A ASP 8 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 422 ? 1_555 165.1 ? 12 O ? A ASP 10 ? A ASP 10 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 422 ? 1_555 91.2 ? 13 OD1 ? A ASP 170 ? A ASP 170 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 422 ? 1_555 85.3 ? 14 O ? C HOH . ? A HOH 410 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 422 ? 1_555 84.7 ? 15 O ? C HOH . ? A HOH 419 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? C HOH . ? A HOH 422 ? 1_555 83.0 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 134 ? ILE A 135 ? ALA A 134 ILE A 135 AA1 2 LYS A 109 ? LEU A 112 ? LYS A 109 LEU A 112 AA1 3 ALA A 4 ? PHE A 7 ? ALA A 4 PHE A 7 AA1 4 SER A 165 ? GLU A 169 ? SER A 165 GLU A 169 AA1 5 LEU A 184 ? VAL A 188 ? LEU A 184 VAL A 188 AA1 6 VAL A 199 ? VAL A 201 ? VAL A 199 VAL A 201 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ALA A 134 ? O ALA A 134 N LEU A 112 ? N LEU A 112 AA1 2 3 O ALA A 111 ? O ALA A 111 N PHE A 7 ? N PHE A 7 AA1 3 4 N LEU A 6 ? N LEU A 6 O ILE A 166 ? O ILE A 166 AA1 4 5 N SER A 165 ? N SER A 165 O LEU A 184 ? O LEU A 184 AA1 5 6 N GLY A 187 ? N GLY A 187 O VAL A 199 ? O VAL A 199 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id MG _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 7 _struct_site.details 'binding site for residue MG A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ASP A 8 ? ASP A 8 . ? 1_555 ? 2 AC1 7 ASP A 10 ? ASP A 10 . ? 1_555 ? 3 AC1 7 GLU A 169 ? GLU A 169 . ? 1_555 ? 4 AC1 7 ASP A 170 ? ASP A 170 . ? 1_555 ? 5 AC1 7 HOH C . ? HOH A 410 . ? 1_555 ? 6 AC1 7 HOH C . ? HOH A 419 . ? 1_555 ? 7 AC1 7 HOH C . ? HOH A 422 . ? 1_555 ? # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CG _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 MET _pdbx_validate_rmsd_angle.auth_seq_id_1 1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 SD _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 MET _pdbx_validate_rmsd_angle.auth_seq_id_2 1 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CE _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 MET _pdbx_validate_rmsd_angle.auth_seq_id_3 1 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 87.93 _pdbx_validate_rmsd_angle.angle_target_value 100.20 _pdbx_validate_rmsd_angle.angle_deviation -12.27 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.60 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 9 ? ? -94.49 -71.68 2 1 VAL A 12 ? ? -122.75 -63.68 3 1 ALA A 146 ? ? 64.12 -0.38 # _pdbx_phasing_MR.entry_id 6YDK _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 6.310 _pdbx_phasing_MR.d_res_low_rotation 43.950 _pdbx_phasing_MR.d_res_high_translation 6.310 _pdbx_phasing_MR.d_res_low_translation 43.950 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # _pdbx_entry_details.entry_id 6YDK _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 MG MG MG N N 236 PHE N N N N 237 PHE CA C N S 238 PHE C C N N 239 PHE O O N N 240 PHE CB C N N 241 PHE CG C Y N 242 PHE CD1 C Y N 243 PHE CD2 C Y N 244 PHE CE1 C Y N 245 PHE CE2 C Y N 246 PHE CZ C Y N 247 PHE OXT O N N 248 PHE H H N N 249 PHE H2 H N N 250 PHE HA H N N 251 PHE HB2 H N N 252 PHE HB3 H N N 253 PHE HD1 H N N 254 PHE HD2 H N N 255 PHE HE1 H N N 256 PHE HE2 H N N 257 PHE HZ H N N 258 PHE HXT H N N 259 PRO N N N N 260 PRO CA C N S 261 PRO C C N N 262 PRO O O N N 263 PRO CB C N N 264 PRO CG C N N 265 PRO CD C N N 266 PRO OXT O N N 267 PRO H H N N 268 PRO HA H N N 269 PRO HB2 H N N 270 PRO HB3 H N N 271 PRO HG2 H N N 272 PRO HG3 H N N 273 PRO HD2 H N N 274 PRO HD3 H N N 275 PRO HXT H N N 276 SER N N N N 277 SER CA C N S 278 SER C C N N 279 SER O O N N 280 SER CB C N N 281 SER OG O N N 282 SER OXT O N N 283 SER H H N N 284 SER H2 H N N 285 SER HA H N N 286 SER HB2 H N N 287 SER HB3 H N N 288 SER HG H N N 289 SER HXT H N N 290 THR N N N N 291 THR CA C N S 292 THR C C N N 293 THR O O N N 294 THR CB C N R 295 THR OG1 O N N 296 THR CG2 C N N 297 THR OXT O N N 298 THR H H N N 299 THR H2 H N N 300 THR HA H N N 301 THR HB H N N 302 THR HG1 H N N 303 THR HG21 H N N 304 THR HG22 H N N 305 THR HG23 H N N 306 THR HXT H N N 307 TRP N N N N 308 TRP CA C N S 309 TRP C C N N 310 TRP O O N N 311 TRP CB C N N 312 TRP CG C Y N 313 TRP CD1 C Y N 314 TRP CD2 C Y N 315 TRP NE1 N Y N 316 TRP CE2 C Y N 317 TRP CE3 C Y N 318 TRP CZ2 C Y N 319 TRP CZ3 C Y N 320 TRP CH2 C Y N 321 TRP OXT O N N 322 TRP H H N N 323 TRP H2 H N N 324 TRP HA H N N 325 TRP HB2 H N N 326 TRP HB3 H N N 327 TRP HD1 H N N 328 TRP HE1 H N N 329 TRP HE3 H N N 330 TRP HZ2 H N N 331 TRP HZ3 H N N 332 TRP HH2 H N N 333 TRP HXT H N N 334 TYR N N N N 335 TYR CA C N S 336 TYR C C N N 337 TYR O O N N 338 TYR CB C N N 339 TYR CG C Y N 340 TYR CD1 C Y N 341 TYR CD2 C Y N 342 TYR CE1 C Y N 343 TYR CE2 C Y N 344 TYR CZ C Y N 345 TYR OH O N N 346 TYR OXT O N N 347 TYR H H N N 348 TYR H2 H N N 349 TYR HA H N N 350 TYR HB2 H N N 351 TYR HB3 H N N 352 TYR HD1 H N N 353 TYR HD2 H N N 354 TYR HE1 H N N 355 TYR HE2 H N N 356 TYR HH H N N 357 TYR HXT H N N 358 VAL N N N N 359 VAL CA C N S 360 VAL C C N N 361 VAL O O N N 362 VAL CB C N N 363 VAL CG1 C N N 364 VAL CG2 C N N 365 VAL OXT O N N 366 VAL H H N N 367 VAL H2 H N N 368 VAL HA H N N 369 VAL HB H N N 370 VAL HG11 H N N 371 VAL HG12 H N N 372 VAL HG13 H N N 373 VAL HG21 H N N 374 VAL HG22 H N N 375 VAL HG23 H N N 376 VAL HXT H N N 377 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Biotechnology and Biological Sciences Research Council (BBSRC)' 'United Kingdom' X/009906-20-26 1 'Biotechnology and Biological Sciences Research Council (BBSRC)' 'United Kingdom' BB/M021637/1 2 'Biotechnology and Biological Sciences Research Council (BBSRC)' 'United Kingdom' BB/S007965/1 3 'Biotechnology and Biological Sciences Research Council (BBSRC)' 'United Kingdom' BB/P007066/1 4 'Consejo Nacional de Ciencia y Tecnologia (CONACYT)' Mexico 472448 5 'Royal Society' 'United Kingdom' R/152968 6 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id MG _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id MG _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2WHE _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6YDK _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.018762 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017781 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012877 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C MG N O S # loop_