data_6YEU # _entry.id 6YEU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6YEU pdb_00006yeu 10.2210/pdb6yeu/pdb WWPDB D_1292107149 ? ? BMRB 34504 ? 10.13018/BMR34504 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-03-31 2 'Structure model' 1 1 2021-06-09 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' 14 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 15 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 6YEU _pdbx_database_status.recvd_initial_deposition_date 2020-03-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Second EH domain of AtEH1/Pan1' _pdbx_database_related.db_id 34504 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yperman, K.' 1 0000-0002-7542-1155 'Papageorgiou, A.' 2 ? 'Evangelidis, T.' 3 ? 'Van Damme, D.' 4 0000-0002-9385-4851 'Tripsianes, K.' 5 0000-0003-0948-813X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 3050 _citation.page_last 3050 _citation.title 'Distinct EH domains of the endocytic TPLATE complex confer lipid and protein binding.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-021-23314-6 _citation.pdbx_database_id_PubMed 34031427 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yperman, K.' 1 0000-0002-7542-1155 primary 'Papageorgiou, A.C.' 2 ? primary 'Merceron, R.' 3 ? primary 'De Munck, S.' 4 ? primary 'Bloch, Y.' 5 0000-0001-7924-3539 primary 'Eeckhout, D.' 6 0000-0001-5770-7670 primary 'Jiang, Q.' 7 ? primary 'Tack, P.' 8 0000-0001-8437-6678 primary 'Grigoryan, R.' 9 0000-0002-0909-9217 primary 'Evangelidis, T.' 10 ? primary 'Van Leene, J.' 11 0000-0002-4932-8192 primary 'Vincze, L.' 12 ? primary 'Vandenabeele, P.' 13 ? primary 'Vanhaecke, F.' 14 0000-0002-1884-3853 primary 'Potocky, M.' 15 0000-0002-3699-7549 primary 'De Jaeger, G.' 16 0000-0001-6558-5669 primary 'Savvides, S.N.' 17 0000-0003-3420-5947 primary 'Tripsianes, K.' 18 0000-0003-0948-813X primary 'Pleskot, R.' 19 0000-0003-0436-9748 primary 'Van Damme, D.' 20 0000-0002-9385-4851 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Calcium-binding EF hand family protein' 11736.118 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name F2D10.25 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GGMAGQNPNMDQFEAYFKRADLDGDGRISGAEAVGFFQGSGLSKQVLAQIWSLSDRSHSGFLDRQNFYNSLRLVTVAQSK RDLTPEIVNAALNTPAAAKIPPPKINLSA ; _entity_poly.pdbx_seq_one_letter_code_can ;GGMAGQNPNMDQFEAYFKRADLDGDGRISGAEAVGFFQGSGLSKQVLAQIWSLSDRSHSGFLDRQNFYNSLRLVTVAQSK RDLTPEIVNAALNTPAAAKIPPPKINLSA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 MET n 1 4 ALA n 1 5 GLY n 1 6 GLN n 1 7 ASN n 1 8 PRO n 1 9 ASN n 1 10 MET n 1 11 ASP n 1 12 GLN n 1 13 PHE n 1 14 GLU n 1 15 ALA n 1 16 TYR n 1 17 PHE n 1 18 LYS n 1 19 ARG n 1 20 ALA n 1 21 ASP n 1 22 LEU n 1 23 ASP n 1 24 GLY n 1 25 ASP n 1 26 GLY n 1 27 ARG n 1 28 ILE n 1 29 SER n 1 30 GLY n 1 31 ALA n 1 32 GLU n 1 33 ALA n 1 34 VAL n 1 35 GLY n 1 36 PHE n 1 37 PHE n 1 38 GLN n 1 39 GLY n 1 40 SER n 1 41 GLY n 1 42 LEU n 1 43 SER n 1 44 LYS n 1 45 GLN n 1 46 VAL n 1 47 LEU n 1 48 ALA n 1 49 GLN n 1 50 ILE n 1 51 TRP n 1 52 SER n 1 53 LEU n 1 54 SER n 1 55 ASP n 1 56 ARG n 1 57 SER n 1 58 HIS n 1 59 SER n 1 60 GLY n 1 61 PHE n 1 62 LEU n 1 63 ASP n 1 64 ARG n 1 65 GLN n 1 66 ASN n 1 67 PHE n 1 68 TYR n 1 69 ASN n 1 70 SER n 1 71 LEU n 1 72 ARG n 1 73 LEU n 1 74 VAL n 1 75 THR n 1 76 VAL n 1 77 ALA n 1 78 GLN n 1 79 SER n 1 80 LYS n 1 81 ARG n 1 82 ASP n 1 83 LEU n 1 84 THR n 1 85 PRO n 1 86 GLU n 1 87 ILE n 1 88 VAL n 1 89 ASN n 1 90 ALA n 1 91 ALA n 1 92 LEU n 1 93 ASN n 1 94 THR n 1 95 PRO n 1 96 ALA n 1 97 ALA n 1 98 ALA n 1 99 LYS n 1 100 ILE n 1 101 PRO n 1 102 PRO n 1 103 PRO n 1 104 LYS n 1 105 ILE n 1 106 ASN n 1 107 LEU n 1 108 SER n 1 109 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 109 _entity_src_gen.gene_src_common_name 'Thale cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'At1g20760, F2D10.25, F2D10_25' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pET _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET22b_EH11 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 GLY 2 0 ? ? ? A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 ALA 4 2 2 ALA ALA A . n A 1 5 GLY 5 3 3 GLY GLY A . n A 1 6 GLN 6 4 4 GLN GLN A . n A 1 7 ASN 7 5 5 ASN ASN A . n A 1 8 PRO 8 6 6 PRO PRO A . n A 1 9 ASN 9 7 7 ASN ASN A . n A 1 10 MET 10 8 8 MET MET A . n A 1 11 ASP 11 9 9 ASP ASP A . n A 1 12 GLN 12 10 10 GLN GLN A . n A 1 13 PHE 13 11 11 PHE PHE A . n A 1 14 GLU 14 12 12 GLU GLU A . n A 1 15 ALA 15 13 13 ALA ALA A . n A 1 16 TYR 16 14 14 TYR TYR A . n A 1 17 PHE 17 15 15 PHE PHE A . n A 1 18 LYS 18 16 16 LYS LYS A . n A 1 19 ARG 19 17 17 ARG ARG A . n A 1 20 ALA 20 18 18 ALA ALA A . n A 1 21 ASP 21 19 19 ASP ASP A . n A 1 22 LEU 22 20 20 LEU LEU A . n A 1 23 ASP 23 21 21 ASP ASP A . n A 1 24 GLY 24 22 22 GLY GLY A . n A 1 25 ASP 25 23 23 ASP ASP A . n A 1 26 GLY 26 24 24 GLY GLY A . n A 1 27 ARG 27 25 25 ARG ARG A . n A 1 28 ILE 28 26 26 ILE ILE A . n A 1 29 SER 29 27 27 SER SER A . n A 1 30 GLY 30 28 28 GLY GLY A . n A 1 31 ALA 31 29 29 ALA ALA A . n A 1 32 GLU 32 30 30 GLU GLU A . n A 1 33 ALA 33 31 31 ALA ALA A . n A 1 34 VAL 34 32 32 VAL VAL A . n A 1 35 GLY 35 33 33 GLY GLY A . n A 1 36 PHE 36 34 34 PHE PHE A . n A 1 37 PHE 37 35 35 PHE PHE A . n A 1 38 GLN 38 36 36 GLN GLN A . n A 1 39 GLY 39 37 37 GLY GLY A . n A 1 40 SER 40 38 38 SER SER A . n A 1 41 GLY 41 39 39 GLY GLY A . n A 1 42 LEU 42 40 40 LEU LEU A . n A 1 43 SER 43 41 41 SER SER A . n A 1 44 LYS 44 42 42 LYS LYS A . n A 1 45 GLN 45 43 43 GLN GLN A . n A 1 46 VAL 46 44 44 VAL VAL A . n A 1 47 LEU 47 45 45 LEU LEU A . n A 1 48 ALA 48 46 46 ALA ALA A . n A 1 49 GLN 49 47 47 GLN GLN A . n A 1 50 ILE 50 48 48 ILE ILE A . n A 1 51 TRP 51 49 49 TRP TRP A . n A 1 52 SER 52 50 50 SER SER A . n A 1 53 LEU 53 51 51 LEU LEU A . n A 1 54 SER 54 52 52 SER SER A . n A 1 55 ASP 55 53 53 ASP ASP A . n A 1 56 ARG 56 54 54 ARG ARG A . n A 1 57 SER 57 55 55 SER SER A . n A 1 58 HIS 58 56 56 HIS HIS A . n A 1 59 SER 59 57 57 SER SER A . n A 1 60 GLY 60 58 58 GLY GLY A . n A 1 61 PHE 61 59 59 PHE PHE A . n A 1 62 LEU 62 60 60 LEU LEU A . n A 1 63 ASP 63 61 61 ASP ASP A . n A 1 64 ARG 64 62 62 ARG ARG A . n A 1 65 GLN 65 63 63 GLN GLN A . n A 1 66 ASN 66 64 64 ASN ASN A . n A 1 67 PHE 67 65 65 PHE PHE A . n A 1 68 TYR 68 66 66 TYR TYR A . n A 1 69 ASN 69 67 67 ASN ASN A . n A 1 70 SER 70 68 68 SER SER A . n A 1 71 LEU 71 69 69 LEU LEU A . n A 1 72 ARG 72 70 70 ARG ARG A . n A 1 73 LEU 73 71 71 LEU LEU A . n A 1 74 VAL 74 72 72 VAL VAL A . n A 1 75 THR 75 73 73 THR THR A . n A 1 76 VAL 76 74 74 VAL VAL A . n A 1 77 ALA 77 75 75 ALA ALA A . n A 1 78 GLN 78 76 76 GLN GLN A . n A 1 79 SER 79 77 77 SER SER A . n A 1 80 LYS 80 78 78 LYS LYS A . n A 1 81 ARG 81 79 79 ARG ARG A . n A 1 82 ASP 82 80 80 ASP ASP A . n A 1 83 LEU 83 81 81 LEU LEU A . n A 1 84 THR 84 82 82 THR THR A . n A 1 85 PRO 85 83 83 PRO PRO A . n A 1 86 GLU 86 84 84 GLU GLU A . n A 1 87 ILE 87 85 85 ILE ILE A . n A 1 88 VAL 88 86 86 VAL VAL A . n A 1 89 ASN 89 87 87 ASN ASN A . n A 1 90 ALA 90 88 88 ALA ALA A . n A 1 91 ALA 91 89 89 ALA ALA A . n A 1 92 LEU 92 90 90 LEU LEU A . n A 1 93 ASN 93 91 91 ASN ASN A . n A 1 94 THR 94 92 92 THR THR A . n A 1 95 PRO 95 93 93 PRO PRO A . n A 1 96 ALA 96 94 94 ALA ALA A . n A 1 97 ALA 97 95 95 ALA ALA A . n A 1 98 ALA 98 96 96 ALA ALA A . n A 1 99 LYS 99 97 97 LYS LYS A . n A 1 100 ILE 100 98 98 ILE ILE A . n A 1 101 PRO 101 99 99 PRO PRO A . n A 1 102 PRO 102 100 100 PRO PRO A . n A 1 103 PRO 103 101 101 PRO PRO A . n A 1 104 LYS 104 102 102 LYS LYS A . n A 1 105 ILE 105 103 103 ILE ILE A . n A 1 106 ASN 106 104 104 ASN ASN A . n A 1 107 LEU 107 105 105 LEU LEU A . n A 1 108 SER 108 106 106 SER SER A . n A 1 109 ALA 109 107 107 ALA ALA A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CA _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 999 _pdbx_nonpoly_scheme.pdb_mon_id CA _pdbx_nonpoly_scheme.auth_mon_id CA _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6YEU _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 6YEU _struct.title 'Second EH domain of AtEH1/Pan1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6YEU _struct_keywords.text 'Adaptor protein, EF-hand, EH domain, Calcium-binding, peptide motif binding, PEPTIDE BINDING PROTEIN' _struct_keywords.pdbx_keywords 'PEPTIDE BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9LM78_ARATH _struct_ref.pdbx_db_accession Q9LM78 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAGQNPNMDQFEAYFKRADLDGDGRISGAEAVGFFQGSGLSKQVLAQIWSLSDRSHSGFLDRQNFYNSLRLVTVAQSKRD LTPEIVNAALNTPAAAKIPPPKINLSA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6YEU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 109 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9LM78 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 107 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 107 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6YEU GLY A 1 ? UNP Q9LM78 ? ? 'expression tag' -1 1 1 6YEU GLY A 2 ? UNP Q9LM78 ? ? 'expression tag' 0 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 90 ? 1 MORE -13 ? 1 'SSA (A^2)' 6190 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 7 ? ASP A 21 ? ASN A 5 ASP A 19 1 ? 15 HELX_P HELX_P2 AA2 GLY A 30 ? GLN A 38 ? GLY A 28 GLN A 36 1 ? 9 HELX_P HELX_P3 AA3 SER A 43 ? ASP A 55 ? SER A 41 ASP A 53 1 ? 13 HELX_P HELX_P4 AA4 ASP A 63 ? SER A 79 ? ASP A 61 SER A 77 1 ? 17 HELX_P HELX_P5 AA5 THR A 84 ? ASN A 93 ? THR A 82 ASN A 91 1 ? 10 HELX_P HELX_P6 AA6 THR A 94 ? LYS A 99 ? THR A 92 LYS A 97 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 21 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 19 A CA 201 1_555 ? ? ? ? ? ? ? 2.428 ? ? metalc2 metalc ? ? A ASP 23 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 21 A CA 201 1_555 ? ? ? ? ? ? ? 2.417 ? ? metalc3 metalc ? ? A ASP 25 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 23 A CA 201 1_555 ? ? ? ? ? ? ? 2.412 ? ? metalc4 metalc ? ? A ARG 27 O ? ? ? 1_555 B CA . CA ? ? A ARG 25 A CA 201 1_555 ? ? ? ? ? ? ? 2.382 ? ? metalc5 metalc ? ? A GLU 32 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 30 A CA 201 1_555 ? ? ? ? ? ? ? 2.420 ? ? metalc6 metalc ? ? A GLU 32 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 30 A CA 201 1_555 ? ? ? ? ? ? ? 2.394 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 21 ? A ASP 19 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 23 ? A ASP 21 ? 1_555 79.7 ? 2 OD1 ? A ASP 21 ? A ASP 19 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 25 ? A ASP 23 ? 1_555 89.6 ? 3 OD1 ? A ASP 23 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 25 ? A ASP 23 ? 1_555 73.2 ? 4 OD1 ? A ASP 21 ? A ASP 19 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A ARG 27 ? A ARG 25 ? 1_555 86.1 ? 5 OD1 ? A ASP 23 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A ARG 27 ? A ARG 25 ? 1_555 144.9 ? 6 OD1 ? A ASP 25 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A ARG 27 ? A ARG 25 ? 1_555 74.7 ? 7 OD1 ? A ASP 21 ? A ASP 19 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 32 ? A GLU 30 ? 1_555 86.2 ? 8 OD1 ? A ASP 23 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 32 ? A GLU 30 ? 1_555 77.3 ? 9 OD1 ? A ASP 25 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 32 ? A GLU 30 ? 1_555 150.5 ? 10 O ? A ARG 27 ? A ARG 25 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 32 ? A GLU 30 ? 1_555 133.9 ? 11 OD1 ? A ASP 21 ? A ASP 19 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 32 ? A GLU 30 ? 1_555 89.2 ? 12 OD1 ? A ASP 23 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 32 ? A GLU 30 ? 1_555 132.2 ? 13 OD1 ? A ASP 25 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 32 ? A GLU 30 ? 1_555 153.7 ? 14 O ? A ARG 27 ? A ARG 25 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 32 ? A GLU 30 ? 1_555 79.0 ? 15 OE1 ? A GLU 32 ? A GLU 30 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 32 ? A GLU 30 ? 1_555 55.5 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 28 ? SER A 29 ? ILE A 26 SER A 27 AA1 2 PHE A 61 ? LEU A 62 ? PHE A 59 LEU A 60 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 28 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 26 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LEU _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 62 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 60 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CA _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'binding site for residue CA A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 21 ? ASP A 19 . ? 1_555 ? 2 AC1 6 ASP A 23 ? ASP A 21 . ? 1_555 ? 3 AC1 6 ASP A 25 ? ASP A 23 . ? 1_555 ? 4 AC1 6 ARG A 27 ? ARG A 25 . ? 1_555 ? 5 AC1 6 SER A 29 ? SER A 27 . ? 1_555 ? 6 AC1 6 GLU A 32 ? GLU A 30 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 12 ? ? HH21 A ARG 62 ? ? 1.57 2 3 OE2 A GLU 12 ? ? HH21 A ARG 62 ? ? 1.59 3 13 HG1 A THR 82 ? ? OE2 A GLU 84 ? ? 1.59 4 15 OE2 A GLU 12 ? ? HH21 A ARG 62 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 105 ? ? -120.25 -70.35 2 1 SER A 106 ? ? -148.83 27.11 3 2 LEU A 105 ? ? -93.72 -63.29 4 3 ALA A 2 ? ? -95.89 36.61 5 4 ALA A 2 ? ? -94.11 56.46 6 4 LEU A 105 ? ? -93.32 -63.76 7 5 ALA A 2 ? ? -152.62 -32.27 8 6 ALA A 2 ? ? 65.27 -80.50 9 6 SER A 106 ? ? -103.00 48.60 10 8 ALA A 2 ? ? -115.96 68.34 11 8 GLN A 4 ? ? -56.16 108.67 12 11 SER A 106 ? ? -169.38 104.72 13 12 ALA A 2 ? ? -155.44 52.53 14 13 LEU A 105 ? ? -96.39 -61.89 15 15 LEU A 105 ? ? -130.95 -43.90 16 16 LYS A 78 ? ? 70.13 33.90 17 16 SER A 106 ? ? -142.51 17.91 18 17 LEU A 105 ? ? -120.81 -52.30 19 19 LEU A 105 ? ? -107.53 -61.17 20 20 GLN A 4 ? ? -78.32 29.03 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 25 ? ? 0.075 'SIDE CHAIN' 2 4 ARG A 79 ? ? 0.076 'SIDE CHAIN' 3 7 ARG A 79 ? ? 0.099 'SIDE CHAIN' 4 8 ARG A 25 ? ? 0.089 'SIDE CHAIN' # _pdbx_entry_details.entry_id 6YEU _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_nmr_ensemble.entry_id 6YEU _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 6YEU _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM [U-99% 13C; U-99% 15N] EH11, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label sample_1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component EH11 _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-99% 13C; U-99% 15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label sample_conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '4D HC(CC TOCSY(CO))NH' 1 isotropic 2 1 1 '4D 13C,15N edited HMQC-NOESY-HSQC' 1 isotropic 3 1 1 '4D 13C,13C edited HMQC-NOESY-HSQC' 1 isotropic 4 1 1 '3D 13C edited NOESY-HSQC' 1 isotropic # _pdbx_nmr_refine.entry_id 6YEU _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger A. T. et.al.' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' 4D-CHAINS ? 'Evangelidis and Tripsianes' 4 'peak picking' Sparky ? Goddard # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A GLY 0 ? A GLY 2 3 2 Y 1 A GLY -1 ? A GLY 1 4 2 Y 1 A GLY 0 ? A GLY 2 5 3 Y 1 A GLY -1 ? A GLY 1 6 3 Y 1 A GLY 0 ? A GLY 2 7 4 Y 1 A GLY -1 ? A GLY 1 8 4 Y 1 A GLY 0 ? A GLY 2 9 5 Y 1 A GLY -1 ? A GLY 1 10 5 Y 1 A GLY 0 ? A GLY 2 11 6 Y 1 A GLY -1 ? A GLY 1 12 6 Y 1 A GLY 0 ? A GLY 2 13 7 Y 1 A GLY -1 ? A GLY 1 14 7 Y 1 A GLY 0 ? A GLY 2 15 8 Y 1 A GLY -1 ? A GLY 1 16 8 Y 1 A GLY 0 ? A GLY 2 17 9 Y 1 A GLY -1 ? A GLY 1 18 9 Y 1 A GLY 0 ? A GLY 2 19 10 Y 1 A GLY -1 ? A GLY 1 20 10 Y 1 A GLY 0 ? A GLY 2 21 11 Y 1 A GLY -1 ? A GLY 1 22 11 Y 1 A GLY 0 ? A GLY 2 23 12 Y 1 A GLY -1 ? A GLY 1 24 12 Y 1 A GLY 0 ? A GLY 2 25 13 Y 1 A GLY -1 ? A GLY 1 26 13 Y 1 A GLY 0 ? A GLY 2 27 14 Y 1 A GLY -1 ? A GLY 1 28 14 Y 1 A GLY 0 ? A GLY 2 29 15 Y 1 A GLY -1 ? A GLY 1 30 15 Y 1 A GLY 0 ? A GLY 2 31 16 Y 1 A GLY -1 ? A GLY 1 32 16 Y 1 A GLY 0 ? A GLY 2 33 17 Y 1 A GLY -1 ? A GLY 1 34 17 Y 1 A GLY 0 ? A GLY 2 35 18 Y 1 A GLY -1 ? A GLY 1 36 18 Y 1 A GLY 0 ? A GLY 2 37 19 Y 1 A GLY -1 ? A GLY 1 38 19 Y 1 A GLY 0 ? A GLY 2 39 20 Y 1 A GLY -1 ? A GLY 1 40 20 Y 1 A GLY 0 ? A GLY 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 ILE N N N N 145 ILE CA C N S 146 ILE C C N N 147 ILE O O N N 148 ILE CB C N S 149 ILE CG1 C N N 150 ILE CG2 C N N 151 ILE CD1 C N N 152 ILE OXT O N N 153 ILE H H N N 154 ILE H2 H N N 155 ILE HA H N N 156 ILE HB H N N 157 ILE HG12 H N N 158 ILE HG13 H N N 159 ILE HG21 H N N 160 ILE HG22 H N N 161 ILE HG23 H N N 162 ILE HD11 H N N 163 ILE HD12 H N N 164 ILE HD13 H N N 165 ILE HXT H N N 166 LEU N N N N 167 LEU CA C N S 168 LEU C C N N 169 LEU O O N N 170 LEU CB C N N 171 LEU CG C N N 172 LEU CD1 C N N 173 LEU CD2 C N N 174 LEU OXT O N N 175 LEU H H N N 176 LEU H2 H N N 177 LEU HA H N N 178 LEU HB2 H N N 179 LEU HB3 H N N 180 LEU HG H N N 181 LEU HD11 H N N 182 LEU HD12 H N N 183 LEU HD13 H N N 184 LEU HD21 H N N 185 LEU HD22 H N N 186 LEU HD23 H N N 187 LEU HXT H N N 188 LYS N N N N 189 LYS CA C N S 190 LYS C C N N 191 LYS O O N N 192 LYS CB C N N 193 LYS CG C N N 194 LYS CD C N N 195 LYS CE C N N 196 LYS NZ N N N 197 LYS OXT O N N 198 LYS H H N N 199 LYS H2 H N N 200 LYS HA H N N 201 LYS HB2 H N N 202 LYS HB3 H N N 203 LYS HG2 H N N 204 LYS HG3 H N N 205 LYS HD2 H N N 206 LYS HD3 H N N 207 LYS HE2 H N N 208 LYS HE3 H N N 209 LYS HZ1 H N N 210 LYS HZ2 H N N 211 LYS HZ3 H N N 212 LYS HXT H N N 213 MET N N N N 214 MET CA C N S 215 MET C C N N 216 MET O O N N 217 MET CB C N N 218 MET CG C N N 219 MET SD S N N 220 MET CE C N N 221 MET OXT O N N 222 MET H H N N 223 MET H2 H N N 224 MET HA H N N 225 MET HB2 H N N 226 MET HB3 H N N 227 MET HG2 H N N 228 MET HG3 H N N 229 MET HE1 H N N 230 MET HE2 H N N 231 MET HE3 H N N 232 MET HXT H N N 233 PHE N N N N 234 PHE CA C N S 235 PHE C C N N 236 PHE O O N N 237 PHE CB C N N 238 PHE CG C Y N 239 PHE CD1 C Y N 240 PHE CD2 C Y N 241 PHE CE1 C Y N 242 PHE CE2 C Y N 243 PHE CZ C Y N 244 PHE OXT O N N 245 PHE H H N N 246 PHE H2 H N N 247 PHE HA H N N 248 PHE HB2 H N N 249 PHE HB3 H N N 250 PHE HD1 H N N 251 PHE HD2 H N N 252 PHE HE1 H N N 253 PHE HE2 H N N 254 PHE HZ H N N 255 PHE HXT H N N 256 PRO N N N N 257 PRO CA C N S 258 PRO C C N N 259 PRO O O N N 260 PRO CB C N N 261 PRO CG C N N 262 PRO CD C N N 263 PRO OXT O N N 264 PRO H H N N 265 PRO HA H N N 266 PRO HB2 H N N 267 PRO HB3 H N N 268 PRO HG2 H N N 269 PRO HG3 H N N 270 PRO HD2 H N N 271 PRO HD3 H N N 272 PRO HXT H N N 273 SER N N N N 274 SER CA C N S 275 SER C C N N 276 SER O O N N 277 SER CB C N N 278 SER OG O N N 279 SER OXT O N N 280 SER H H N N 281 SER H2 H N N 282 SER HA H N N 283 SER HB2 H N N 284 SER HB3 H N N 285 SER HG H N N 286 SER HXT H N N 287 THR N N N N 288 THR CA C N S 289 THR C C N N 290 THR O O N N 291 THR CB C N R 292 THR OG1 O N N 293 THR CG2 C N N 294 THR OXT O N N 295 THR H H N N 296 THR H2 H N N 297 THR HA H N N 298 THR HB H N N 299 THR HG1 H N N 300 THR HG21 H N N 301 THR HG22 H N N 302 THR HG23 H N N 303 THR HXT H N N 304 TRP N N N N 305 TRP CA C N S 306 TRP C C N N 307 TRP O O N N 308 TRP CB C N N 309 TRP CG C Y N 310 TRP CD1 C Y N 311 TRP CD2 C Y N 312 TRP NE1 N Y N 313 TRP CE2 C Y N 314 TRP CE3 C Y N 315 TRP CZ2 C Y N 316 TRP CZ3 C Y N 317 TRP CH2 C Y N 318 TRP OXT O N N 319 TRP H H N N 320 TRP H2 H N N 321 TRP HA H N N 322 TRP HB2 H N N 323 TRP HB3 H N N 324 TRP HD1 H N N 325 TRP HE1 H N N 326 TRP HE3 H N N 327 TRP HZ2 H N N 328 TRP HZ3 H N N 329 TRP HH2 H N N 330 TRP HXT H N N 331 TYR N N N N 332 TYR CA C N S 333 TYR C C N N 334 TYR O O N N 335 TYR CB C N N 336 TYR CG C Y N 337 TYR CD1 C Y N 338 TYR CD2 C Y N 339 TYR CE1 C Y N 340 TYR CE2 C Y N 341 TYR CZ C Y N 342 TYR OH O N N 343 TYR OXT O N N 344 TYR H H N N 345 TYR H2 H N N 346 TYR HA H N N 347 TYR HB2 H N N 348 TYR HB3 H N N 349 TYR HD1 H N N 350 TYR HD2 H N N 351 TYR HE1 H N N 352 TYR HE2 H N N 353 TYR HH H N N 354 TYR HXT H N N 355 VAL N N N N 356 VAL CA C N S 357 VAL C C N N 358 VAL O O N N 359 VAL CB C N N 360 VAL CG1 C N N 361 VAL CG2 C N N 362 VAL OXT O N N 363 VAL H H N N 364 VAL H2 H N N 365 VAL HA H N N 366 VAL HB H N N 367 VAL HG11 H N N 368 VAL HG12 H N N 369 VAL HG13 H N N 370 VAL HG21 H N N 371 VAL HG22 H N N 372 VAL HG23 H N N 373 VAL HXT H N N 374 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'European Union (EU)' ? 'INSTRUCT-ERIC PID: 6554' 1 'European Research Council (ERC)' ? 682436 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id CA _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id CA _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 850 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 6YEU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA H N O S # loop_