data_6YHT # _entry.id 6YHT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6YHT pdb_00006yht 10.2210/pdb6yht/pdb WWPDB D_1292107647 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-04-14 2 'Structure model' 1 1 2021-10-27 3 'Structure model' 1 2 2024-01-24 4 'Structure model' 1 3 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Refinement description' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_database_proc 5 3 'Structure model' chem_comp_atom 6 3 'Structure model' chem_comp_bond 7 3 'Structure model' pdbx_initial_refinement_model 8 4 'Structure model' pdbx_entry_details 9 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_database_2.pdbx_DOI' 14 2 'Structure model' '_database_2.pdbx_database_accession' 15 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6YHT _pdbx_database_status.recvd_initial_deposition_date 2020-03-31 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Saikia, C.' 1 ? 'Altman-Gueta, H.' 2 ? 'Dym, O.' 3 ? 'Frolow, F.' 4 ? 'Gurevitz, M.' 5 ? 'Gordon, D.' 6 ? 'Reuveny, E.' 7 ? 'Karbat, I.' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 433 _citation.language ? _citation.page_first 166957 _citation.page_last 166957 _citation.title 'A Molecular Lid Mechanism of K + Channel Blocker Action Revealed by a Cone Peptide.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2021.166957 _citation.pdbx_database_id_PubMed 33771569 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Saikia, C.' 1 ? primary 'Dym, O.' 2 ? primary 'Altman-Gueta, H.' 3 ? primary 'Gordon, D.' 4 ? primary 'Reuveny, E.' 5 ? primary 'Karbat, I.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Conk-C1 6665.451 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 non-polymer syn 'CITRIC ACID' 192.124 1 ? ? ? ? 4 water nat water 18.015 10 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GLPSLCYEPADSGSGTKSEKRIYYNSARKQCLRFTYNGKGGNANNFIHTFDCQHTCLYK _entity_poly.pdbx_seq_one_letter_code_can GLPSLCYEPADSGSGTKSEKRIYYNSARKQCLRFTYNGKGGNANNFIHTFDCQHTCLYK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'CITRIC ACID' CIT 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LEU n 1 3 PRO n 1 4 SER n 1 5 LEU n 1 6 CYS n 1 7 TYR n 1 8 GLU n 1 9 PRO n 1 10 ALA n 1 11 ASP n 1 12 SER n 1 13 GLY n 1 14 SER n 1 15 GLY n 1 16 THR n 1 17 LYS n 1 18 SER n 1 19 GLU n 1 20 LYS n 1 21 ARG n 1 22 ILE n 1 23 TYR n 1 24 TYR n 1 25 ASN n 1 26 SER n 1 27 ALA n 1 28 ARG n 1 29 LYS n 1 30 GLN n 1 31 CYS n 1 32 LEU n 1 33 ARG n 1 34 PHE n 1 35 THR n 1 36 TYR n 1 37 ASN n 1 38 GLY n 1 39 LYS n 1 40 GLY n 1 41 GLY n 1 42 ASN n 1 43 ALA n 1 44 ASN n 1 45 ASN n 1 46 PHE n 1 47 ILE n 1 48 HIS n 1 49 THR n 1 50 PHE n 1 51 ASP n 1 52 CYS n 1 53 GLN n 1 54 HIS n 1 55 THR n 1 56 CYS n 1 57 LEU n 1 58 TYR n 1 59 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 59 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Conus cocceus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2547880 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CIT non-polymer . 'CITRIC ACID' ? 'C6 H8 O7' 192.124 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 2 ? ? ? A . n A 1 2 LEU 2 3 3 LEU LEU A . n A 1 3 PRO 3 4 4 PRO PRO A . n A 1 4 SER 4 5 5 SER SER A . n A 1 5 LEU 5 6 6 LEU LEU A . n A 1 6 CYS 6 7 7 CYS CYS A . n A 1 7 TYR 7 8 8 TYR TYR A . n A 1 8 GLU 8 9 9 GLU GLU A . n A 1 9 PRO 9 10 10 PRO PRO A . n A 1 10 ALA 10 11 11 ALA ALA A . n A 1 11 ASP 11 12 12 ASP ASP A . n A 1 12 SER 12 13 13 SER SER A . n A 1 13 GLY 13 14 14 GLY GLY A . n A 1 14 SER 14 15 15 SER SER A . n A 1 15 GLY 15 16 16 GLY GLY A . n A 1 16 THR 16 17 17 THR THR A . n A 1 17 LYS 17 18 18 LYS LYS A . n A 1 18 SER 18 19 19 SER SER A . n A 1 19 GLU 19 20 20 GLU GLU A . n A 1 20 LYS 20 21 21 LYS LYS A . n A 1 21 ARG 21 22 22 ARG ARG A . n A 1 22 ILE 22 23 23 ILE ILE A . n A 1 23 TYR 23 24 24 TYR TYR A . n A 1 24 TYR 24 25 25 TYR TYR A . n A 1 25 ASN 25 26 26 ASN ASN A . n A 1 26 SER 26 27 27 SER SER A . n A 1 27 ALA 27 28 28 ALA ALA A . n A 1 28 ARG 28 29 29 ARG ARG A . n A 1 29 LYS 29 30 30 LYS LYS A . n A 1 30 GLN 30 31 31 GLN GLN A . n A 1 31 CYS 31 32 32 CYS CYS A . n A 1 32 LEU 32 33 33 LEU LEU A . n A 1 33 ARG 33 34 34 ARG ARG A . n A 1 34 PHE 34 35 35 PHE PHE A . n A 1 35 THR 35 36 36 THR THR A . n A 1 36 TYR 36 37 37 TYR TYR A . n A 1 37 ASN 37 38 38 ASN ASN A . n A 1 38 GLY 38 39 39 GLY GLY A . n A 1 39 LYS 39 40 40 LYS LYS A . n A 1 40 GLY 40 41 41 GLY GLY A . n A 1 41 GLY 41 42 42 GLY GLY A . n A 1 42 ASN 42 43 43 ASN ASN A . n A 1 43 ALA 43 44 44 ALA ALA A . n A 1 44 ASN 44 45 45 ASN ASN A . n A 1 45 ASN 45 46 46 ASN ASN A . n A 1 46 PHE 46 47 47 PHE PHE A . n A 1 47 ILE 47 48 48 ILE ILE A . n A 1 48 HIS 48 49 49 HIS HIS A . n A 1 49 THR 49 50 50 THR THR A . n A 1 50 PHE 50 51 51 PHE PHE A . n A 1 51 ASP 51 52 52 ASP ASP A . n A 1 52 CYS 52 53 53 CYS CYS A . n A 1 53 GLN 53 54 54 GLN GLN A . n A 1 54 HIS 54 55 55 HIS HIS A . n A 1 55 THR 55 56 56 THR THR A . n A 1 56 CYS 56 57 57 CYS CYS A . n A 1 57 LEU 57 58 58 LEU LEU A . n A 1 58 TYR 58 59 ? ? ? A . n A 1 59 LYS 59 60 ? ? ? A . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 CIT ? ? CIT ? ? 'SUBJECT OF INVESTIGATION' ? 2 SO4 ? ? SO4 ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 101 71 SO4 SO4 A . C 2 SO4 1 102 72 SO4 SO4 A . D 3 CIT 1 103 426 CIT CIT A . E 4 HOH 1 201 98 HOH HOH A . E 4 HOH 2 202 94 HOH HOH A . E 4 HOH 3 203 93 HOH HOH A . E 4 HOH 4 204 92 HOH HOH A . E 4 HOH 5 205 99 HOH HOH A . E 4 HOH 6 206 97 HOH HOH A . E 4 HOH 7 207 102 HOH HOH A . E 4 HOH 8 208 91 HOH HOH A . E 4 HOH 9 209 96 HOH HOH A . E 4 HOH 10 210 100 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 18 ? CE ? A LYS 17 CE 2 1 Y 1 A LYS 18 ? NZ ? A LYS 17 NZ 3 1 Y 1 A LYS 40 ? CE ? A LYS 39 CE 4 1 Y 1 A LYS 40 ? NZ ? A LYS 39 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6YHT _cell.details ? _cell.formula_units_Z ? _cell.length_a 68.609 _cell.length_a_esd ? _cell.length_b 68.609 _cell.length_b_esd ? _cell.length_c 68.609 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6YHT _symmetry.cell_setting ? _symmetry.Int_Tables_number 198 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6YHT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.04 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 69.54 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.100M Sodium citrate tribasic dihydrate pH 5.6 20.00% v/v Isopropanol 20.00% w/v Polyethylene glycol 4,000 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-11-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97625 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97625 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6YHT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.15 _reflns.d_resolution_low 39.61 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12142 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.97 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20 _reflns.pdbx_Rmerge_I_obs 0.02 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.58 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.027 _reflns.pdbx_Rpim_I_all 0.02 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.15 _reflns_shell.d_res_low 2.227 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.91 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1206 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.3515 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.4971 _reflns_shell.pdbx_Rpim_I_all 0.3515 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.695 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 98.670 _refine.B_iso_mean 63.6919 _refine.B_iso_min 30.000 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6YHT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1500 _refine.ls_d_res_low 39.6100 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11362 _refine.ls_number_reflns_R_free 562 _refine.ls_number_reflns_R_work 10800 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9800 _refine.ls_percent_reflns_R_free 4.9500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2064 _refine.ls_R_factor_R_free 0.2218 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2056 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1Y62 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.9800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.1500 _refine_hist.d_res_low 39.6100 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 468 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 56 _refine_hist.pdbx_B_iso_mean_ligand 82.72 _refine_hist.pdbx_B_iso_mean_solvent 56.97 _refine_hist.pdbx_number_atoms_protein 438 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1500 2.3700 2863 . 148 2715 100.0000 . . . 0.3174 0.0000 0.2722 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.3700 2.7100 2813 . 142 2671 100.0000 . . . 0.2942 0.0000 0.2756 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.7100 3.4100 2837 . 136 2701 100.0000 . . . 0.2954 0.0000 0.2501 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.4100 39.6100 2849 . 136 2713 100.0000 . . . 0.1750 0.0000 0.1735 . . . . . . . 4 . . . # _struct.entry_id 6YHT _struct.title 'A lid blocking mechanism of a cone snail toxin revealed at the atomic level' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6YHT _struct_keywords.text 'conkunitzin-3, TOXIN' _struct_keywords.pdbx_keywords TOXIN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 6YHT _struct_ref.pdbx_db_accession 6YHT _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6YHT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 59 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 6YHT _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 60 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 60 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 340 ? 1 MORE -9 ? 1 'SSA (A^2)' 3980 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 3 ? GLU A 8 ? PRO A 4 GLU A 9 5 ? 6 HELX_P HELX_P2 AA2 HIS A 48 ? LEU A 57 ? HIS A 49 LEU A 58 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 56 SG ? ? A CYS 7 A CYS 57 1_555 ? ? ? ? ? ? ? 2.006 ? ? disulf2 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 52 SG ? ? A CYS 32 A CYS 53 1_555 ? ? ? ? ? ? ? 2.022 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 6 ? CYS A 56 ? CYS A 7 ? 1_555 CYS A 57 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 31 ? CYS A 52 ? CYS A 32 ? 1_555 CYS A 53 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 19 ? ASN A 25 ? GLU A 20 ASN A 26 AA1 2 GLN A 30 ? TYR A 36 ? GLN A 31 TYR A 37 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 23 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 24 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LEU _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 32 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 33 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 101 ? 4 'binding site for residue SO4 A 101' AC2 Software A SO4 102 ? 3 'binding site for residue SO4 A 102' AC3 Software A CIT 103 ? 4 'binding site for residue CIT A 103' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ASN A 25 ? ASN A 26 . ? 11_545 ? 2 AC1 4 ARG A 28 ? ARG A 29 . ? 11_545 ? 3 AC1 4 ARG A 28 ? ARG A 29 . ? 8_544 ? 4 AC1 4 HOH E . ? HOH A 209 . ? 1_555 ? 5 AC2 3 ILE A 47 ? ILE A 48 . ? 1_555 ? 6 AC2 3 HIS A 48 ? HIS A 49 . ? 9_555 ? 7 AC2 3 THR A 49 ? THR A 50 . ? 9_555 ? 8 AC3 4 PRO A 3 ? PRO A 4 . ? 1_555 ? 9 AC3 4 SER A 4 ? SER A 5 . ? 1_555 ? 10 AC3 4 LEU A 5 ? LEU A 6 . ? 1_555 ? 11 AC3 4 SER A 18 ? SER A 19 . ? 11_545 ? # _pdbx_entry_details.entry_id 6YHT _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 15 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -150.95 _pdbx_validate_torsion.psi -6.46 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A SO4 101 ? B SO4 . 2 1 A SO4 101 ? B SO4 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 2 ? A GLY 1 2 1 Y 1 A TYR 59 ? A TYR 58 3 1 Y 1 A LYS 60 ? A LYS 59 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CIT C1 C N N 74 CIT O1 O N N 75 CIT O2 O N N 76 CIT C2 C N N 77 CIT C3 C N N 78 CIT O7 O N N 79 CIT C4 C N N 80 CIT C5 C N N 81 CIT O3 O N N 82 CIT O4 O N N 83 CIT C6 C N N 84 CIT O5 O N N 85 CIT O6 O N N 86 CIT HO2 H N N 87 CIT H21 H N N 88 CIT H22 H N N 89 CIT HO7 H N N 90 CIT H41 H N N 91 CIT H42 H N N 92 CIT HO4 H N N 93 CIT HO6 H N N 94 CYS N N N N 95 CYS CA C N R 96 CYS C C N N 97 CYS O O N N 98 CYS CB C N N 99 CYS SG S N N 100 CYS OXT O N N 101 CYS H H N N 102 CYS H2 H N N 103 CYS HA H N N 104 CYS HB2 H N N 105 CYS HB3 H N N 106 CYS HG H N N 107 CYS HXT H N N 108 GLN N N N N 109 GLN CA C N S 110 GLN C C N N 111 GLN O O N N 112 GLN CB C N N 113 GLN CG C N N 114 GLN CD C N N 115 GLN OE1 O N N 116 GLN NE2 N N N 117 GLN OXT O N N 118 GLN H H N N 119 GLN H2 H N N 120 GLN HA H N N 121 GLN HB2 H N N 122 GLN HB3 H N N 123 GLN HG2 H N N 124 GLN HG3 H N N 125 GLN HE21 H N N 126 GLN HE22 H N N 127 GLN HXT H N N 128 GLU N N N N 129 GLU CA C N S 130 GLU C C N N 131 GLU O O N N 132 GLU CB C N N 133 GLU CG C N N 134 GLU CD C N N 135 GLU OE1 O N N 136 GLU OE2 O N N 137 GLU OXT O N N 138 GLU H H N N 139 GLU H2 H N N 140 GLU HA H N N 141 GLU HB2 H N N 142 GLU HB3 H N N 143 GLU HG2 H N N 144 GLU HG3 H N N 145 GLU HE2 H N N 146 GLU HXT H N N 147 GLY N N N N 148 GLY CA C N N 149 GLY C C N N 150 GLY O O N N 151 GLY OXT O N N 152 GLY H H N N 153 GLY H2 H N N 154 GLY HA2 H N N 155 GLY HA3 H N N 156 GLY HXT H N N 157 HIS N N N N 158 HIS CA C N S 159 HIS C C N N 160 HIS O O N N 161 HIS CB C N N 162 HIS CG C Y N 163 HIS ND1 N Y N 164 HIS CD2 C Y N 165 HIS CE1 C Y N 166 HIS NE2 N Y N 167 HIS OXT O N N 168 HIS H H N N 169 HIS H2 H N N 170 HIS HA H N N 171 HIS HB2 H N N 172 HIS HB3 H N N 173 HIS HD1 H N N 174 HIS HD2 H N N 175 HIS HE1 H N N 176 HIS HE2 H N N 177 HIS HXT H N N 178 HOH O O N N 179 HOH H1 H N N 180 HOH H2 H N N 181 ILE N N N N 182 ILE CA C N S 183 ILE C C N N 184 ILE O O N N 185 ILE CB C N S 186 ILE CG1 C N N 187 ILE CG2 C N N 188 ILE CD1 C N N 189 ILE OXT O N N 190 ILE H H N N 191 ILE H2 H N N 192 ILE HA H N N 193 ILE HB H N N 194 ILE HG12 H N N 195 ILE HG13 H N N 196 ILE HG21 H N N 197 ILE HG22 H N N 198 ILE HG23 H N N 199 ILE HD11 H N N 200 ILE HD12 H N N 201 ILE HD13 H N N 202 ILE HXT H N N 203 LEU N N N N 204 LEU CA C N S 205 LEU C C N N 206 LEU O O N N 207 LEU CB C N N 208 LEU CG C N N 209 LEU CD1 C N N 210 LEU CD2 C N N 211 LEU OXT O N N 212 LEU H H N N 213 LEU H2 H N N 214 LEU HA H N N 215 LEU HB2 H N N 216 LEU HB3 H N N 217 LEU HG H N N 218 LEU HD11 H N N 219 LEU HD12 H N N 220 LEU HD13 H N N 221 LEU HD21 H N N 222 LEU HD22 H N N 223 LEU HD23 H N N 224 LEU HXT H N N 225 LYS N N N N 226 LYS CA C N S 227 LYS C C N N 228 LYS O O N N 229 LYS CB C N N 230 LYS CG C N N 231 LYS CD C N N 232 LYS CE C N N 233 LYS NZ N N N 234 LYS OXT O N N 235 LYS H H N N 236 LYS H2 H N N 237 LYS HA H N N 238 LYS HB2 H N N 239 LYS HB3 H N N 240 LYS HG2 H N N 241 LYS HG3 H N N 242 LYS HD2 H N N 243 LYS HD3 H N N 244 LYS HE2 H N N 245 LYS HE3 H N N 246 LYS HZ1 H N N 247 LYS HZ2 H N N 248 LYS HZ3 H N N 249 LYS HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 SO4 S S N N 305 SO4 O1 O N N 306 SO4 O2 O N N 307 SO4 O3 O N N 308 SO4 O4 O N N 309 THR N N N N 310 THR CA C N S 311 THR C C N N 312 THR O O N N 313 THR CB C N R 314 THR OG1 O N N 315 THR CG2 C N N 316 THR OXT O N N 317 THR H H N N 318 THR H2 H N N 319 THR HA H N N 320 THR HB H N N 321 THR HG1 H N N 322 THR HG21 H N N 323 THR HG22 H N N 324 THR HG23 H N N 325 THR HXT H N N 326 TYR N N N N 327 TYR CA C N S 328 TYR C C N N 329 TYR O O N N 330 TYR CB C N N 331 TYR CG C Y N 332 TYR CD1 C Y N 333 TYR CD2 C Y N 334 TYR CE1 C Y N 335 TYR CE2 C Y N 336 TYR CZ C Y N 337 TYR OH O N N 338 TYR OXT O N N 339 TYR H H N N 340 TYR H2 H N N 341 TYR HA H N N 342 TYR HB2 H N N 343 TYR HB3 H N N 344 TYR HD1 H N N 345 TYR HD2 H N N 346 TYR HE1 H N N 347 TYR HE2 H N N 348 TYR HH H N N 349 TYR HXT H N N 350 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CIT C1 O1 doub N N 70 CIT C1 O2 sing N N 71 CIT C1 C2 sing N N 72 CIT O2 HO2 sing N N 73 CIT C2 C3 sing N N 74 CIT C2 H21 sing N N 75 CIT C2 H22 sing N N 76 CIT C3 O7 sing N N 77 CIT C3 C4 sing N N 78 CIT C3 C6 sing N N 79 CIT O7 HO7 sing N N 80 CIT C4 C5 sing N N 81 CIT C4 H41 sing N N 82 CIT C4 H42 sing N N 83 CIT C5 O3 doub N N 84 CIT C5 O4 sing N N 85 CIT O4 HO4 sing N N 86 CIT C6 O5 doub N N 87 CIT C6 O6 sing N N 88 CIT O6 HO6 sing N N 89 CYS N CA sing N N 90 CYS N H sing N N 91 CYS N H2 sing N N 92 CYS CA C sing N N 93 CYS CA CB sing N N 94 CYS CA HA sing N N 95 CYS C O doub N N 96 CYS C OXT sing N N 97 CYS CB SG sing N N 98 CYS CB HB2 sing N N 99 CYS CB HB3 sing N N 100 CYS SG HG sing N N 101 CYS OXT HXT sing N N 102 GLN N CA sing N N 103 GLN N H sing N N 104 GLN N H2 sing N N 105 GLN CA C sing N N 106 GLN CA CB sing N N 107 GLN CA HA sing N N 108 GLN C O doub N N 109 GLN C OXT sing N N 110 GLN CB CG sing N N 111 GLN CB HB2 sing N N 112 GLN CB HB3 sing N N 113 GLN CG CD sing N N 114 GLN CG HG2 sing N N 115 GLN CG HG3 sing N N 116 GLN CD OE1 doub N N 117 GLN CD NE2 sing N N 118 GLN NE2 HE21 sing N N 119 GLN NE2 HE22 sing N N 120 GLN OXT HXT sing N N 121 GLU N CA sing N N 122 GLU N H sing N N 123 GLU N H2 sing N N 124 GLU CA C sing N N 125 GLU CA CB sing N N 126 GLU CA HA sing N N 127 GLU C O doub N N 128 GLU C OXT sing N N 129 GLU CB CG sing N N 130 GLU CB HB2 sing N N 131 GLU CB HB3 sing N N 132 GLU CG CD sing N N 133 GLU CG HG2 sing N N 134 GLU CG HG3 sing N N 135 GLU CD OE1 doub N N 136 GLU CD OE2 sing N N 137 GLU OE2 HE2 sing N N 138 GLU OXT HXT sing N N 139 GLY N CA sing N N 140 GLY N H sing N N 141 GLY N H2 sing N N 142 GLY CA C sing N N 143 GLY CA HA2 sing N N 144 GLY CA HA3 sing N N 145 GLY C O doub N N 146 GLY C OXT sing N N 147 GLY OXT HXT sing N N 148 HIS N CA sing N N 149 HIS N H sing N N 150 HIS N H2 sing N N 151 HIS CA C sing N N 152 HIS CA CB sing N N 153 HIS CA HA sing N N 154 HIS C O doub N N 155 HIS C OXT sing N N 156 HIS CB CG sing N N 157 HIS CB HB2 sing N N 158 HIS CB HB3 sing N N 159 HIS CG ND1 sing Y N 160 HIS CG CD2 doub Y N 161 HIS ND1 CE1 doub Y N 162 HIS ND1 HD1 sing N N 163 HIS CD2 NE2 sing Y N 164 HIS CD2 HD2 sing N N 165 HIS CE1 NE2 sing Y N 166 HIS CE1 HE1 sing N N 167 HIS NE2 HE2 sing N N 168 HIS OXT HXT sing N N 169 HOH O H1 sing N N 170 HOH O H2 sing N N 171 ILE N CA sing N N 172 ILE N H sing N N 173 ILE N H2 sing N N 174 ILE CA C sing N N 175 ILE CA CB sing N N 176 ILE CA HA sing N N 177 ILE C O doub N N 178 ILE C OXT sing N N 179 ILE CB CG1 sing N N 180 ILE CB CG2 sing N N 181 ILE CB HB sing N N 182 ILE CG1 CD1 sing N N 183 ILE CG1 HG12 sing N N 184 ILE CG1 HG13 sing N N 185 ILE CG2 HG21 sing N N 186 ILE CG2 HG22 sing N N 187 ILE CG2 HG23 sing N N 188 ILE CD1 HD11 sing N N 189 ILE CD1 HD12 sing N N 190 ILE CD1 HD13 sing N N 191 ILE OXT HXT sing N N 192 LEU N CA sing N N 193 LEU N H sing N N 194 LEU N H2 sing N N 195 LEU CA C sing N N 196 LEU CA CB sing N N 197 LEU CA HA sing N N 198 LEU C O doub N N 199 LEU C OXT sing N N 200 LEU CB CG sing N N 201 LEU CB HB2 sing N N 202 LEU CB HB3 sing N N 203 LEU CG CD1 sing N N 204 LEU CG CD2 sing N N 205 LEU CG HG sing N N 206 LEU CD1 HD11 sing N N 207 LEU CD1 HD12 sing N N 208 LEU CD1 HD13 sing N N 209 LEU CD2 HD21 sing N N 210 LEU CD2 HD22 sing N N 211 LEU CD2 HD23 sing N N 212 LEU OXT HXT sing N N 213 LYS N CA sing N N 214 LYS N H sing N N 215 LYS N H2 sing N N 216 LYS CA C sing N N 217 LYS CA CB sing N N 218 LYS CA HA sing N N 219 LYS C O doub N N 220 LYS C OXT sing N N 221 LYS CB CG sing N N 222 LYS CB HB2 sing N N 223 LYS CB HB3 sing N N 224 LYS CG CD sing N N 225 LYS CG HG2 sing N N 226 LYS CG HG3 sing N N 227 LYS CD CE sing N N 228 LYS CD HD2 sing N N 229 LYS CD HD3 sing N N 230 LYS CE NZ sing N N 231 LYS CE HE2 sing N N 232 LYS CE HE3 sing N N 233 LYS NZ HZ1 sing N N 234 LYS NZ HZ2 sing N N 235 LYS NZ HZ3 sing N N 236 LYS OXT HXT sing N N 237 PHE N CA sing N N 238 PHE N H sing N N 239 PHE N H2 sing N N 240 PHE CA C sing N N 241 PHE CA CB sing N N 242 PHE CA HA sing N N 243 PHE C O doub N N 244 PHE C OXT sing N N 245 PHE CB CG sing N N 246 PHE CB HB2 sing N N 247 PHE CB HB3 sing N N 248 PHE CG CD1 doub Y N 249 PHE CG CD2 sing Y N 250 PHE CD1 CE1 sing Y N 251 PHE CD1 HD1 sing N N 252 PHE CD2 CE2 doub Y N 253 PHE CD2 HD2 sing N N 254 PHE CE1 CZ doub Y N 255 PHE CE1 HE1 sing N N 256 PHE CE2 CZ sing Y N 257 PHE CE2 HE2 sing N N 258 PHE CZ HZ sing N N 259 PHE OXT HXT sing N N 260 PRO N CA sing N N 261 PRO N CD sing N N 262 PRO N H sing N N 263 PRO CA C sing N N 264 PRO CA CB sing N N 265 PRO CA HA sing N N 266 PRO C O doub N N 267 PRO C OXT sing N N 268 PRO CB CG sing N N 269 PRO CB HB2 sing N N 270 PRO CB HB3 sing N N 271 PRO CG CD sing N N 272 PRO CG HG2 sing N N 273 PRO CG HG3 sing N N 274 PRO CD HD2 sing N N 275 PRO CD HD3 sing N N 276 PRO OXT HXT sing N N 277 SER N CA sing N N 278 SER N H sing N N 279 SER N H2 sing N N 280 SER CA C sing N N 281 SER CA CB sing N N 282 SER CA HA sing N N 283 SER C O doub N N 284 SER C OXT sing N N 285 SER CB OG sing N N 286 SER CB HB2 sing N N 287 SER CB HB3 sing N N 288 SER OG HG sing N N 289 SER OXT HXT sing N N 290 SO4 S O1 doub N N 291 SO4 S O2 doub N N 292 SO4 S O3 sing N N 293 SO4 S O4 sing N N 294 THR N CA sing N N 295 THR N H sing N N 296 THR N H2 sing N N 297 THR CA C sing N N 298 THR CA CB sing N N 299 THR CA HA sing N N 300 THR C O doub N N 301 THR C OXT sing N N 302 THR CB OG1 sing N N 303 THR CB CG2 sing N N 304 THR CB HB sing N N 305 THR OG1 HG1 sing N N 306 THR CG2 HG21 sing N N 307 THR CG2 HG22 sing N N 308 THR CG2 HG23 sing N N 309 THR OXT HXT sing N N 310 TYR N CA sing N N 311 TYR N H sing N N 312 TYR N H2 sing N N 313 TYR CA C sing N N 314 TYR CA CB sing N N 315 TYR CA HA sing N N 316 TYR C O doub N N 317 TYR C OXT sing N N 318 TYR CB CG sing N N 319 TYR CB HB2 sing N N 320 TYR CB HB3 sing N N 321 TYR CG CD1 doub Y N 322 TYR CG CD2 sing Y N 323 TYR CD1 CE1 sing Y N 324 TYR CD1 HD1 sing N N 325 TYR CD2 CE2 doub Y N 326 TYR CD2 HD2 sing N N 327 TYR CE1 CZ doub Y N 328 TYR CE1 HE1 sing N N 329 TYR CE2 CZ sing Y N 330 TYR CE2 HE2 sing N N 331 TYR CZ OH sing N N 332 TYR OH HH sing N N 333 TYR OXT HXT sing N N 334 # _pdbx_audit_support.funding_organization 'Israel Science Foundation' _pdbx_audit_support.country Israel _pdbx_audit_support.grant_number 1248/15 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1Y62 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6YHT _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014575 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014575 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014575 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CD N O S # loop_ #