data_6YLV # _entry.id 6YLV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6YLV pdb_00006ylv 10.2210/pdb6ylv/pdb WWPDB D_1292107820 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-06-10 2 'Structure model' 1 1 2021-12-29 3 'Structure model' 1 2 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' citation 7 3 'Structure model' pdbx_initial_refinement_model 8 3 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_CSD' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 2 'Structure model' '_database_2.pdbx_DOI' 10 2 'Structure model' '_database_2.pdbx_database_accession' 11 3 'Structure model' '_citation.country' 12 3 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 13 3 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 14 3 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 15 3 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 16 3 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 17 3 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 18 3 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 19 3 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6YLV _pdbx_database_status.recvd_initial_deposition_date 2020-04-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kubacka, D.' 1 0000-0003-0421-0470 'Wojcik, R.' 2 0000-0003-1984-6818 'Baranowski, M.R.' 3 0000-0002-1426-482X 'Kowalska, J.' 4 0000-0002-9174-7999 'Jemielity, J.' 5 0000-0001-7633-788X # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? CH ? ? primary Pharmaceutics ? ? 1999-4923 ? ? 13 ? ? ? ;Novel N7-Arylmethyl Substituted Dinucleotide mRNA 5' cap Analogs: Synthesis and Evaluation as Modulators of Translation. ; 2021 ? 10.3390/pharmaceutics13111941 34834356 ? ? ? ? ? ? ? ? US ? ? 1 'Acta Crystallogr. D Biol. Crystallogr.' ABCRE6 ? 1399-0047 ? ? 68 ? 352 367 'Towards automated crystallographic structure refinement with phenix.refine.' 2012 ? 10.1107/S0907444912001308 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wojcik, R.' 1 0000-0003-1984-6818 primary 'Baranowski, M.R.' 2 0000-0002-1426-482X primary 'Markiewicz, L.' 3 ? primary 'Kubacka, D.' 4 ? primary 'Bednarczyk, M.' 5 ? primary 'Baran, N.' 6 0000-0002-4341-695X primary 'Wojtczak, A.' 7 ? primary 'Sikorski, P.J.' 8 0000-0001-9842-6533 primary 'Zuberek, J.' 9 0000-0003-4798-2665 primary 'Kowalska, J.' 10 0000-0002-9174-7999 primary 'Jemielity, J.' 11 0000-0001-7633-788X 1 'Afonine, P.V.' 12 ? 1 'Grosse-Kunstleve, R.W.' 13 ? 1 'Echols, N.' 14 ? 1 'Headd, J.J.' 15 ? 1 'Moriarty, N.W.' 16 ? 1 'Mustyakimov, M.' 17 ? 1 'Terwilliger, T.C.' 18 ? 1 'Urzhumtsev, A.' 19 ? 1 'Zwart, P.H.' 20 ? 1 'Adams, P.D.' 21 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Eukaryotic translation initiation factor 4E' 22276.309 4 ? ? ? ? 2 non-polymer syn ;4-Cl-Bn7GpppG mRNA 5' cap analog ; 913.981 4 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 4 water nat water 18.015 238 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'mRNA cap-binding protein,eIF-4F 25 kDa subunit' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEK NKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKER LGLPPKIVIGYQSHADTATKSGSTTKNRFVV ; _entity_poly.pdbx_seq_one_letter_code_can ;MVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEK NKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKER LGLPPKIVIGYQSHADTATKSGSTTKNRFVV ; _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;4-Cl-Bn7GpppG mRNA 5' cap analog ; OYW 3 GLYCEROL GOL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 ALA n 1 4 ASN n 1 5 PRO n 1 6 GLU n 1 7 HIS n 1 8 TYR n 1 9 ILE n 1 10 LYS n 1 11 HIS n 1 12 PRO n 1 13 LEU n 1 14 GLN n 1 15 ASN n 1 16 ARG n 1 17 TRP n 1 18 ALA n 1 19 LEU n 1 20 TRP n 1 21 PHE n 1 22 PHE n 1 23 LYS n 1 24 ASN n 1 25 ASP n 1 26 LYS n 1 27 SER n 1 28 LYS n 1 29 THR n 1 30 TRP n 1 31 GLN n 1 32 ALA n 1 33 ASN n 1 34 LEU n 1 35 ARG n 1 36 LEU n 1 37 ILE n 1 38 SER n 1 39 LYS n 1 40 PHE n 1 41 ASP n 1 42 THR n 1 43 VAL n 1 44 GLU n 1 45 ASP n 1 46 PHE n 1 47 TRP n 1 48 ALA n 1 49 LEU n 1 50 TYR n 1 51 ASN n 1 52 HIS n 1 53 ILE n 1 54 GLN n 1 55 LEU n 1 56 SER n 1 57 SER n 1 58 ASN n 1 59 LEU n 1 60 MET n 1 61 PRO n 1 62 GLY n 1 63 CYS n 1 64 ASP n 1 65 TYR n 1 66 SER n 1 67 LEU n 1 68 PHE n 1 69 LYS n 1 70 ASP n 1 71 GLY n 1 72 ILE n 1 73 GLU n 1 74 PRO n 1 75 MET n 1 76 TRP n 1 77 GLU n 1 78 ASP n 1 79 GLU n 1 80 LYS n 1 81 ASN n 1 82 LYS n 1 83 ARG n 1 84 GLY n 1 85 GLY n 1 86 ARG n 1 87 TRP n 1 88 LEU n 1 89 ILE n 1 90 THR n 1 91 LEU n 1 92 ASN n 1 93 LYS n 1 94 GLN n 1 95 GLN n 1 96 ARG n 1 97 ARG n 1 98 SER n 1 99 ASP n 1 100 LEU n 1 101 ASP n 1 102 ARG n 1 103 PHE n 1 104 TRP n 1 105 LEU n 1 106 GLU n 1 107 THR n 1 108 LEU n 1 109 LEU n 1 110 CYS n 1 111 LEU n 1 112 ILE n 1 113 GLY n 1 114 GLU n 1 115 SER n 1 116 PHE n 1 117 ASP n 1 118 ASP n 1 119 TYR n 1 120 SER n 1 121 ASP n 1 122 ASP n 1 123 VAL n 1 124 CYS n 1 125 GLY n 1 126 ALA n 1 127 VAL n 1 128 VAL n 1 129 ASN n 1 130 VAL n 1 131 ARG n 1 132 ALA n 1 133 LYS n 1 134 GLY n 1 135 ASP n 1 136 LYS n 1 137 ILE n 1 138 ALA n 1 139 ILE n 1 140 TRP n 1 141 THR n 1 142 THR n 1 143 GLU n 1 144 CYS n 1 145 GLU n 1 146 ASN n 1 147 ARG n 1 148 ASP n 1 149 ALA n 1 150 VAL n 1 151 THR n 1 152 HIS n 1 153 ILE n 1 154 GLY n 1 155 ARG n 1 156 VAL n 1 157 TYR n 1 158 LYS n 1 159 GLU n 1 160 ARG n 1 161 LEU n 1 162 GLY n 1 163 LEU n 1 164 PRO n 1 165 PRO n 1 166 LYS n 1 167 ILE n 1 168 VAL n 1 169 ILE n 1 170 GLY n 1 171 TYR n 1 172 GLN n 1 173 SER n 1 174 HIS n 1 175 ALA n 1 176 ASP n 1 177 THR n 1 178 ALA n 1 179 THR n 1 180 LYS n 1 181 SER n 1 182 GLY n 1 183 SER n 1 184 THR n 1 185 THR n 1 186 LYS n 1 187 ASN n 1 188 ARG n 1 189 PHE n 1 190 VAL n 1 191 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 191 _entity_src_gen.gene_src_common_name 'House mouse' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Eif4e _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 OYW 'RNA linking' . ;4-Cl-Bn7GpppG mRNA 5' cap analog ; ;[[(2~{R},3~{S},4~{R},5~{R})-5-[2-azanyl-7-[(4-chlorophenyl)methyl]-6-oxidanylidene-1~{H}-purin-9-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; 'C27 H33 Cl N10 O18 P3 1' 913.981 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 27 ? ? ? A . n A 1 2 VAL 2 28 ? ? ? A . n A 1 3 ALA 3 29 29 ALA ALA A . n A 1 4 ASN 4 30 30 ASN ASN A . n A 1 5 PRO 5 31 31 PRO PRO A . n A 1 6 GLU 6 32 32 GLU GLU A . n A 1 7 HIS 7 33 33 HIS HIS A . n A 1 8 TYR 8 34 34 TYR TYR A . n A 1 9 ILE 9 35 35 ILE ILE A . n A 1 10 LYS 10 36 36 LYS LYS A . n A 1 11 HIS 11 37 37 HIS HIS A . n A 1 12 PRO 12 38 38 PRO PRO A . n A 1 13 LEU 13 39 39 LEU LEU A . n A 1 14 GLN 14 40 40 GLN GLN A . n A 1 15 ASN 15 41 41 ASN ASN A . n A 1 16 ARG 16 42 42 ARG ARG A . n A 1 17 TRP 17 43 43 TRP TRP A . n A 1 18 ALA 18 44 44 ALA ALA A . n A 1 19 LEU 19 45 45 LEU LEU A . n A 1 20 TRP 20 46 46 TRP TRP A . n A 1 21 PHE 21 47 47 PHE PHE A . n A 1 22 PHE 22 48 48 PHE PHE A . n A 1 23 LYS 23 49 49 LYS LYS A . n A 1 24 ASN 24 50 50 ASN ASN A . n A 1 25 ASP 25 51 51 ASP ASP A . n A 1 26 LYS 26 52 52 LYS LYS A . n A 1 27 SER 27 53 53 SER SER A . n A 1 28 LYS 28 54 54 LYS LYS A . n A 1 29 THR 29 55 55 THR THR A . n A 1 30 TRP 30 56 56 TRP TRP A . n A 1 31 GLN 31 57 57 GLN GLN A . n A 1 32 ALA 32 58 58 ALA ALA A . n A 1 33 ASN 33 59 59 ASN ASN A . n A 1 34 LEU 34 60 60 LEU LEU A . n A 1 35 ARG 35 61 61 ARG ARG A . n A 1 36 LEU 36 62 62 LEU LEU A . n A 1 37 ILE 37 63 63 ILE ILE A . n A 1 38 SER 38 64 64 SER SER A . n A 1 39 LYS 39 65 65 LYS LYS A . n A 1 40 PHE 40 66 66 PHE PHE A . n A 1 41 ASP 41 67 67 ASP ASP A . n A 1 42 THR 42 68 68 THR THR A . n A 1 43 VAL 43 69 69 VAL VAL A . n A 1 44 GLU 44 70 70 GLU GLU A . n A 1 45 ASP 45 71 71 ASP ASP A . n A 1 46 PHE 46 72 72 PHE PHE A . n A 1 47 TRP 47 73 73 TRP TRP A . n A 1 48 ALA 48 74 74 ALA ALA A . n A 1 49 LEU 49 75 75 LEU LEU A . n A 1 50 TYR 50 76 76 TYR TYR A . n A 1 51 ASN 51 77 77 ASN ASN A . n A 1 52 HIS 52 78 78 HIS HIS A . n A 1 53 ILE 53 79 79 ILE ILE A . n A 1 54 GLN 54 80 80 GLN GLN A . n A 1 55 LEU 55 81 81 LEU LEU A . n A 1 56 SER 56 82 82 SER SER A . n A 1 57 SER 57 83 83 SER SER A . n A 1 58 ASN 58 84 84 ASN ASN A . n A 1 59 LEU 59 85 85 LEU LEU A . n A 1 60 MET 60 86 86 MET MET A . n A 1 61 PRO 61 87 87 PRO PRO A . n A 1 62 GLY 62 88 88 GLY GLY A . n A 1 63 CYS 63 89 89 CYS CYS A . n A 1 64 ASP 64 90 90 ASP ASP A . n A 1 65 TYR 65 91 91 TYR TYR A . n A 1 66 SER 66 92 92 SER SER A . n A 1 67 LEU 67 93 93 LEU LEU A . n A 1 68 PHE 68 94 94 PHE PHE A . n A 1 69 LYS 69 95 95 LYS LYS A . n A 1 70 ASP 70 96 96 ASP ASP A . n A 1 71 GLY 71 97 97 GLY GLY A . n A 1 72 ILE 72 98 98 ILE ILE A . n A 1 73 GLU 73 99 99 GLU GLU A . n A 1 74 PRO 74 100 100 PRO PRO A . n A 1 75 MET 75 101 101 MET MET A . n A 1 76 TRP 76 102 102 TRP TRP A . n A 1 77 GLU 77 103 103 GLU GLU A . n A 1 78 ASP 78 104 104 ASP ASP A . n A 1 79 GLU 79 105 105 GLU GLU A . n A 1 80 LYS 80 106 106 LYS LYS A . n A 1 81 ASN 81 107 107 ASN ASN A . n A 1 82 LYS 82 108 108 LYS LYS A . n A 1 83 ARG 83 109 109 ARG ARG A . n A 1 84 GLY 84 110 110 GLY GLY A . n A 1 85 GLY 85 111 111 GLY GLY A . n A 1 86 ARG 86 112 112 ARG ARG A . n A 1 87 TRP 87 113 113 TRP TRP A . n A 1 88 LEU 88 114 114 LEU LEU A . n A 1 89 ILE 89 115 115 ILE ILE A . n A 1 90 THR 90 116 116 THR THR A . n A 1 91 LEU 91 117 117 LEU LEU A . n A 1 92 ASN 92 118 118 ASN ASN A . n A 1 93 LYS 93 119 119 LYS LYS A . n A 1 94 GLN 94 120 120 GLN GLN A . n A 1 95 GLN 95 121 121 GLN GLN A . n A 1 96 ARG 96 122 122 ARG ARG A . n A 1 97 ARG 97 123 123 ARG ARG A . n A 1 98 SER 98 124 124 SER SER A . n A 1 99 ASP 99 125 125 ASP ASP A . n A 1 100 LEU 100 126 126 LEU LEU A . n A 1 101 ASP 101 127 127 ASP ASP A . n A 1 102 ARG 102 128 128 ARG ARG A . n A 1 103 PHE 103 129 129 PHE PHE A . n A 1 104 TRP 104 130 130 TRP TRP A . n A 1 105 LEU 105 131 131 LEU LEU A . n A 1 106 GLU 106 132 132 GLU GLU A . n A 1 107 THR 107 133 133 THR THR A . n A 1 108 LEU 108 134 134 LEU LEU A . n A 1 109 LEU 109 135 135 LEU LEU A . n A 1 110 CYS 110 136 136 CYS CYS A . n A 1 111 LEU 111 137 137 LEU LEU A . n A 1 112 ILE 112 138 138 ILE ILE A . n A 1 113 GLY 113 139 139 GLY GLY A . n A 1 114 GLU 114 140 140 GLU GLU A . n A 1 115 SER 115 141 141 SER SER A . n A 1 116 PHE 116 142 142 PHE PHE A . n A 1 117 ASP 117 143 143 ASP ASP A . n A 1 118 ASP 118 144 144 ASP ASP A . n A 1 119 TYR 119 145 145 TYR TYR A . n A 1 120 SER 120 146 146 SER SER A . n A 1 121 ASP 121 147 147 ASP ASP A . n A 1 122 ASP 122 148 148 ASP ASP A . n A 1 123 VAL 123 149 149 VAL VAL A . n A 1 124 CYS 124 150 150 CYS CYS A . n A 1 125 GLY 125 151 151 GLY GLY A . n A 1 126 ALA 126 152 152 ALA ALA A . n A 1 127 VAL 127 153 153 VAL VAL A . n A 1 128 VAL 128 154 154 VAL VAL A . n A 1 129 ASN 129 155 155 ASN ASN A . n A 1 130 VAL 130 156 156 VAL VAL A . n A 1 131 ARG 131 157 157 ARG ARG A . n A 1 132 ALA 132 158 158 ALA ALA A . n A 1 133 LYS 133 159 159 LYS LYS A . n A 1 134 GLY 134 160 160 GLY GLY A . n A 1 135 ASP 135 161 161 ASP ASP A . n A 1 136 LYS 136 162 162 LYS LYS A . n A 1 137 ILE 137 163 163 ILE ILE A . n A 1 138 ALA 138 164 164 ALA ALA A . n A 1 139 ILE 139 165 165 ILE ILE A . n A 1 140 TRP 140 166 166 TRP TRP A . n A 1 141 THR 141 167 167 THR THR A . n A 1 142 THR 142 168 168 THR THR A . n A 1 143 GLU 143 169 169 GLU GLU A . n A 1 144 CYS 144 170 170 CYS CYS A . n A 1 145 GLU 145 171 171 GLU GLU A . n A 1 146 ASN 146 172 172 ASN ASN A . n A 1 147 ARG 147 173 173 ARG ARG A . n A 1 148 ASP 148 174 174 ASP ASP A . n A 1 149 ALA 149 175 175 ALA ALA A . n A 1 150 VAL 150 176 176 VAL VAL A . n A 1 151 THR 151 177 177 THR THR A . n A 1 152 HIS 152 178 178 HIS HIS A . n A 1 153 ILE 153 179 179 ILE ILE A . n A 1 154 GLY 154 180 180 GLY GLY A . n A 1 155 ARG 155 181 181 ARG ARG A . n A 1 156 VAL 156 182 182 VAL VAL A . n A 1 157 TYR 157 183 183 TYR TYR A . n A 1 158 LYS 158 184 184 LYS LYS A . n A 1 159 GLU 159 185 185 GLU GLU A . n A 1 160 ARG 160 186 186 ARG ARG A . n A 1 161 LEU 161 187 187 LEU LEU A . n A 1 162 GLY 162 188 188 GLY GLY A . n A 1 163 LEU 163 189 189 LEU LEU A . n A 1 164 PRO 164 190 190 PRO PRO A . n A 1 165 PRO 165 191 191 PRO PRO A . n A 1 166 LYS 166 192 192 LYS LYS A . n A 1 167 ILE 167 193 193 ILE ILE A . n A 1 168 VAL 168 194 194 VAL VAL A . n A 1 169 ILE 169 195 195 ILE ILE A . n A 1 170 GLY 170 196 196 GLY GLY A . n A 1 171 TYR 171 197 197 TYR TYR A . n A 1 172 GLN 172 198 198 GLN GLN A . n A 1 173 SER 173 199 199 SER SER A . n A 1 174 HIS 174 200 200 HIS HIS A . n A 1 175 ALA 175 201 201 ALA ALA A . n A 1 176 ASP 176 202 202 ASP ASP A . n A 1 177 THR 177 203 203 THR THR A . n A 1 178 ALA 178 204 204 ALA ALA A . n A 1 179 THR 179 205 205 THR THR A . n A 1 180 LYS 180 206 ? ? ? A . n A 1 181 SER 181 207 ? ? ? A . n A 1 182 GLY 182 208 ? ? ? A . n A 1 183 SER 183 209 ? ? ? A . n A 1 184 THR 184 210 ? ? ? A . n A 1 185 THR 185 211 ? ? ? A . n A 1 186 LYS 186 212 212 LYS LYS A . n A 1 187 ASN 187 213 213 ASN ASN A . n A 1 188 ARG 188 214 214 ARG ARG A . n A 1 189 PHE 189 215 215 PHE PHE A . n A 1 190 VAL 190 216 216 VAL VAL A . n A 1 191 VAL 191 217 217 VAL VAL A . n B 1 1 MET 1 27 ? ? ? B . n B 1 2 VAL 2 28 ? ? ? B . n B 1 3 ALA 3 29 ? ? ? B . n B 1 4 ASN 4 30 ? ? ? B . n B 1 5 PRO 5 31 31 PRO PRO B . n B 1 6 GLU 6 32 32 GLU GLU B . n B 1 7 HIS 7 33 33 HIS HIS B . n B 1 8 TYR 8 34 34 TYR TYR B . n B 1 9 ILE 9 35 35 ILE ILE B . n B 1 10 LYS 10 36 36 LYS LYS B . n B 1 11 HIS 11 37 37 HIS HIS B . n B 1 12 PRO 12 38 38 PRO PRO B . n B 1 13 LEU 13 39 39 LEU LEU B . n B 1 14 GLN 14 40 40 GLN GLN B . n B 1 15 ASN 15 41 41 ASN ASN B . n B 1 16 ARG 16 42 42 ARG ARG B . n B 1 17 TRP 17 43 43 TRP TRP B . n B 1 18 ALA 18 44 44 ALA ALA B . n B 1 19 LEU 19 45 45 LEU LEU B . n B 1 20 TRP 20 46 46 TRP TRP B . n B 1 21 PHE 21 47 47 PHE PHE B . n B 1 22 PHE 22 48 48 PHE PHE B . n B 1 23 LYS 23 49 49 LYS LYS B . n B 1 24 ASN 24 50 50 ASN ASN B . n B 1 25 ASP 25 51 51 ASP ASP B . n B 1 26 LYS 26 52 52 LYS LYS B . n B 1 27 SER 27 53 53 SER SER B . n B 1 28 LYS 28 54 54 LYS LYS B . n B 1 29 THR 29 55 55 THR THR B . n B 1 30 TRP 30 56 56 TRP TRP B . n B 1 31 GLN 31 57 57 GLN GLN B . n B 1 32 ALA 32 58 58 ALA ALA B . n B 1 33 ASN 33 59 59 ASN ASN B . n B 1 34 LEU 34 60 60 LEU LEU B . n B 1 35 ARG 35 61 61 ARG ARG B . n B 1 36 LEU 36 62 62 LEU LEU B . n B 1 37 ILE 37 63 63 ILE ILE B . n B 1 38 SER 38 64 64 SER SER B . n B 1 39 LYS 39 65 65 LYS LYS B . n B 1 40 PHE 40 66 66 PHE PHE B . n B 1 41 ASP 41 67 67 ASP ASP B . n B 1 42 THR 42 68 68 THR THR B . n B 1 43 VAL 43 69 69 VAL VAL B . n B 1 44 GLU 44 70 70 GLU GLU B . n B 1 45 ASP 45 71 71 ASP ASP B . n B 1 46 PHE 46 72 72 PHE PHE B . n B 1 47 TRP 47 73 73 TRP TRP B . n B 1 48 ALA 48 74 74 ALA ALA B . n B 1 49 LEU 49 75 75 LEU LEU B . n B 1 50 TYR 50 76 76 TYR TYR B . n B 1 51 ASN 51 77 77 ASN ASN B . n B 1 52 HIS 52 78 78 HIS HIS B . n B 1 53 ILE 53 79 79 ILE ILE B . n B 1 54 GLN 54 80 80 GLN GLN B . n B 1 55 LEU 55 81 81 LEU LEU B . n B 1 56 SER 56 82 82 SER SER B . n B 1 57 SER 57 83 83 SER SER B . n B 1 58 ASN 58 84 84 ASN ASN B . n B 1 59 LEU 59 85 85 LEU LEU B . n B 1 60 MET 60 86 86 MET MET B . n B 1 61 PRO 61 87 87 PRO PRO B . n B 1 62 GLY 62 88 88 GLY GLY B . n B 1 63 CYS 63 89 89 CYS CYS B . n B 1 64 ASP 64 90 90 ASP ASP B . n B 1 65 TYR 65 91 91 TYR TYR B . n B 1 66 SER 66 92 92 SER SER B . n B 1 67 LEU 67 93 93 LEU LEU B . n B 1 68 PHE 68 94 94 PHE PHE B . n B 1 69 LYS 69 95 95 LYS LYS B . n B 1 70 ASP 70 96 96 ASP ASP B . n B 1 71 GLY 71 97 97 GLY GLY B . n B 1 72 ILE 72 98 98 ILE ILE B . n B 1 73 GLU 73 99 99 GLU GLU B . n B 1 74 PRO 74 100 100 PRO PRO B . n B 1 75 MET 75 101 101 MET MET B . n B 1 76 TRP 76 102 102 TRP TRP B . n B 1 77 GLU 77 103 103 GLU GLU B . n B 1 78 ASP 78 104 104 ASP ASP B . n B 1 79 GLU 79 105 105 GLU GLU B . n B 1 80 LYS 80 106 106 LYS LYS B . n B 1 81 ASN 81 107 107 ASN ASN B . n B 1 82 LYS 82 108 108 LYS LYS B . n B 1 83 ARG 83 109 109 ARG ARG B . n B 1 84 GLY 84 110 110 GLY GLY B . n B 1 85 GLY 85 111 111 GLY GLY B . n B 1 86 ARG 86 112 112 ARG ARG B . n B 1 87 TRP 87 113 113 TRP TRP B . n B 1 88 LEU 88 114 114 LEU LEU B . n B 1 89 ILE 89 115 115 ILE ILE B . n B 1 90 THR 90 116 116 THR THR B . n B 1 91 LEU 91 117 117 LEU LEU B . n B 1 92 ASN 92 118 118 ASN ASN B . n B 1 93 LYS 93 119 119 LYS LYS B . n B 1 94 GLN 94 120 120 GLN GLN B . n B 1 95 GLN 95 121 121 GLN GLN B . n B 1 96 ARG 96 122 122 ARG ARG B . n B 1 97 ARG 97 123 123 ARG ARG B . n B 1 98 SER 98 124 124 SER SER B . n B 1 99 ASP 99 125 125 ASP ASP B . n B 1 100 LEU 100 126 126 LEU LEU B . n B 1 101 ASP 101 127 127 ASP ASP B . n B 1 102 ARG 102 128 128 ARG ARG B . n B 1 103 PHE 103 129 129 PHE PHE B . n B 1 104 TRP 104 130 130 TRP TRP B . n B 1 105 LEU 105 131 131 LEU LEU B . n B 1 106 GLU 106 132 132 GLU GLU B . n B 1 107 THR 107 133 133 THR THR B . n B 1 108 LEU 108 134 134 LEU LEU B . n B 1 109 LEU 109 135 135 LEU LEU B . n B 1 110 CYS 110 136 136 CYS CYS B . n B 1 111 LEU 111 137 137 LEU LEU B . n B 1 112 ILE 112 138 138 ILE ILE B . n B 1 113 GLY 113 139 139 GLY GLY B . n B 1 114 GLU 114 140 140 GLU GLU B . n B 1 115 SER 115 141 141 SER SER B . n B 1 116 PHE 116 142 142 PHE PHE B . n B 1 117 ASP 117 143 143 ASP ASP B . n B 1 118 ASP 118 144 144 ASP ASP B . n B 1 119 TYR 119 145 145 TYR TYR B . n B 1 120 SER 120 146 146 SER SER B . n B 1 121 ASP 121 147 147 ASP ASP B . n B 1 122 ASP 122 148 148 ASP ASP B . n B 1 123 VAL 123 149 149 VAL VAL B . n B 1 124 CYS 124 150 150 CYS CYS B . n B 1 125 GLY 125 151 151 GLY GLY B . n B 1 126 ALA 126 152 152 ALA ALA B . n B 1 127 VAL 127 153 153 VAL VAL B . n B 1 128 VAL 128 154 154 VAL VAL B . n B 1 129 ASN 129 155 155 ASN ASN B . n B 1 130 VAL 130 156 156 VAL VAL B . n B 1 131 ARG 131 157 157 ARG ARG B . n B 1 132 ALA 132 158 158 ALA ALA B . n B 1 133 LYS 133 159 159 LYS LYS B . n B 1 134 GLY 134 160 160 GLY GLY B . n B 1 135 ASP 135 161 161 ASP ASP B . n B 1 136 LYS 136 162 162 LYS LYS B . n B 1 137 ILE 137 163 163 ILE ILE B . n B 1 138 ALA 138 164 164 ALA ALA B . n B 1 139 ILE 139 165 165 ILE ILE B . n B 1 140 TRP 140 166 166 TRP TRP B . n B 1 141 THR 141 167 167 THR THR B . n B 1 142 THR 142 168 168 THR THR B . n B 1 143 GLU 143 169 169 GLU GLU B . n B 1 144 CYS 144 170 170 CYS CYS B . n B 1 145 GLU 145 171 171 GLU GLU B . n B 1 146 ASN 146 172 172 ASN ASN B . n B 1 147 ARG 147 173 173 ARG ARG B . n B 1 148 ASP 148 174 174 ASP ASP B . n B 1 149 ALA 149 175 175 ALA ALA B . n B 1 150 VAL 150 176 176 VAL VAL B . n B 1 151 THR 151 177 177 THR THR B . n B 1 152 HIS 152 178 178 HIS HIS B . n B 1 153 ILE 153 179 179 ILE ILE B . n B 1 154 GLY 154 180 180 GLY GLY B . n B 1 155 ARG 155 181 181 ARG ARG B . n B 1 156 VAL 156 182 182 VAL VAL B . n B 1 157 TYR 157 183 183 TYR TYR B . n B 1 158 LYS 158 184 184 LYS LYS B . n B 1 159 GLU 159 185 185 GLU GLU B . n B 1 160 ARG 160 186 186 ARG ARG B . n B 1 161 LEU 161 187 187 LEU LEU B . n B 1 162 GLY 162 188 188 GLY GLY B . n B 1 163 LEU 163 189 189 LEU LEU B . n B 1 164 PRO 164 190 190 PRO PRO B . n B 1 165 PRO 165 191 191 PRO PRO B . n B 1 166 LYS 166 192 192 LYS LYS B . n B 1 167 ILE 167 193 193 ILE ILE B . n B 1 168 VAL 168 194 194 VAL VAL B . n B 1 169 ILE 169 195 195 ILE ILE B . n B 1 170 GLY 170 196 196 GLY GLY B . n B 1 171 TYR 171 197 197 TYR TYR B . n B 1 172 GLN 172 198 198 GLN GLN B . n B 1 173 SER 173 199 199 SER SER B . n B 1 174 HIS 174 200 200 HIS HIS B . n B 1 175 ALA 175 201 201 ALA ALA B . n B 1 176 ASP 176 202 202 ASP ASP B . n B 1 177 THR 177 203 203 THR THR B . n B 1 178 ALA 178 204 204 ALA ALA B . n B 1 179 THR 179 205 205 THR THR B . n B 1 180 LYS 180 206 ? ? ? B . n B 1 181 SER 181 207 ? ? ? B . n B 1 182 GLY 182 208 208 GLY GLY B . n B 1 183 SER 183 209 209 SER SER B . n B 1 184 THR 184 210 210 THR THR B . n B 1 185 THR 185 211 211 THR THR B . n B 1 186 LYS 186 212 212 LYS LYS B . n B 1 187 ASN 187 213 213 ASN ASN B . n B 1 188 ARG 188 214 214 ARG ARG B . n B 1 189 PHE 189 215 215 PHE PHE B . n B 1 190 VAL 190 216 216 VAL VAL B . n B 1 191 VAL 191 217 217 VAL VAL B . n C 1 1 MET 1 27 ? ? ? C . n C 1 2 VAL 2 28 ? ? ? C . n C 1 3 ALA 3 29 ? ? ? C . n C 1 4 ASN 4 30 ? ? ? C . n C 1 5 PRO 5 31 ? ? ? C . n C 1 6 GLU 6 32 32 GLU GLU C . n C 1 7 HIS 7 33 33 HIS HIS C . n C 1 8 TYR 8 34 34 TYR TYR C . n C 1 9 ILE 9 35 35 ILE ILE C . n C 1 10 LYS 10 36 36 LYS LYS C . n C 1 11 HIS 11 37 37 HIS HIS C . n C 1 12 PRO 12 38 38 PRO PRO C . n C 1 13 LEU 13 39 39 LEU LEU C . n C 1 14 GLN 14 40 40 GLN GLN C . n C 1 15 ASN 15 41 41 ASN ASN C . n C 1 16 ARG 16 42 42 ARG ARG C . n C 1 17 TRP 17 43 43 TRP TRP C . n C 1 18 ALA 18 44 44 ALA ALA C . n C 1 19 LEU 19 45 45 LEU LEU C . n C 1 20 TRP 20 46 46 TRP TRP C . n C 1 21 PHE 21 47 47 PHE PHE C . n C 1 22 PHE 22 48 48 PHE PHE C . n C 1 23 LYS 23 49 49 LYS LYS C . n C 1 24 ASN 24 50 50 ASN ASN C . n C 1 25 ASP 25 51 51 ASP ASP C . n C 1 26 LYS 26 52 52 LYS LYS C . n C 1 27 SER 27 53 53 SER SER C . n C 1 28 LYS 28 54 54 LYS LYS C . n C 1 29 THR 29 55 55 THR THR C . n C 1 30 TRP 30 56 56 TRP TRP C . n C 1 31 GLN 31 57 57 GLN GLN C . n C 1 32 ALA 32 58 58 ALA ALA C . n C 1 33 ASN 33 59 59 ASN ASN C . n C 1 34 LEU 34 60 60 LEU LEU C . n C 1 35 ARG 35 61 61 ARG ARG C . n C 1 36 LEU 36 62 62 LEU LEU C . n C 1 37 ILE 37 63 63 ILE ILE C . n C 1 38 SER 38 64 64 SER SER C . n C 1 39 LYS 39 65 65 LYS LYS C . n C 1 40 PHE 40 66 66 PHE PHE C . n C 1 41 ASP 41 67 67 ASP ASP C . n C 1 42 THR 42 68 68 THR THR C . n C 1 43 VAL 43 69 69 VAL VAL C . n C 1 44 GLU 44 70 70 GLU GLU C . n C 1 45 ASP 45 71 71 ASP ASP C . n C 1 46 PHE 46 72 72 PHE PHE C . n C 1 47 TRP 47 73 73 TRP TRP C . n C 1 48 ALA 48 74 74 ALA ALA C . n C 1 49 LEU 49 75 75 LEU LEU C . n C 1 50 TYR 50 76 76 TYR TYR C . n C 1 51 ASN 51 77 77 ASN ASN C . n C 1 52 HIS 52 78 78 HIS HIS C . n C 1 53 ILE 53 79 79 ILE ILE C . n C 1 54 GLN 54 80 80 GLN GLN C . n C 1 55 LEU 55 81 81 LEU LEU C . n C 1 56 SER 56 82 82 SER SER C . n C 1 57 SER 57 83 83 SER SER C . n C 1 58 ASN 58 84 84 ASN ASN C . n C 1 59 LEU 59 85 85 LEU LEU C . n C 1 60 MET 60 86 86 MET MET C . n C 1 61 PRO 61 87 87 PRO PRO C . n C 1 62 GLY 62 88 88 GLY GLY C . n C 1 63 CYS 63 89 89 CYS CYS C . n C 1 64 ASP 64 90 90 ASP ASP C . n C 1 65 TYR 65 91 91 TYR TYR C . n C 1 66 SER 66 92 92 SER SER C . n C 1 67 LEU 67 93 93 LEU LEU C . n C 1 68 PHE 68 94 94 PHE PHE C . n C 1 69 LYS 69 95 95 LYS LYS C . n C 1 70 ASP 70 96 96 ASP ASP C . n C 1 71 GLY 71 97 97 GLY GLY C . n C 1 72 ILE 72 98 98 ILE ILE C . n C 1 73 GLU 73 99 99 GLU GLU C . n C 1 74 PRO 74 100 100 PRO PRO C . n C 1 75 MET 75 101 101 MET MET C . n C 1 76 TRP 76 102 102 TRP TRP C . n C 1 77 GLU 77 103 103 GLU GLU C . n C 1 78 ASP 78 104 104 ASP ASP C . n C 1 79 GLU 79 105 105 GLU GLU C . n C 1 80 LYS 80 106 106 LYS LYS C . n C 1 81 ASN 81 107 107 ASN ASN C . n C 1 82 LYS 82 108 108 LYS LYS C . n C 1 83 ARG 83 109 109 ARG ARG C . n C 1 84 GLY 84 110 110 GLY GLY C . n C 1 85 GLY 85 111 111 GLY GLY C . n C 1 86 ARG 86 112 112 ARG ARG C . n C 1 87 TRP 87 113 113 TRP TRP C . n C 1 88 LEU 88 114 114 LEU LEU C . n C 1 89 ILE 89 115 115 ILE ILE C . n C 1 90 THR 90 116 116 THR THR C . n C 1 91 LEU 91 117 117 LEU LEU C . n C 1 92 ASN 92 118 118 ASN ASN C . n C 1 93 LYS 93 119 119 LYS LYS C . n C 1 94 GLN 94 120 120 GLN GLN C . n C 1 95 GLN 95 121 121 GLN GLN C . n C 1 96 ARG 96 122 122 ARG ARG C . n C 1 97 ARG 97 123 123 ARG ARG C . n C 1 98 SER 98 124 124 SER SER C . n C 1 99 ASP 99 125 125 ASP ASP C . n C 1 100 LEU 100 126 126 LEU LEU C . n C 1 101 ASP 101 127 127 ASP ASP C . n C 1 102 ARG 102 128 128 ARG ARG C . n C 1 103 PHE 103 129 129 PHE PHE C . n C 1 104 TRP 104 130 130 TRP TRP C . n C 1 105 LEU 105 131 131 LEU LEU C . n C 1 106 GLU 106 132 132 GLU GLU C . n C 1 107 THR 107 133 133 THR THR C . n C 1 108 LEU 108 134 134 LEU LEU C . n C 1 109 LEU 109 135 135 LEU LEU C . n C 1 110 CYS 110 136 136 CYS CYS C . n C 1 111 LEU 111 137 137 LEU LEU C . n C 1 112 ILE 112 138 138 ILE ILE C . n C 1 113 GLY 113 139 139 GLY GLY C . n C 1 114 GLU 114 140 140 GLU GLU C . n C 1 115 SER 115 141 141 SER SER C . n C 1 116 PHE 116 142 142 PHE PHE C . n C 1 117 ASP 117 143 143 ASP ASP C . n C 1 118 ASP 118 144 144 ASP ASP C . n C 1 119 TYR 119 145 145 TYR TYR C . n C 1 120 SER 120 146 146 SER SER C . n C 1 121 ASP 121 147 147 ASP ASP C . n C 1 122 ASP 122 148 148 ASP ASP C . n C 1 123 VAL 123 149 149 VAL VAL C . n C 1 124 CYS 124 150 150 CYS CYS C . n C 1 125 GLY 125 151 151 GLY GLY C . n C 1 126 ALA 126 152 152 ALA ALA C . n C 1 127 VAL 127 153 153 VAL VAL C . n C 1 128 VAL 128 154 154 VAL VAL C . n C 1 129 ASN 129 155 155 ASN ASN C . n C 1 130 VAL 130 156 156 VAL VAL C . n C 1 131 ARG 131 157 157 ARG ARG C . n C 1 132 ALA 132 158 158 ALA ALA C . n C 1 133 LYS 133 159 159 LYS LYS C . n C 1 134 GLY 134 160 160 GLY GLY C . n C 1 135 ASP 135 161 161 ASP ASP C . n C 1 136 LYS 136 162 162 LYS LYS C . n C 1 137 ILE 137 163 163 ILE ILE C . n C 1 138 ALA 138 164 164 ALA ALA C . n C 1 139 ILE 139 165 165 ILE ILE C . n C 1 140 TRP 140 166 166 TRP TRP C . n C 1 141 THR 141 167 167 THR THR C . n C 1 142 THR 142 168 168 THR THR C . n C 1 143 GLU 143 169 169 GLU GLU C . n C 1 144 CYS 144 170 170 CYS CYS C . n C 1 145 GLU 145 171 171 GLU GLU C . n C 1 146 ASN 146 172 172 ASN ASN C . n C 1 147 ARG 147 173 173 ARG ARG C . n C 1 148 ASP 148 174 174 ASP ASP C . n C 1 149 ALA 149 175 175 ALA ALA C . n C 1 150 VAL 150 176 176 VAL VAL C . n C 1 151 THR 151 177 177 THR THR C . n C 1 152 HIS 152 178 178 HIS HIS C . n C 1 153 ILE 153 179 179 ILE ILE C . n C 1 154 GLY 154 180 180 GLY GLY C . n C 1 155 ARG 155 181 181 ARG ARG C . n C 1 156 VAL 156 182 182 VAL VAL C . n C 1 157 TYR 157 183 183 TYR TYR C . n C 1 158 LYS 158 184 184 LYS LYS C . n C 1 159 GLU 159 185 185 GLU GLU C . n C 1 160 ARG 160 186 186 ARG ARG C . n C 1 161 LEU 161 187 187 LEU LEU C . n C 1 162 GLY 162 188 188 GLY GLY C . n C 1 163 LEU 163 189 189 LEU LEU C . n C 1 164 PRO 164 190 190 PRO PRO C . n C 1 165 PRO 165 191 191 PRO PRO C . n C 1 166 LYS 166 192 192 LYS LYS C . n C 1 167 ILE 167 193 193 ILE ILE C . n C 1 168 VAL 168 194 194 VAL VAL C . n C 1 169 ILE 169 195 195 ILE ILE C . n C 1 170 GLY 170 196 196 GLY GLY C . n C 1 171 TYR 171 197 197 TYR TYR C . n C 1 172 GLN 172 198 198 GLN GLN C . n C 1 173 SER 173 199 199 SER SER C . n C 1 174 HIS 174 200 200 HIS HIS C . n C 1 175 ALA 175 201 201 ALA ALA C . n C 1 176 ASP 176 202 202 ASP ASP C . n C 1 177 THR 177 203 203 THR THR C . n C 1 178 ALA 178 204 204 ALA ALA C . n C 1 179 THR 179 205 ? ? ? C . n C 1 180 LYS 180 206 ? ? ? C . n C 1 181 SER 181 207 ? ? ? C . n C 1 182 GLY 182 208 ? ? ? C . n C 1 183 SER 183 209 ? ? ? C . n C 1 184 THR 184 210 ? ? ? C . n C 1 185 THR 185 211 ? ? ? C . n C 1 186 LYS 186 212 212 LYS LYS C . n C 1 187 ASN 187 213 213 ASN ASN C . n C 1 188 ARG 188 214 214 ARG ARG C . n C 1 189 PHE 189 215 215 PHE PHE C . n C 1 190 VAL 190 216 216 VAL VAL C . n C 1 191 VAL 191 217 217 VAL VAL C . n D 1 1 MET 1 27 ? ? ? D . n D 1 2 VAL 2 28 ? ? ? D . n D 1 3 ALA 3 29 ? ? ? D . n D 1 4 ASN 4 30 ? ? ? D . n D 1 5 PRO 5 31 31 PRO PRO D . n D 1 6 GLU 6 32 32 GLU GLU D . n D 1 7 HIS 7 33 33 HIS HIS D . n D 1 8 TYR 8 34 34 TYR TYR D . n D 1 9 ILE 9 35 35 ILE ILE D . n D 1 10 LYS 10 36 36 LYS LYS D . n D 1 11 HIS 11 37 37 HIS HIS D . n D 1 12 PRO 12 38 38 PRO PRO D . n D 1 13 LEU 13 39 39 LEU LEU D . n D 1 14 GLN 14 40 40 GLN GLN D . n D 1 15 ASN 15 41 41 ASN ASN D . n D 1 16 ARG 16 42 42 ARG ARG D . n D 1 17 TRP 17 43 43 TRP TRP D . n D 1 18 ALA 18 44 44 ALA ALA D . n D 1 19 LEU 19 45 45 LEU LEU D . n D 1 20 TRP 20 46 46 TRP TRP D . n D 1 21 PHE 21 47 47 PHE PHE D . n D 1 22 PHE 22 48 48 PHE PHE D . n D 1 23 LYS 23 49 49 LYS LYS D . n D 1 24 ASN 24 50 50 ASN ASN D . n D 1 25 ASP 25 51 51 ASP ASP D . n D 1 26 LYS 26 52 52 LYS LYS D . n D 1 27 SER 27 53 53 SER SER D . n D 1 28 LYS 28 54 54 LYS LYS D . n D 1 29 THR 29 55 55 THR THR D . n D 1 30 TRP 30 56 56 TRP TRP D . n D 1 31 GLN 31 57 57 GLN GLN D . n D 1 32 ALA 32 58 58 ALA ALA D . n D 1 33 ASN 33 59 59 ASN ASN D . n D 1 34 LEU 34 60 60 LEU LEU D . n D 1 35 ARG 35 61 61 ARG ARG D . n D 1 36 LEU 36 62 62 LEU LEU D . n D 1 37 ILE 37 63 63 ILE ILE D . n D 1 38 SER 38 64 64 SER SER D . n D 1 39 LYS 39 65 65 LYS LYS D . n D 1 40 PHE 40 66 66 PHE PHE D . n D 1 41 ASP 41 67 67 ASP ASP D . n D 1 42 THR 42 68 68 THR THR D . n D 1 43 VAL 43 69 69 VAL VAL D . n D 1 44 GLU 44 70 70 GLU GLU D . n D 1 45 ASP 45 71 71 ASP ASP D . n D 1 46 PHE 46 72 72 PHE PHE D . n D 1 47 TRP 47 73 73 TRP TRP D . n D 1 48 ALA 48 74 74 ALA ALA D . n D 1 49 LEU 49 75 75 LEU LEU D . n D 1 50 TYR 50 76 76 TYR TYR D . n D 1 51 ASN 51 77 77 ASN ASN D . n D 1 52 HIS 52 78 78 HIS HIS D . n D 1 53 ILE 53 79 79 ILE ILE D . n D 1 54 GLN 54 80 80 GLN GLN D . n D 1 55 LEU 55 81 81 LEU LEU D . n D 1 56 SER 56 82 82 SER SER D . n D 1 57 SER 57 83 83 SER SER D . n D 1 58 ASN 58 84 84 ASN ASN D . n D 1 59 LEU 59 85 85 LEU LEU D . n D 1 60 MET 60 86 86 MET MET D . n D 1 61 PRO 61 87 87 PRO PRO D . n D 1 62 GLY 62 88 88 GLY GLY D . n D 1 63 CYS 63 89 89 CYS CYS D . n D 1 64 ASP 64 90 90 ASP ASP D . n D 1 65 TYR 65 91 91 TYR TYR D . n D 1 66 SER 66 92 92 SER SER D . n D 1 67 LEU 67 93 93 LEU LEU D . n D 1 68 PHE 68 94 94 PHE PHE D . n D 1 69 LYS 69 95 95 LYS LYS D . n D 1 70 ASP 70 96 96 ASP ASP D . n D 1 71 GLY 71 97 97 GLY GLY D . n D 1 72 ILE 72 98 98 ILE ILE D . n D 1 73 GLU 73 99 99 GLU GLU D . n D 1 74 PRO 74 100 100 PRO PRO D . n D 1 75 MET 75 101 101 MET MET D . n D 1 76 TRP 76 102 102 TRP TRP D . n D 1 77 GLU 77 103 103 GLU GLU D . n D 1 78 ASP 78 104 104 ASP ASP D . n D 1 79 GLU 79 105 105 GLU GLU D . n D 1 80 LYS 80 106 106 LYS LYS D . n D 1 81 ASN 81 107 107 ASN ASN D . n D 1 82 LYS 82 108 108 LYS LYS D . n D 1 83 ARG 83 109 109 ARG ARG D . n D 1 84 GLY 84 110 110 GLY GLY D . n D 1 85 GLY 85 111 111 GLY GLY D . n D 1 86 ARG 86 112 112 ARG ARG D . n D 1 87 TRP 87 113 113 TRP TRP D . n D 1 88 LEU 88 114 114 LEU LEU D . n D 1 89 ILE 89 115 115 ILE ILE D . n D 1 90 THR 90 116 116 THR THR D . n D 1 91 LEU 91 117 117 LEU LEU D . n D 1 92 ASN 92 118 118 ASN ASN D . n D 1 93 LYS 93 119 119 LYS LYS D . n D 1 94 GLN 94 120 120 GLN GLN D . n D 1 95 GLN 95 121 121 GLN GLN D . n D 1 96 ARG 96 122 122 ARG ARG D . n D 1 97 ARG 97 123 123 ARG ARG D . n D 1 98 SER 98 124 124 SER SER D . n D 1 99 ASP 99 125 125 ASP ASP D . n D 1 100 LEU 100 126 126 LEU LEU D . n D 1 101 ASP 101 127 127 ASP ASP D . n D 1 102 ARG 102 128 128 ARG ARG D . n D 1 103 PHE 103 129 129 PHE PHE D . n D 1 104 TRP 104 130 130 TRP TRP D . n D 1 105 LEU 105 131 131 LEU LEU D . n D 1 106 GLU 106 132 132 GLU GLU D . n D 1 107 THR 107 133 133 THR THR D . n D 1 108 LEU 108 134 134 LEU LEU D . n D 1 109 LEU 109 135 135 LEU LEU D . n D 1 110 CYS 110 136 136 CYS CYS D . n D 1 111 LEU 111 137 137 LEU LEU D . n D 1 112 ILE 112 138 138 ILE ILE D . n D 1 113 GLY 113 139 139 GLY GLY D . n D 1 114 GLU 114 140 140 GLU GLU D . n D 1 115 SER 115 141 141 SER SER D . n D 1 116 PHE 116 142 142 PHE PHE D . n D 1 117 ASP 117 143 143 ASP ASP D . n D 1 118 ASP 118 144 144 ASP ASP D . n D 1 119 TYR 119 145 145 TYR TYR D . n D 1 120 SER 120 146 146 SER SER D . n D 1 121 ASP 121 147 147 ASP ASP D . n D 1 122 ASP 122 148 148 ASP ASP D . n D 1 123 VAL 123 149 149 VAL VAL D . n D 1 124 CYS 124 150 150 CYS CYS D . n D 1 125 GLY 125 151 151 GLY GLY D . n D 1 126 ALA 126 152 152 ALA ALA D . n D 1 127 VAL 127 153 153 VAL VAL D . n D 1 128 VAL 128 154 154 VAL VAL D . n D 1 129 ASN 129 155 155 ASN ASN D . n D 1 130 VAL 130 156 156 VAL VAL D . n D 1 131 ARG 131 157 157 ARG ARG D . n D 1 132 ALA 132 158 158 ALA ALA D . n D 1 133 LYS 133 159 159 LYS LYS D . n D 1 134 GLY 134 160 160 GLY GLY D . n D 1 135 ASP 135 161 161 ASP ASP D . n D 1 136 LYS 136 162 162 LYS LYS D . n D 1 137 ILE 137 163 163 ILE ILE D . n D 1 138 ALA 138 164 164 ALA ALA D . n D 1 139 ILE 139 165 165 ILE ILE D . n D 1 140 TRP 140 166 166 TRP TRP D . n D 1 141 THR 141 167 167 THR THR D . n D 1 142 THR 142 168 168 THR THR D . n D 1 143 GLU 143 169 169 GLU GLU D . n D 1 144 CYS 144 170 170 CYS CYS D . n D 1 145 GLU 145 171 171 GLU GLU D . n D 1 146 ASN 146 172 172 ASN ASN D . n D 1 147 ARG 147 173 173 ARG ARG D . n D 1 148 ASP 148 174 174 ASP ASP D . n D 1 149 ALA 149 175 175 ALA ALA D . n D 1 150 VAL 150 176 176 VAL VAL D . n D 1 151 THR 151 177 177 THR THR D . n D 1 152 HIS 152 178 178 HIS HIS D . n D 1 153 ILE 153 179 179 ILE ILE D . n D 1 154 GLY 154 180 180 GLY GLY D . n D 1 155 ARG 155 181 181 ARG ARG D . n D 1 156 VAL 156 182 182 VAL VAL D . n D 1 157 TYR 157 183 183 TYR TYR D . n D 1 158 LYS 158 184 184 LYS LYS D . n D 1 159 GLU 159 185 185 GLU GLU D . n D 1 160 ARG 160 186 186 ARG ARG D . n D 1 161 LEU 161 187 187 LEU LEU D . n D 1 162 GLY 162 188 188 GLY GLY D . n D 1 163 LEU 163 189 189 LEU LEU D . n D 1 164 PRO 164 190 190 PRO PRO D . n D 1 165 PRO 165 191 191 PRO PRO D . n D 1 166 LYS 166 192 192 LYS LYS D . n D 1 167 ILE 167 193 193 ILE ILE D . n D 1 168 VAL 168 194 194 VAL VAL D . n D 1 169 ILE 169 195 195 ILE ILE D . n D 1 170 GLY 170 196 196 GLY GLY D . n D 1 171 TYR 171 197 197 TYR TYR D . n D 1 172 GLN 172 198 198 GLN GLN D . n D 1 173 SER 173 199 199 SER SER D . n D 1 174 HIS 174 200 200 HIS HIS D . n D 1 175 ALA 175 201 201 ALA ALA D . n D 1 176 ASP 176 202 202 ASP ASP D . n D 1 177 THR 177 203 ? ? ? D . n D 1 178 ALA 178 204 ? ? ? D . n D 1 179 THR 179 205 ? ? ? D . n D 1 180 LYS 180 206 ? ? ? D . n D 1 181 SER 181 207 ? ? ? D . n D 1 182 GLY 182 208 ? ? ? D . n D 1 183 SER 183 209 ? ? ? D . n D 1 184 THR 184 210 ? ? ? D . n D 1 185 THR 185 211 ? ? ? D . n D 1 186 LYS 186 212 212 LYS LYS D . n D 1 187 ASN 187 213 213 ASN ASN D . n D 1 188 ARG 188 214 214 ARG ARG D . n D 1 189 PHE 189 215 215 PHE PHE D . n D 1 190 VAL 190 216 216 VAL VAL D . n D 1 191 VAL 191 217 217 VAL VAL D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 OYW 1 300 300 OYW CLG A . F 3 GOL 1 301 1 GOL GOL A . G 2 OYW 1 300 300 OYW CLG B . H 3 GOL 1 301 2 GOL GOL B . I 2 OYW 1 300 300 OYW CLG C . J 2 OYW 1 300 300 OYW CLG D . K 4 HOH 1 401 56 HOH HOH A . K 4 HOH 2 402 113 HOH HOH A . K 4 HOH 3 403 1 HOH HOH A . K 4 HOH 4 404 109 HOH HOH A . K 4 HOH 5 405 30 HOH HOH A . K 4 HOH 6 406 63 HOH HOH A . K 4 HOH 7 407 25 HOH HOH A . K 4 HOH 8 408 50 HOH HOH A . K 4 HOH 9 409 89 HOH HOH A . K 4 HOH 10 410 94 HOH HOH A . K 4 HOH 11 411 31 HOH HOH A . K 4 HOH 12 412 80 HOH HOH A . K 4 HOH 13 413 132 HOH HOH A . K 4 HOH 14 414 118 HOH HOH A . K 4 HOH 15 415 18 HOH HOH A . K 4 HOH 16 416 70 HOH HOH A . K 4 HOH 17 417 40 HOH HOH A . K 4 HOH 18 418 45 HOH HOH A . K 4 HOH 19 419 99 HOH HOH A . K 4 HOH 20 420 13 HOH HOH A . K 4 HOH 21 421 163 HOH HOH A . K 4 HOH 22 422 146 HOH HOH A . K 4 HOH 23 423 97 HOH HOH A . K 4 HOH 24 424 11 HOH HOH A . K 4 HOH 25 425 17 HOH HOH A . K 4 HOH 26 426 110 HOH HOH A . K 4 HOH 27 427 51 HOH HOH A . K 4 HOH 28 428 78 HOH HOH A . K 4 HOH 29 429 66 HOH HOH A . K 4 HOH 30 430 93 HOH HOH A . K 4 HOH 31 431 3 HOH HOH A . K 4 HOH 32 432 27 HOH HOH A . K 4 HOH 33 433 106 HOH HOH A . K 4 HOH 34 434 82 HOH HOH A . K 4 HOH 35 435 151 HOH HOH A . K 4 HOH 36 436 143 HOH HOH A . K 4 HOH 37 437 41 HOH HOH A . K 4 HOH 38 438 141 HOH HOH A . K 4 HOH 39 439 147 HOH HOH A . K 4 HOH 40 440 126 HOH HOH A . K 4 HOH 41 441 19 HOH HOH A . K 4 HOH 42 442 117 HOH HOH A . K 4 HOH 43 443 158 HOH HOH A . K 4 HOH 44 444 161 HOH HOH A . K 4 HOH 45 445 155 HOH HOH A . K 4 HOH 46 446 115 HOH HOH A . K 4 HOH 47 447 67 HOH HOH A . K 4 HOH 48 448 125 HOH HOH A . K 4 HOH 49 449 139 HOH HOH A . K 4 HOH 50 450 137 HOH HOH A . K 4 HOH 51 451 90 HOH HOH A . K 4 HOH 52 452 160 HOH HOH A . K 4 HOH 53 453 127 HOH HOH A . K 4 HOH 54 454 149 HOH HOH A . K 4 HOH 55 455 148 HOH HOH A . K 4 HOH 56 456 188 HOH HOH A . K 4 HOH 57 457 164 HOH HOH A . K 4 HOH 58 458 124 HOH HOH A . K 4 HOH 59 459 165 HOH HOH A . K 4 HOH 60 460 144 HOH HOH A . K 4 HOH 61 461 145 HOH HOH A . K 4 HOH 62 462 154 HOH HOH A . K 4 HOH 63 463 138 HOH HOH A . K 4 HOH 64 464 133 HOH HOH A . K 4 HOH 65 465 64 HOH HOH A . K 4 HOH 66 466 140 HOH HOH A . K 4 HOH 67 467 162 HOH HOH A . K 4 HOH 68 468 152 HOH HOH A . K 4 HOH 69 469 34 HOH HOH A . K 4 HOH 70 470 166 HOH HOH A . K 4 HOH 71 471 157 HOH HOH A . K 4 HOH 72 472 150 HOH HOH A . K 4 HOH 73 473 134 HOH HOH A . K 4 HOH 74 474 61 HOH HOH A . K 4 HOH 75 475 142 HOH HOH A . K 4 HOH 76 476 91 HOH HOH A . K 4 HOH 77 477 136 HOH HOH A . L 4 HOH 1 401 105 HOH HOH B . L 4 HOH 2 402 20 HOH HOH B . L 4 HOH 3 403 2 HOH HOH B . L 4 HOH 4 404 8 HOH HOH B . L 4 HOH 5 405 6 HOH HOH B . L 4 HOH 6 406 53 HOH HOH B . L 4 HOH 7 407 10 HOH HOH B . L 4 HOH 8 408 88 HOH HOH B . L 4 HOH 9 409 193 HOH HOH B . L 4 HOH 10 410 210 HOH HOH B . L 4 HOH 11 411 46 HOH HOH B . L 4 HOH 12 412 9 HOH HOH B . L 4 HOH 13 413 24 HOH HOH B . L 4 HOH 14 414 22 HOH HOH B . L 4 HOH 15 415 65 HOH HOH B . L 4 HOH 16 416 76 HOH HOH B . L 4 HOH 17 417 72 HOH HOH B . L 4 HOH 18 418 43 HOH HOH B . L 4 HOH 19 419 52 HOH HOH B . L 4 HOH 20 420 185 HOH HOH B . L 4 HOH 21 421 29 HOH HOH B . L 4 HOH 22 422 108 HOH HOH B . L 4 HOH 23 423 7 HOH HOH B . L 4 HOH 24 424 201 HOH HOH B . L 4 HOH 25 425 190 HOH HOH B . L 4 HOH 26 426 207 HOH HOH B . L 4 HOH 27 427 212 HOH HOH B . L 4 HOH 28 428 15 HOH HOH B . L 4 HOH 29 429 176 HOH HOH B . L 4 HOH 30 430 38 HOH HOH B . L 4 HOH 31 431 197 HOH HOH B . L 4 HOH 32 432 16 HOH HOH B . L 4 HOH 33 433 183 HOH HOH B . L 4 HOH 34 434 86 HOH HOH B . L 4 HOH 35 435 203 HOH HOH B . L 4 HOH 36 436 4 HOH HOH B . L 4 HOH 37 437 33 HOH HOH B . L 4 HOH 38 438 87 HOH HOH B . L 4 HOH 39 439 265 HOH HOH B . L 4 HOH 40 440 211 HOH HOH B . L 4 HOH 41 441 198 HOH HOH B . L 4 HOH 42 442 85 HOH HOH B . L 4 HOH 43 443 79 HOH HOH B . L 4 HOH 44 444 208 HOH HOH B . L 4 HOH 45 445 173 HOH HOH B . L 4 HOH 46 446 39 HOH HOH B . L 4 HOH 47 447 54 HOH HOH B . L 4 HOH 48 448 181 HOH HOH B . L 4 HOH 49 449 175 HOH HOH B . L 4 HOH 50 450 68 HOH HOH B . L 4 HOH 51 451 206 HOH HOH B . L 4 HOH 52 452 180 HOH HOH B . L 4 HOH 53 453 213 HOH HOH B . L 4 HOH 54 454 60 HOH HOH B . L 4 HOH 55 455 37 HOH HOH B . L 4 HOH 56 456 167 HOH HOH B . L 4 HOH 57 457 195 HOH HOH B . L 4 HOH 58 458 186 HOH HOH B . L 4 HOH 59 459 192 HOH HOH B . L 4 HOH 60 460 178 HOH HOH B . L 4 HOH 61 461 202 HOH HOH B . L 4 HOH 62 462 199 HOH HOH B . L 4 HOH 63 463 196 HOH HOH B . L 4 HOH 64 464 187 HOH HOH B . L 4 HOH 65 465 96 HOH HOH B . L 4 HOH 66 466 172 HOH HOH B . L 4 HOH 67 467 21 HOH HOH B . L 4 HOH 68 468 77 HOH HOH B . L 4 HOH 69 469 168 HOH HOH B . L 4 HOH 70 470 177 HOH HOH B . L 4 HOH 71 471 191 HOH HOH B . L 4 HOH 72 472 182 HOH HOH B . L 4 HOH 73 473 209 HOH HOH B . L 4 HOH 74 474 204 HOH HOH B . L 4 HOH 75 475 194 HOH HOH B . L 4 HOH 76 476 100 HOH HOH B . L 4 HOH 77 477 179 HOH HOH B . L 4 HOH 78 478 189 HOH HOH B . L 4 HOH 79 479 200 HOH HOH B . L 4 HOH 80 480 81 HOH HOH B . L 4 HOH 81 481 205 HOH HOH B . M 4 HOH 1 401 14 HOH HOH C . M 4 HOH 2 402 69 HOH HOH C . M 4 HOH 3 403 5 HOH HOH C . M 4 HOH 4 404 231 HOH HOH C . M 4 HOH 5 405 32 HOH HOH C . M 4 HOH 6 406 26 HOH HOH C . M 4 HOH 7 407 71 HOH HOH C . M 4 HOH 8 408 102 HOH HOH C . M 4 HOH 9 409 112 HOH HOH C . M 4 HOH 10 410 225 HOH HOH C . M 4 HOH 11 411 35 HOH HOH C . M 4 HOH 12 412 49 HOH HOH C . M 4 HOH 13 413 229 HOH HOH C . M 4 HOH 14 414 28 HOH HOH C . M 4 HOH 15 415 233 HOH HOH C . M 4 HOH 16 416 36 HOH HOH C . M 4 HOH 17 417 103 HOH HOH C . M 4 HOH 18 418 58 HOH HOH C . M 4 HOH 19 419 44 HOH HOH C . M 4 HOH 20 420 107 HOH HOH C . M 4 HOH 21 421 224 HOH HOH C . M 4 HOH 22 422 73 HOH HOH C . M 4 HOH 23 423 226 HOH HOH C . M 4 HOH 24 424 236 HOH HOH C . M 4 HOH 25 425 220 HOH HOH C . M 4 HOH 26 426 242 HOH HOH C . M 4 HOH 27 427 223 HOH HOH C . M 4 HOH 28 428 235 HOH HOH C . M 4 HOH 29 429 237 HOH HOH C . M 4 HOH 30 430 221 HOH HOH C . M 4 HOH 31 431 227 HOH HOH C . M 4 HOH 32 432 217 HOH HOH C . M 4 HOH 33 433 241 HOH HOH C . M 4 HOH 34 434 244 HOH HOH C . M 4 HOH 35 435 222 HOH HOH C . M 4 HOH 36 436 219 HOH HOH C . M 4 HOH 37 437 228 HOH HOH C . M 4 HOH 38 438 239 HOH HOH C . M 4 HOH 39 439 214 HOH HOH C . M 4 HOH 40 440 184 HOH HOH C . M 4 HOH 41 441 218 HOH HOH C . M 4 HOH 42 442 230 HOH HOH C . M 4 HOH 43 443 238 HOH HOH C . M 4 HOH 44 444 243 HOH HOH C . M 4 HOH 45 445 232 HOH HOH C . N 4 HOH 1 401 23 HOH HOH D . N 4 HOH 2 402 57 HOH HOH D . N 4 HOH 3 403 101 HOH HOH D . N 4 HOH 4 404 12 HOH HOH D . N 4 HOH 5 405 98 HOH HOH D . N 4 HOH 6 406 55 HOH HOH D . N 4 HOH 7 407 251 HOH HOH D . N 4 HOH 8 408 92 HOH HOH D . N 4 HOH 9 409 252 HOH HOH D . N 4 HOH 10 410 84 HOH HOH D . N 4 HOH 11 411 47 HOH HOH D . N 4 HOH 12 412 248 HOH HOH D . N 4 HOH 13 413 249 HOH HOH D . N 4 HOH 14 414 42 HOH HOH D . N 4 HOH 15 415 75 HOH HOH D . N 4 HOH 16 416 74 HOH HOH D . N 4 HOH 17 417 62 HOH HOH D . N 4 HOH 18 418 250 HOH HOH D . N 4 HOH 19 419 256 HOH HOH D . N 4 HOH 20 420 59 HOH HOH D . N 4 HOH 21 421 263 HOH HOH D . N 4 HOH 22 422 254 HOH HOH D . N 4 HOH 23 423 264 HOH HOH D . N 4 HOH 24 424 128 HOH HOH D . N 4 HOH 25 425 266 HOH HOH D . N 4 HOH 26 426 48 HOH HOH D . N 4 HOH 27 427 261 HOH HOH D . N 4 HOH 28 428 259 HOH HOH D . N 4 HOH 29 429 130 HOH HOH D . N 4 HOH 30 430 262 HOH HOH D . N 4 HOH 31 431 255 HOH HOH D . N 4 HOH 32 432 129 HOH HOH D . N 4 HOH 33 433 246 HOH HOH D . N 4 HOH 34 434 253 HOH HOH D . N 4 HOH 35 435 120 HOH HOH D . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 30 ? CG ? A ASN 4 CG 2 1 Y 1 A ASN 30 ? OD1 ? A ASN 4 OD1 3 1 Y 1 A ASN 30 ? ND2 ? A ASN 4 ND2 4 1 Y 1 A GLU 32 ? CG ? A GLU 6 CG 5 1 Y 1 A GLU 32 ? CD ? A GLU 6 CD 6 1 Y 1 A GLU 32 ? OE1 ? A GLU 6 OE1 7 1 Y 1 A GLU 32 ? OE2 ? A GLU 6 OE2 8 1 Y 1 A GLN 57 ? CG ? A GLN 31 CG 9 1 Y 1 A GLN 57 ? CD ? A GLN 31 CD 10 1 Y 1 A GLN 57 ? OE1 ? A GLN 31 OE1 11 1 Y 1 A GLN 57 ? NE2 ? A GLN 31 NE2 12 1 Y 1 A ARG 61 ? CG ? A ARG 35 CG 13 1 Y 1 A ARG 61 ? CD ? A ARG 35 CD 14 1 Y 1 A ARG 61 ? NE ? A ARG 35 NE 15 1 Y 1 A ARG 61 ? CZ ? A ARG 35 CZ 16 1 Y 1 A ARG 61 ? NH1 ? A ARG 35 NH1 17 1 Y 1 A ARG 61 ? NH2 ? A ARG 35 NH2 18 1 Y 1 A GLU 105 ? CG ? A GLU 79 CG 19 1 Y 1 A GLU 105 ? CD ? A GLU 79 CD 20 1 Y 1 A GLU 105 ? OE1 ? A GLU 79 OE1 21 1 Y 1 A GLU 105 ? OE2 ? A GLU 79 OE2 22 1 Y 1 A LYS 159 ? CG ? A LYS 133 CG 23 1 Y 1 A LYS 159 ? CD ? A LYS 133 CD 24 1 Y 1 A LYS 159 ? CE ? A LYS 133 CE 25 1 Y 1 A LYS 159 ? NZ ? A LYS 133 NZ 26 1 Y 1 A ARG 173 ? CG ? A ARG 147 CG 27 1 Y 1 A ARG 173 ? CD ? A ARG 147 CD 28 1 Y 1 A ARG 173 ? NE ? A ARG 147 NE 29 1 Y 1 A ARG 173 ? CZ ? A ARG 147 CZ 30 1 Y 1 A ARG 173 ? NH1 ? A ARG 147 NH1 31 1 Y 1 A ARG 173 ? NH2 ? A ARG 147 NH2 32 1 Y 1 A GLU 185 ? CG ? A GLU 159 CG 33 1 Y 1 A GLU 185 ? CD ? A GLU 159 CD 34 1 Y 1 A GLU 185 ? OE1 ? A GLU 159 OE1 35 1 Y 1 A GLU 185 ? OE2 ? A GLU 159 OE2 36 1 Y 1 A LYS 192 ? CG ? A LYS 166 CG 37 1 Y 1 A LYS 192 ? CD ? A LYS 166 CD 38 1 Y 1 A LYS 192 ? CE ? A LYS 166 CE 39 1 Y 1 A LYS 192 ? NZ ? A LYS 166 NZ 40 1 Y 1 A THR 203 ? OG1 ? A THR 177 OG1 41 1 Y 1 A THR 203 ? CG2 ? A THR 177 CG2 42 1 Y 1 A THR 205 ? OG1 ? A THR 179 OG1 43 1 Y 1 A THR 205 ? CG2 ? A THR 179 CG2 44 1 Y 1 B GLU 32 ? CG ? B GLU 6 CG 45 1 Y 1 B GLU 32 ? CD ? B GLU 6 CD 46 1 Y 1 B GLU 32 ? OE1 ? B GLU 6 OE1 47 1 Y 1 B GLU 32 ? OE2 ? B GLU 6 OE2 48 1 Y 1 B GLU 105 ? CG ? B GLU 79 CG 49 1 Y 1 B GLU 105 ? CD ? B GLU 79 CD 50 1 Y 1 B GLU 105 ? OE1 ? B GLU 79 OE1 51 1 Y 1 B GLU 105 ? OE2 ? B GLU 79 OE2 52 1 Y 1 B LYS 108 ? CG ? B LYS 82 CG 53 1 Y 1 B LYS 108 ? CD ? B LYS 82 CD 54 1 Y 1 B LYS 108 ? CE ? B LYS 82 CE 55 1 Y 1 B LYS 108 ? NZ ? B LYS 82 NZ 56 1 Y 1 B ARG 109 ? CG ? B ARG 83 CG 57 1 Y 1 B ARG 109 ? CD ? B ARG 83 CD 58 1 Y 1 B ARG 109 ? NE ? B ARG 83 NE 59 1 Y 1 B ARG 109 ? CZ ? B ARG 83 CZ 60 1 Y 1 B ARG 109 ? NH1 ? B ARG 83 NH1 61 1 Y 1 B ARG 109 ? NH2 ? B ARG 83 NH2 62 1 Y 1 B LYS 159 ? CG ? B LYS 133 CG 63 1 Y 1 B LYS 159 ? CD ? B LYS 133 CD 64 1 Y 1 B LYS 159 ? CE ? B LYS 133 CE 65 1 Y 1 B LYS 159 ? NZ ? B LYS 133 NZ 66 1 Y 1 B ARG 173 ? CG ? B ARG 147 CG 67 1 Y 1 B ARG 173 ? CD ? B ARG 147 CD 68 1 Y 1 B ARG 173 ? NE ? B ARG 147 NE 69 1 Y 1 B ARG 173 ? CZ ? B ARG 147 CZ 70 1 Y 1 B ARG 173 ? NH1 ? B ARG 147 NH1 71 1 Y 1 B ARG 173 ? NH2 ? B ARG 147 NH2 72 1 Y 1 B GLU 185 ? CG ? B GLU 159 CG 73 1 Y 1 B GLU 185 ? CD ? B GLU 159 CD 74 1 Y 1 B GLU 185 ? OE1 ? B GLU 159 OE1 75 1 Y 1 B GLU 185 ? OE2 ? B GLU 159 OE2 76 1 Y 1 B LYS 192 ? CG ? B LYS 166 CG 77 1 Y 1 B LYS 192 ? CD ? B LYS 166 CD 78 1 Y 1 B LYS 192 ? CE ? B LYS 166 CE 79 1 Y 1 B LYS 192 ? NZ ? B LYS 166 NZ 80 1 Y 1 B ILE 193 ? CG1 ? B ILE 167 CG1 81 1 Y 1 B ILE 193 ? CG2 ? B ILE 167 CG2 82 1 Y 1 B ILE 193 ? CD1 ? B ILE 167 CD1 83 1 Y 1 B THR 205 ? OG1 ? B THR 179 OG1 84 1 Y 1 B THR 205 ? CG2 ? B THR 179 CG2 85 1 Y 1 B SER 209 ? OG ? B SER 183 OG 86 1 Y 1 B THR 211 ? OG1 ? B THR 185 OG1 87 1 Y 1 B THR 211 ? CG2 ? B THR 185 CG2 88 1 Y 1 B LYS 212 ? CG ? B LYS 186 CG 89 1 Y 1 B LYS 212 ? CD ? B LYS 186 CD 90 1 Y 1 B LYS 212 ? CE ? B LYS 186 CE 91 1 Y 1 B LYS 212 ? NZ ? B LYS 186 NZ 92 1 Y 1 C GLU 32 ? CG ? C GLU 6 CG 93 1 Y 1 C GLU 32 ? CD ? C GLU 6 CD 94 1 Y 1 C GLU 32 ? OE1 ? C GLU 6 OE1 95 1 Y 1 C GLU 32 ? OE2 ? C GLU 6 OE2 96 1 Y 1 C LYS 49 ? CG ? C LYS 23 CG 97 1 Y 1 C LYS 49 ? CD ? C LYS 23 CD 98 1 Y 1 C LYS 49 ? CE ? C LYS 23 CE 99 1 Y 1 C LYS 49 ? NZ ? C LYS 23 NZ 100 1 Y 1 C ASN 50 ? CG ? C ASN 24 CG 101 1 Y 1 C ASN 50 ? OD1 ? C ASN 24 OD1 102 1 Y 1 C ASN 50 ? ND2 ? C ASN 24 ND2 103 1 Y 1 C LYS 52 ? CG ? C LYS 26 CG 104 1 Y 1 C LYS 52 ? CD ? C LYS 26 CD 105 1 Y 1 C LYS 52 ? CE ? C LYS 26 CE 106 1 Y 1 C LYS 52 ? NZ ? C LYS 26 NZ 107 1 Y 1 C SER 53 ? OG ? C SER 27 OG 108 1 Y 1 C LYS 54 ? CG ? C LYS 28 CG 109 1 Y 1 C LYS 54 ? CD ? C LYS 28 CD 110 1 Y 1 C LYS 54 ? CE ? C LYS 28 CE 111 1 Y 1 C LYS 54 ? NZ ? C LYS 28 NZ 112 1 Y 1 C GLN 57 ? CG ? C GLN 31 CG 113 1 Y 1 C GLN 57 ? CD ? C GLN 31 CD 114 1 Y 1 C GLN 57 ? OE1 ? C GLN 31 OE1 115 1 Y 1 C GLN 57 ? NE2 ? C GLN 31 NE2 116 1 Y 1 C GLU 105 ? CG ? C GLU 79 CG 117 1 Y 1 C GLU 105 ? CD ? C GLU 79 CD 118 1 Y 1 C GLU 105 ? OE1 ? C GLU 79 OE1 119 1 Y 1 C GLU 105 ? OE2 ? C GLU 79 OE2 120 1 Y 1 C LYS 106 ? CG ? C LYS 80 CG 121 1 Y 1 C LYS 106 ? CD ? C LYS 80 CD 122 1 Y 1 C LYS 106 ? CE ? C LYS 80 CE 123 1 Y 1 C LYS 106 ? NZ ? C LYS 80 NZ 124 1 Y 1 C LYS 108 ? CG ? C LYS 82 CG 125 1 Y 1 C LYS 108 ? CD ? C LYS 82 CD 126 1 Y 1 C LYS 108 ? CE ? C LYS 82 CE 127 1 Y 1 C LYS 108 ? NZ ? C LYS 82 NZ 128 1 Y 1 C ARG 109 ? CG ? C ARG 83 CG 129 1 Y 1 C ARG 109 ? CD ? C ARG 83 CD 130 1 Y 1 C ARG 109 ? NE ? C ARG 83 NE 131 1 Y 1 C ARG 109 ? CZ ? C ARG 83 CZ 132 1 Y 1 C ARG 109 ? NH1 ? C ARG 83 NH1 133 1 Y 1 C ARG 109 ? NH2 ? C ARG 83 NH2 134 1 Y 1 C ASP 144 ? CG ? C ASP 118 CG 135 1 Y 1 C ASP 144 ? OD1 ? C ASP 118 OD1 136 1 Y 1 C ASP 144 ? OD2 ? C ASP 118 OD2 137 1 Y 1 C SER 146 ? OG ? C SER 120 OG 138 1 Y 1 C LYS 159 ? CG ? C LYS 133 CG 139 1 Y 1 C LYS 159 ? CD ? C LYS 133 CD 140 1 Y 1 C LYS 159 ? CE ? C LYS 133 CE 141 1 Y 1 C LYS 159 ? NZ ? C LYS 133 NZ 142 1 Y 1 C GLU 171 ? CG ? C GLU 145 CG 143 1 Y 1 C GLU 171 ? CD ? C GLU 145 CD 144 1 Y 1 C GLU 171 ? OE1 ? C GLU 145 OE1 145 1 Y 1 C GLU 171 ? OE2 ? C GLU 145 OE2 146 1 Y 1 C ASN 172 ? CG ? C ASN 146 CG 147 1 Y 1 C ASN 172 ? OD1 ? C ASN 146 OD1 148 1 Y 1 C ASN 172 ? ND2 ? C ASN 146 ND2 149 1 Y 1 C VAL 182 ? CG1 ? C VAL 156 CG1 150 1 Y 1 C VAL 182 ? CG2 ? C VAL 156 CG2 151 1 Y 1 C LYS 184 ? CG ? C LYS 158 CG 152 1 Y 1 C LYS 184 ? CD ? C LYS 158 CD 153 1 Y 1 C LYS 184 ? CE ? C LYS 158 CE 154 1 Y 1 C LYS 184 ? NZ ? C LYS 158 NZ 155 1 Y 1 C GLU 185 ? CG ? C GLU 159 CG 156 1 Y 1 C GLU 185 ? CD ? C GLU 159 CD 157 1 Y 1 C GLU 185 ? OE1 ? C GLU 159 OE1 158 1 Y 1 C GLU 185 ? OE2 ? C GLU 159 OE2 159 1 Y 1 C LYS 192 ? CG ? C LYS 166 CG 160 1 Y 1 C LYS 192 ? CD ? C LYS 166 CD 161 1 Y 1 C LYS 192 ? CE ? C LYS 166 CE 162 1 Y 1 C LYS 192 ? NZ ? C LYS 166 NZ 163 1 Y 1 C ILE 195 ? CG1 ? C ILE 169 CG1 164 1 Y 1 C ILE 195 ? CG2 ? C ILE 169 CG2 165 1 Y 1 C ILE 195 ? CD1 ? C ILE 169 CD1 166 1 Y 1 C GLN 198 ? CG ? C GLN 172 CG 167 1 Y 1 C GLN 198 ? CD ? C GLN 172 CD 168 1 Y 1 C GLN 198 ? OE1 ? C GLN 172 OE1 169 1 Y 1 C GLN 198 ? NE2 ? C GLN 172 NE2 170 1 Y 1 C LYS 212 ? CG ? C LYS 186 CG 171 1 Y 1 C LYS 212 ? CD ? C LYS 186 CD 172 1 Y 1 C LYS 212 ? CE ? C LYS 186 CE 173 1 Y 1 C LYS 212 ? NZ ? C LYS 186 NZ 174 1 Y 1 C ARG 214 ? CG ? C ARG 188 CG 175 1 Y 1 C ARG 214 ? CD ? C ARG 188 CD 176 1 Y 1 C ARG 214 ? NE ? C ARG 188 NE 177 1 Y 1 C ARG 214 ? CZ ? C ARG 188 CZ 178 1 Y 1 C ARG 214 ? NH1 ? C ARG 188 NH1 179 1 Y 1 C ARG 214 ? NH2 ? C ARG 188 NH2 180 1 Y 1 C VAL 217 ? CG1 ? C VAL 191 CG1 181 1 Y 1 C VAL 217 ? CG2 ? C VAL 191 CG2 182 1 Y 1 D GLN 40 ? CG ? D GLN 14 CG 183 1 Y 1 D GLN 40 ? CD ? D GLN 14 CD 184 1 Y 1 D GLN 40 ? OE1 ? D GLN 14 OE1 185 1 Y 1 D GLN 40 ? NE2 ? D GLN 14 NE2 186 1 Y 1 D LYS 49 ? CG ? D LYS 23 CG 187 1 Y 1 D LYS 49 ? CD ? D LYS 23 CD 188 1 Y 1 D LYS 49 ? CE ? D LYS 23 CE 189 1 Y 1 D LYS 49 ? NZ ? D LYS 23 NZ 190 1 Y 1 D LYS 52 ? CG ? D LYS 26 CG 191 1 Y 1 D LYS 52 ? CD ? D LYS 26 CD 192 1 Y 1 D LYS 52 ? CE ? D LYS 26 CE 193 1 Y 1 D LYS 52 ? NZ ? D LYS 26 NZ 194 1 Y 1 D SER 53 ? OG ? D SER 27 OG 195 1 Y 1 D LYS 54 ? CG ? D LYS 28 CG 196 1 Y 1 D LYS 54 ? CD ? D LYS 28 CD 197 1 Y 1 D LYS 54 ? CE ? D LYS 28 CE 198 1 Y 1 D LYS 54 ? NZ ? D LYS 28 NZ 199 1 Y 1 D ARG 61 ? CG ? D ARG 35 CG 200 1 Y 1 D ARG 61 ? CD ? D ARG 35 CD 201 1 Y 1 D ARG 61 ? NE ? D ARG 35 NE 202 1 Y 1 D ARG 61 ? CZ ? D ARG 35 CZ 203 1 Y 1 D ARG 61 ? NH1 ? D ARG 35 NH1 204 1 Y 1 D ARG 61 ? NH2 ? D ARG 35 NH2 205 1 Y 1 D GLU 105 ? CG ? D GLU 79 CG 206 1 Y 1 D GLU 105 ? CD ? D GLU 79 CD 207 1 Y 1 D GLU 105 ? OE1 ? D GLU 79 OE1 208 1 Y 1 D GLU 105 ? OE2 ? D GLU 79 OE2 209 1 Y 1 D LYS 106 ? CG ? D LYS 80 CG 210 1 Y 1 D LYS 106 ? CD ? D LYS 80 CD 211 1 Y 1 D LYS 106 ? CE ? D LYS 80 CE 212 1 Y 1 D LYS 106 ? NZ ? D LYS 80 NZ 213 1 Y 1 D LYS 108 ? CG ? D LYS 82 CG 214 1 Y 1 D LYS 108 ? CD ? D LYS 82 CD 215 1 Y 1 D LYS 108 ? CE ? D LYS 82 CE 216 1 Y 1 D LYS 108 ? NZ ? D LYS 82 NZ 217 1 Y 1 D SER 124 ? OG ? D SER 98 OG 218 1 Y 1 D ASP 144 ? CG ? D ASP 118 CG 219 1 Y 1 D ASP 144 ? OD1 ? D ASP 118 OD1 220 1 Y 1 D ASP 144 ? OD2 ? D ASP 118 OD2 221 1 Y 1 D LYS 159 ? CG ? D LYS 133 CG 222 1 Y 1 D LYS 159 ? CD ? D LYS 133 CD 223 1 Y 1 D LYS 159 ? CE ? D LYS 133 CE 224 1 Y 1 D LYS 159 ? NZ ? D LYS 133 NZ 225 1 Y 1 D ARG 173 ? CG ? D ARG 147 CG 226 1 Y 1 D ARG 173 ? CD ? D ARG 147 CD 227 1 Y 1 D ARG 173 ? NE ? D ARG 147 NE 228 1 Y 1 D ARG 173 ? CZ ? D ARG 147 CZ 229 1 Y 1 D ARG 173 ? NH1 ? D ARG 147 NH1 230 1 Y 1 D ARG 173 ? NH2 ? D ARG 147 NH2 231 1 Y 1 D ARG 181 ? CG ? D ARG 155 CG 232 1 Y 1 D ARG 181 ? CD ? D ARG 155 CD 233 1 Y 1 D ARG 181 ? NE ? D ARG 155 NE 234 1 Y 1 D ARG 181 ? CZ ? D ARG 155 CZ 235 1 Y 1 D ARG 181 ? NH1 ? D ARG 155 NH1 236 1 Y 1 D ARG 181 ? NH2 ? D ARG 155 NH2 237 1 Y 1 D LYS 184 ? CG ? D LYS 158 CG 238 1 Y 1 D LYS 184 ? CD ? D LYS 158 CD 239 1 Y 1 D LYS 184 ? CE ? D LYS 158 CE 240 1 Y 1 D LYS 184 ? NZ ? D LYS 158 NZ 241 1 Y 1 D LEU 189 ? CG ? D LEU 163 CG 242 1 Y 1 D LEU 189 ? CD1 ? D LEU 163 CD1 243 1 Y 1 D LEU 189 ? CD2 ? D LEU 163 CD2 244 1 Y 1 D LYS 192 ? CG ? D LYS 166 CG 245 1 Y 1 D LYS 192 ? CD ? D LYS 166 CD 246 1 Y 1 D LYS 192 ? CE ? D LYS 166 CE 247 1 Y 1 D LYS 192 ? NZ ? D LYS 166 NZ 248 1 Y 1 D ILE 193 ? CG1 ? D ILE 167 CG1 249 1 Y 1 D ILE 193 ? CG2 ? D ILE 167 CG2 250 1 Y 1 D ILE 193 ? CD1 ? D ILE 167 CD1 251 1 Y 1 D VAL 194 ? CG1 ? D VAL 168 CG1 252 1 Y 1 D VAL 194 ? CG2 ? D VAL 168 CG2 253 1 Y 1 D GLN 198 ? CG ? D GLN 172 CG 254 1 Y 1 D GLN 198 ? CD ? D GLN 172 CD 255 1 Y 1 D GLN 198 ? OE1 ? D GLN 172 OE1 256 1 Y 1 D GLN 198 ? NE2 ? D GLN 172 NE2 257 1 Y 1 D SER 199 ? OG ? D SER 173 OG 258 1 Y 1 D ASP 202 ? CG ? D ASP 176 CG 259 1 Y 1 D ASP 202 ? OD1 ? D ASP 176 OD1 260 1 Y 1 D ASP 202 ? OD2 ? D ASP 176 OD2 261 1 Y 1 D LYS 212 ? CG ? D LYS 186 CG 262 1 Y 1 D LYS 212 ? CD ? D LYS 186 CD 263 1 Y 1 D LYS 212 ? CE ? D LYS 186 CE 264 1 Y 1 D LYS 212 ? NZ ? D LYS 186 NZ 265 1 Y 1 D VAL 217 ? CG1 ? D VAL 191 CG1 266 1 Y 1 D VAL 217 ? CG2 ? D VAL 191 CG2 267 1 N 1 A OYW 300 ? O15 ? E OYW 1 O15 268 1 N 1 A OYW 300 ? C18 ? E OYW 1 C18 269 1 N 1 A OYW 300 ? C19 ? E OYW 1 C19 270 1 N 1 A OYW 300 ? C20 ? E OYW 1 C20 271 1 N 1 A OYW 300 ? C21 ? E OYW 1 C21 272 1 N 1 A OYW 300 ? C22 ? E OYW 1 C22 273 1 N 1 A OYW 300 ? O16 ? E OYW 1 O16 274 1 N 1 A OYW 300 ? O17 ? E OYW 1 O17 275 1 N 1 A OYW 300 ? N6 ? E OYW 1 N6 276 1 N 1 A OYW 300 ? N7 ? E OYW 1 N7 277 1 N 1 A OYW 300 ? C23 ? E OYW 1 C23 278 1 N 1 A OYW 300 ? C24 ? E OYW 1 C24 279 1 N 1 A OYW 300 ? C25 ? E OYW 1 C25 280 1 N 1 A OYW 300 ? N8 ? E OYW 1 N8 281 1 N 1 A OYW 300 ? C26 ? E OYW 1 C26 282 1 N 1 A OYW 300 ? C27 ? E OYW 1 C27 283 1 N 1 A OYW 300 ? N9 ? E OYW 1 N9 284 1 N 1 A OYW 300 ? N10 ? E OYW 1 N10 285 1 N 1 A OYW 300 ? O18 ? E OYW 1 O18 286 1 N 1 B OYW 300 ? O15 ? G OYW 1 O15 287 1 N 1 B OYW 300 ? C18 ? G OYW 1 C18 288 1 N 1 B OYW 300 ? C19 ? G OYW 1 C19 289 1 N 1 B OYW 300 ? C20 ? G OYW 1 C20 290 1 N 1 B OYW 300 ? C21 ? G OYW 1 C21 291 1 N 1 B OYW 300 ? C22 ? G OYW 1 C22 292 1 N 1 B OYW 300 ? O16 ? G OYW 1 O16 293 1 N 1 B OYW 300 ? O17 ? G OYW 1 O17 294 1 N 1 B OYW 300 ? N6 ? G OYW 1 N6 295 1 N 1 B OYW 300 ? N7 ? G OYW 1 N7 296 1 N 1 B OYW 300 ? C23 ? G OYW 1 C23 297 1 N 1 B OYW 300 ? C24 ? G OYW 1 C24 298 1 N 1 B OYW 300 ? C25 ? G OYW 1 C25 299 1 N 1 B OYW 300 ? N8 ? G OYW 1 N8 300 1 N 1 B OYW 300 ? C26 ? G OYW 1 C26 301 1 N 1 B OYW 300 ? C27 ? G OYW 1 C27 302 1 N 1 B OYW 300 ? N9 ? G OYW 1 N9 303 1 N 1 B OYW 300 ? N10 ? G OYW 1 N10 304 1 N 1 B OYW 300 ? O18 ? G OYW 1 O18 305 1 N 1 C OYW 300 ? O15 ? I OYW 1 O15 306 1 N 1 C OYW 300 ? C18 ? I OYW 1 C18 307 1 N 1 C OYW 300 ? C19 ? I OYW 1 C19 308 1 N 1 C OYW 300 ? C20 ? I OYW 1 C20 309 1 N 1 C OYW 300 ? C21 ? I OYW 1 C21 310 1 N 1 C OYW 300 ? C22 ? I OYW 1 C22 311 1 N 1 C OYW 300 ? O16 ? I OYW 1 O16 312 1 N 1 C OYW 300 ? O17 ? I OYW 1 O17 313 1 N 1 C OYW 300 ? N6 ? I OYW 1 N6 314 1 N 1 C OYW 300 ? N7 ? I OYW 1 N7 315 1 N 1 C OYW 300 ? C23 ? I OYW 1 C23 316 1 N 1 C OYW 300 ? C24 ? I OYW 1 C24 317 1 N 1 C OYW 300 ? C25 ? I OYW 1 C25 318 1 N 1 C OYW 300 ? N8 ? I OYW 1 N8 319 1 N 1 C OYW 300 ? C26 ? I OYW 1 C26 320 1 N 1 C OYW 300 ? C27 ? I OYW 1 C27 321 1 N 1 C OYW 300 ? N9 ? I OYW 1 N9 322 1 N 1 C OYW 300 ? N10 ? I OYW 1 N10 323 1 N 1 C OYW 300 ? O18 ? I OYW 1 O18 324 1 N 1 D OYW 300 ? O15 ? J OYW 1 O15 325 1 N 1 D OYW 300 ? C18 ? J OYW 1 C18 326 1 N 1 D OYW 300 ? C19 ? J OYW 1 C19 327 1 N 1 D OYW 300 ? C20 ? J OYW 1 C20 328 1 N 1 D OYW 300 ? C21 ? J OYW 1 C21 329 1 N 1 D OYW 300 ? C22 ? J OYW 1 C22 330 1 N 1 D OYW 300 ? O16 ? J OYW 1 O16 331 1 N 1 D OYW 300 ? O17 ? J OYW 1 O17 332 1 N 1 D OYW 300 ? N6 ? J OYW 1 N6 333 1 N 1 D OYW 300 ? N7 ? J OYW 1 N7 334 1 N 1 D OYW 300 ? C23 ? J OYW 1 C23 335 1 N 1 D OYW 300 ? C24 ? J OYW 1 C24 336 1 N 1 D OYW 300 ? C25 ? J OYW 1 C25 337 1 N 1 D OYW 300 ? N8 ? J OYW 1 N8 338 1 N 1 D OYW 300 ? C26 ? J OYW 1 C26 339 1 N 1 D OYW 300 ? C27 ? J OYW 1 C27 340 1 N 1 D OYW 300 ? N9 ? J OYW 1 N9 341 1 N 1 D OYW 300 ? N10 ? J OYW 1 N10 342 1 N 1 D OYW 300 ? O18 ? J OYW 1 O18 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 85.276 _cell.angle_alpha_esd ? _cell.angle_beta 88.416 _cell.angle_beta_esd ? _cell.angle_gamma 77.234 _cell.angle_gamma_esd ? _cell.entry_id 6YLV _cell.details ? _cell.formula_units_Z ? _cell.length_a 38.350 _cell.length_a_esd ? _cell.length_b 38.390 _cell.length_b_esd ? _cell.length_c 148.080 _cell.length_c_esd ? _cell.volume 211890.347 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6YLV _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall 'P 1' _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6YLV _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.38 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.28 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Bicine pH 8.5, 0.2 M sodium formate, 19 % w/v PEGMME 5000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-01-19 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 37.7561760788 _reflns.entry_id 6YLV _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.66 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22090 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 93.59 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.7 _reflns.pdbx_Rmerge_I_obs 0.1122 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.32 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.1258 _reflns.pdbx_Rpim_I_all 0.0555 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.991 _reflns.pdbx_CC_star 0.998 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.66 _reflns_shell.d_res_low 2.755 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.04 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1453 _reflns_shell.percent_possible_all 60.42 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.571 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.6803 _reflns_shell.pdbx_Rpim_I_all 0.3611 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.764 _reflns_shell.pdbx_CC_star 0.931 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 44.7187982624 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6YLV _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.66005667871 _refine.ls_d_res_low 49.1900006675 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22081 _refine.ls_number_reflns_R_free 814 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 93.6032217041 _refine.ls_percent_reflns_R_free 3.68642724514 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.203474516796 _refine.ls_R_factor_R_free 0.255269123128 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.201483739807 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.9795919456 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method NONE _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1L8B _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.0057895497 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.343454744046 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.66005667871 _refine_hist.d_res_low 49.1900006675 _refine_hist.number_atoms_solvent 242 _refine_hist.number_atoms_total 6164 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 5750 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 172 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.00618132238273 ? 6233 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.746652085593 ? 8545 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.360645201754 ? 907 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.00337122667591 ? 1056 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 10.8629456457 ? 4494 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.6601 2.8267 . . 105 2738 72.4515800204 . . . 0.309865088254 . 0.237749979254 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8267 3.0449 . . 140 3647 97.0030737705 . . . 0.328900743504 . 0.243432463449 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0449 3.3513 . . 141 3683 96.9574036511 . . . 0.282311660196 . 0.220167673509 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3513 3.8361 . . 143 3739 97.2932330827 . . . 0.270952156704 . 0.196362745022 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8361 4.8324 . . 144 3759 99.617151608 . . . 0.223308231778 . 0.170855201258 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.8324 49.19 . . 141 3701 98.2860066513 . . . 0.219775397934 . 0.201612313809 . . . . . . . . . . . # loop_ _struct_ncs_dom.id _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.details 1 1 ? 2 1 ? 3 1 ? 4 1 ? # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A GLU 6 . A LYS 10 . A GLU 32 A LYS 36 ? ;(chain 'A' and (resid 32 through 36 or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 48 or (resid 49 through 50 and (name N or name CA or name C or name O or name CB )) or resid 51 or (resid 52 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 101 or resid 103 through 105 or (resid 106 and (name N or name CA or name C or name O or name CB )) or resid 107 or (resid 108 through 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 119 or resid 121 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB )) or resid 125 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 170 or (resid 171 through 173 and (name N or name CA or name C or name O or name CB )) or resid 174 through 180 or (resid 181 through 182 and (name N or name CA or name C or name O or name CB )) or resid 183 or (resid 184 through 185 and (name N or name CA or name C or name O or name CB )) or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 197 or (resid 198 through 199 and (name N or name CA or name C or name O or name CB )) or resid 200 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or (resid 212 and (name N or name CA or name C or name O or name CB )) or resid 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB or name OXT)))) ; 1 1 2 A PRO 12 . A MET 75 . A PRO 38 A MET 101 ? ;(chain 'A' and (resid 32 through 36 or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 48 or (resid 49 through 50 and (name N or name CA or name C or name O or name CB )) or resid 51 or (resid 52 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 101 or resid 103 through 105 or (resid 106 and (name N or name CA or name C or name O or name CB )) or resid 107 or (resid 108 through 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 119 or resid 121 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB )) or resid 125 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 170 or (resid 171 through 173 and (name N or name CA or name C or name O or name CB )) or resid 174 through 180 or (resid 181 through 182 and (name N or name CA or name C or name O or name CB )) or resid 183 or (resid 184 through 185 and (name N or name CA or name C or name O or name CB )) or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 197 or (resid 198 through 199 and (name N or name CA or name C or name O or name CB )) or resid 200 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or (resid 212 and (name N or name CA or name C or name O or name CB )) or resid 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB or name OXT)))) ; 1 1 3 A GLU 77 . A LYS 93 . A GLU 103 A LYS 119 ? ;(chain 'A' and (resid 32 through 36 or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 48 or (resid 49 through 50 and (name N or name CA or name C or name O or name CB )) or resid 51 or (resid 52 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 101 or resid 103 through 105 or (resid 106 and (name N or name CA or name C or name O or name CB )) or resid 107 or (resid 108 through 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 119 or resid 121 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB )) or resid 125 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 170 or (resid 171 through 173 and (name N or name CA or name C or name O or name CB )) or resid 174 through 180 or (resid 181 through 182 and (name N or name CA or name C or name O or name CB )) or resid 183 or (resid 184 through 185 and (name N or name CA or name C or name O or name CB )) or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 197 or (resid 198 through 199 and (name N or name CA or name C or name O or name CB )) or resid 200 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or (resid 212 and (name N or name CA or name C or name O or name CB )) or resid 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB or name OXT)))) ; 1 1 4 A GLN 95 . A ALA 175 . A GLN 121 A ALA 201 ? ;(chain 'A' and (resid 32 through 36 or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 48 or (resid 49 through 50 and (name N or name CA or name C or name O or name CB )) or resid 51 or (resid 52 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 101 or resid 103 through 105 or (resid 106 and (name N or name CA or name C or name O or name CB )) or resid 107 or (resid 108 through 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 119 or resid 121 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB )) or resid 125 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 170 or (resid 171 through 173 and (name N or name CA or name C or name O or name CB )) or resid 174 through 180 or (resid 181 through 182 and (name N or name CA or name C or name O or name CB )) or resid 183 or (resid 184 through 185 and (name N or name CA or name C or name O or name CB )) or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 197 or (resid 198 through 199 and (name N or name CA or name C or name O or name CB )) or resid 200 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or (resid 212 and (name N or name CA or name C or name O or name CB )) or resid 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB or name OXT)))) ; 1 1 5 A LYS 186 . A VAL 191 . A LYS 212 A VAL 217 ? ;(chain 'A' and (resid 32 through 36 or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 48 or (resid 49 through 50 and (name N or name CA or name C or name O or name CB )) or resid 51 or (resid 52 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 101 or resid 103 through 105 or (resid 106 and (name N or name CA or name C or name O or name CB )) or resid 107 or (resid 108 through 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 119 or resid 121 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB )) or resid 125 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 170 or (resid 171 through 173 and (name N or name CA or name C or name O or name CB )) or resid 174 through 180 or (resid 181 through 182 and (name N or name CA or name C or name O or name CB )) or resid 183 or (resid 184 through 185 and (name N or name CA or name C or name O or name CB )) or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 197 or (resid 198 through 199 and (name N or name CA or name C or name O or name CB )) or resid 200 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or (resid 212 and (name N or name CA or name C or name O or name CB )) or resid 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB or name OXT)))) ; 1 2 6 B GLU 6 . B LYS 10 . B GLU 32 B LYS 36 ? ;(chain 'B' and (resid 32 through 36 or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 48 or (resid 49 through 50 and (name N or name CA or name C or name O or name CB )) or resid 51 or (resid 52 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 56 or (resid 57 through 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 101 or resid 103 through 105 or (resid 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 119 or resid 121 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB )) or resid 125 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 170 or (resid 171 through 173 and (name N or name CA or name C or name O or name CB )) or resid 174 through 180 or (resid 181 through 182 and (name N or name CA or name C or name O or name CB )) or resid 183 or (resid 184 through 185 and (name N or name CA or name C or name O or name CB )) or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 193 or (resid 194 through 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 197 or (resid 198 through 199 and (name N or name CA or name C or name O or name CB )) or resid 200 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 212 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB or name OXT)))) ; 1 2 7 B PRO 12 . B MET 75 . B PRO 38 B MET 101 ? ;(chain 'B' and (resid 32 through 36 or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 48 or (resid 49 through 50 and (name N or name CA or name C or name O or name CB )) or resid 51 or (resid 52 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 56 or (resid 57 through 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 101 or resid 103 through 105 or (resid 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 119 or resid 121 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB )) or resid 125 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 170 or (resid 171 through 173 and (name N or name CA or name C or name O or name CB )) or resid 174 through 180 or (resid 181 through 182 and (name N or name CA or name C or name O or name CB )) or resid 183 or (resid 184 through 185 and (name N or name CA or name C or name O or name CB )) or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 193 or (resid 194 through 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 197 or (resid 198 through 199 and (name N or name CA or name C or name O or name CB )) or resid 200 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 212 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB or name OXT)))) ; 1 2 8 B GLU 77 . B LYS 93 . B GLU 103 B LYS 119 ? ;(chain 'B' and (resid 32 through 36 or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 48 or (resid 49 through 50 and (name N or name CA or name C or name O or name CB )) or resid 51 or (resid 52 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 56 or (resid 57 through 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 101 or resid 103 through 105 or (resid 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 119 or resid 121 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB )) or resid 125 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 170 or (resid 171 through 173 and (name N or name CA or name C or name O or name CB )) or resid 174 through 180 or (resid 181 through 182 and (name N or name CA or name C or name O or name CB )) or resid 183 or (resid 184 through 185 and (name N or name CA or name C or name O or name CB )) or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 193 or (resid 194 through 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 197 or (resid 198 through 199 and (name N or name CA or name C or name O or name CB )) or resid 200 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 212 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB or name OXT)))) ; 1 2 9 B GLN 95 . B ALA 175 . B GLN 121 B ALA 201 ? ;(chain 'B' and (resid 32 through 36 or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 48 or (resid 49 through 50 and (name N or name CA or name C or name O or name CB )) or resid 51 or (resid 52 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 56 or (resid 57 through 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 101 or resid 103 through 105 or (resid 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 119 or resid 121 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB )) or resid 125 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 170 or (resid 171 through 173 and (name N or name CA or name C or name O or name CB )) or resid 174 through 180 or (resid 181 through 182 and (name N or name CA or name C or name O or name CB )) or resid 183 or (resid 184 through 185 and (name N or name CA or name C or name O or name CB )) or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 193 or (resid 194 through 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 197 or (resid 198 through 199 and (name N or name CA or name C or name O or name CB )) or resid 200 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 212 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB or name OXT)))) ; 1 2 10 B LYS 186 . B VAL 191 . B LYS 212 B VAL 217 ? ;(chain 'B' and (resid 32 through 36 or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 48 or (resid 49 through 50 and (name N or name CA or name C or name O or name CB )) or resid 51 or (resid 52 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 56 or (resid 57 through 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 101 or resid 103 through 105 or (resid 106 and (name N or name CA or name C or name O or name CB )) or resid 107 through 119 or resid 121 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB )) or resid 125 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 170 or (resid 171 through 173 and (name N or name CA or name C or name O or name CB )) or resid 174 through 180 or (resid 181 through 182 and (name N or name CA or name C or name O or name CB )) or resid 183 or (resid 184 through 185 and (name N or name CA or name C or name O or name CB )) or resid 186 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 193 or (resid 194 through 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 197 or (resid 198 through 199 and (name N or name CA or name C or name O or name CB )) or resid 200 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 212 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB or name OXT)))) ; 1 3 11 C GLU 6 . C LYS 10 . C GLU 32 C LYS 36 ? ;(chain 'C' and (resid 32 through 36 or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 101 or resid 103 through 119 or resid 121 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB )) or resid 125 through 172 or (resid 173 and (name N or name CA or name C or name O or name CB )) or resid 174 through 180 or (resid 181 through 182 and (name N or name CA or name C or name O or name CB )) or resid 183 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 198 or (resid 199 and (name N or name CA or name C or name O or name CB )) or resid 200 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 212 through 217)) ; 1 3 12 C PRO 12 . C MET 75 . C PRO 38 C MET 101 ? ;(chain 'C' and (resid 32 through 36 or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 101 or resid 103 through 119 or resid 121 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB )) or resid 125 through 172 or (resid 173 and (name N or name CA or name C or name O or name CB )) or resid 174 through 180 or (resid 181 through 182 and (name N or name CA or name C or name O or name CB )) or resid 183 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 198 or (resid 199 and (name N or name CA or name C or name O or name CB )) or resid 200 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 212 through 217)) ; 1 3 13 C GLU 77 . C LYS 93 . C GLU 103 C LYS 119 ? ;(chain 'C' and (resid 32 through 36 or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 101 or resid 103 through 119 or resid 121 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB )) or resid 125 through 172 or (resid 173 and (name N or name CA or name C or name O or name CB )) or resid 174 through 180 or (resid 181 through 182 and (name N or name CA or name C or name O or name CB )) or resid 183 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 198 or (resid 199 and (name N or name CA or name C or name O or name CB )) or resid 200 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 212 through 217)) ; 1 3 14 C GLN 95 . C ALA 175 . C GLN 121 C ALA 201 ? ;(chain 'C' and (resid 32 through 36 or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 101 or resid 103 through 119 or resid 121 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB )) or resid 125 through 172 or (resid 173 and (name N or name CA or name C or name O or name CB )) or resid 174 through 180 or (resid 181 through 182 and (name N or name CA or name C or name O or name CB )) or resid 183 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 198 or (resid 199 and (name N or name CA or name C or name O or name CB )) or resid 200 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 212 through 217)) ; 1 3 15 C LYS 186 . C VAL 191 . C LYS 212 C VAL 217 ? ;(chain 'C' and (resid 32 through 36 or resid 38 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 101 or resid 103 through 119 or resid 121 through 123 or (resid 124 and (name N or name CA or name C or name O or name CB )) or resid 125 through 172 or (resid 173 and (name N or name CA or name C or name O or name CB )) or resid 174 through 180 or (resid 181 through 182 and (name N or name CA or name C or name O or name CB )) or resid 183 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 192 or (resid 193 through 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 198 or (resid 199 and (name N or name CA or name C or name O or name CB )) or resid 200 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 212 through 217)) ; 1 4 16 D GLU 6 . D LYS 10 . D GLU 32 D LYS 36 ? ;(chain 'D' and ((resid 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 36 or resid 38 through 49 or (resid 50 and (name N or name CA or name C or name O or name CB )) or resid 51 through 56 or (resid 57 through 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 101 or resid 103 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 119 or resid 121 through 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 170 or (resid 171 through 173 and (name N or name CA or name C or name O or name CB )) or resid 174 through 181 or (resid 182 and (name N or name CA or name C or name O or name CB )) or resid 183 through 184 or (resid 185 and (name N or name CA or name C or name O or name CB )) or resid 186 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 217)) ; 1 4 17 D PRO 12 . D MET 75 . D PRO 38 D MET 101 ? ;(chain 'D' and ((resid 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 36 or resid 38 through 49 or (resid 50 and (name N or name CA or name C or name O or name CB )) or resid 51 through 56 or (resid 57 through 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 101 or resid 103 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 119 or resid 121 through 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 170 or (resid 171 through 173 and (name N or name CA or name C or name O or name CB )) or resid 174 through 181 or (resid 182 and (name N or name CA or name C or name O or name CB )) or resid 183 through 184 or (resid 185 and (name N or name CA or name C or name O or name CB )) or resid 186 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 217)) ; 1 4 18 D GLU 77 . D LYS 93 . D GLU 103 D LYS 119 ? ;(chain 'D' and ((resid 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 36 or resid 38 through 49 or (resid 50 and (name N or name CA or name C or name O or name CB )) or resid 51 through 56 or (resid 57 through 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 101 or resid 103 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 119 or resid 121 through 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 170 or (resid 171 through 173 and (name N or name CA or name C or name O or name CB )) or resid 174 through 181 or (resid 182 and (name N or name CA or name C or name O or name CB )) or resid 183 through 184 or (resid 185 and (name N or name CA or name C or name O or name CB )) or resid 186 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 217)) ; 1 4 19 D GLN 95 . D ALA 175 . D GLN 121 D ALA 201 ? ;(chain 'D' and ((resid 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 36 or resid 38 through 49 or (resid 50 and (name N or name CA or name C or name O or name CB )) or resid 51 through 56 or (resid 57 through 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 101 or resid 103 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 119 or resid 121 through 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 170 or (resid 171 through 173 and (name N or name CA or name C or name O or name CB )) or resid 174 through 181 or (resid 182 and (name N or name CA or name C or name O or name CB )) or resid 183 through 184 or (resid 185 and (name N or name CA or name C or name O or name CB )) or resid 186 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 217)) ; 1 4 20 D LYS 186 . D VAL 191 . D LYS 212 D VAL 217 ? ;(chain 'D' and ((resid 32 and (name N or name CA or name C or name O or name CB )) or resid 33 through 36 or resid 38 through 49 or (resid 50 and (name N or name CA or name C or name O or name CB )) or resid 51 through 56 or (resid 57 through 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 101 or resid 103 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 119 or resid 121 through 145 or (resid 146 and (name N or name CA or name C or name O or name CB )) or resid 147 through 170 or (resid 171 through 173 and (name N or name CA or name C or name O or name CB )) or resid 174 through 181 or (resid 182 and (name N or name CA or name C or name O or name CB )) or resid 183 through 184 or (resid 185 and (name N or name CA or name C or name O or name CB )) or resid 186 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 217)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 6YLV _struct.title ;Translation initiation factor 4E in complex with 4-Cl-Bn7GpppG mRNA 5' cap analog ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6YLV _struct_keywords.text 'cap analog, translation initiation factor, 4-Cl-Bn7GpppG, protein-ligand complex, eIF4E, RNA binding protein, TRANSLATION' _struct_keywords.pdbx_keywords TRANSLATION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 3 ? G N N 2 ? H N N 3 ? I N N 2 ? J N N 2 ? K N N 4 ? L N N 4 ? M N N 4 ? N N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IF4E_MOUSE _struct_ref.pdbx_db_accession P63073 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKN KRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKERL GLPPKIVIGYQSHADTATKSGSTTKNRFVV ; _struct_ref.pdbx_align_begin 28 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6YLV A 2 ? 191 ? P63073 28 ? 217 ? 28 217 2 1 6YLV B 2 ? 191 ? P63073 28 ? 217 ? 28 217 3 1 6YLV C 2 ? 191 ? P63073 28 ? 217 ? 28 217 4 1 6YLV D 2 ? 191 ? P63073 28 ? 217 ? 28 217 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6YLV MET A 1 ? UNP P63073 ? ? 'initiating methionine' 27 1 2 6YLV MET B 1 ? UNP P63073 ? ? 'initiating methionine' 27 2 3 6YLV MET C 1 ? UNP P63073 ? ? 'initiating methionine' 27 3 4 6YLV MET D 1 ? UNP P63073 ? ? 'initiating methionine' 27 4 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 3 author_defined_assembly ? monomeric 1 4 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,E,F,K 2 1 B,G,H,L 3 1 C,I,M 4 1 D,J,N # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 4 ? TYR A 8 ? ASN A 30 TYR A 34 5 ? 5 HELX_P HELX_P2 AA2 TRP A 30 ? ALA A 32 ? TRP A 56 ALA A 58 5 ? 3 HELX_P HELX_P3 AA3 VAL A 43 ? ASN A 51 ? VAL A 69 ASN A 77 1 ? 9 HELX_P HELX_P4 AA4 LEU A 55 ? LEU A 59 ? LEU A 81 LEU A 85 5 ? 5 HELX_P HELX_P5 AA5 GLN A 94 ? ASP A 99 ? GLN A 120 ASP A 125 1 ? 6 HELX_P HELX_P6 AA6 ASP A 99 ? GLY A 113 ? ASP A 125 GLY A 139 1 ? 15 HELX_P HELX_P7 AA7 PHE A 116 ? ASP A 121 ? PHE A 142 ASP A 147 5 ? 6 HELX_P HELX_P8 AA8 ASN A 146 ? LEU A 161 ? ASN A 172 LEU A 187 1 ? 16 HELX_P HELX_P9 AA9 HIS A 174 ? ALA A 178 ? HIS A 200 ALA A 204 1 ? 5 HELX_P HELX_P10 AB1 TRP B 30 ? ALA B 32 ? TRP B 56 ALA B 58 5 ? 3 HELX_P HELX_P11 AB2 VAL B 43 ? ASN B 51 ? VAL B 69 ASN B 77 1 ? 9 HELX_P HELX_P12 AB3 LEU B 55 ? LEU B 59 ? LEU B 81 LEU B 85 5 ? 5 HELX_P HELX_P13 AB4 ASN B 92 ? ASP B 99 ? ASN B 118 ASP B 125 1 ? 8 HELX_P HELX_P14 AB5 ASP B 99 ? GLY B 113 ? ASP B 125 GLY B 139 1 ? 15 HELX_P HELX_P15 AB6 PHE B 116 ? ASP B 121 ? PHE B 142 ASP B 147 5 ? 6 HELX_P HELX_P16 AB7 ASN B 146 ? GLY B 162 ? ASN B 172 GLY B 188 1 ? 17 HELX_P HELX_P17 AB8 HIS B 174 ? ALA B 178 ? HIS B 200 ALA B 204 1 ? 5 HELX_P HELX_P18 AB9 TRP C 30 ? ALA C 32 ? TRP C 56 ALA C 58 5 ? 3 HELX_P HELX_P19 AC1 VAL C 43 ? ASN C 51 ? VAL C 69 ASN C 77 1 ? 9 HELX_P HELX_P20 AC2 GLN C 94 ? ASP C 99 ? GLN C 120 ASP C 125 1 ? 6 HELX_P HELX_P21 AC3 ASP C 99 ? GLY C 113 ? ASP C 125 GLY C 139 1 ? 15 HELX_P HELX_P22 AC4 PHE C 116 ? ASP C 121 ? PHE C 142 ASP C 147 5 ? 6 HELX_P HELX_P23 AC5 ASN C 146 ? GLY C 162 ? ASN C 172 GLY C 188 1 ? 17 HELX_P HELX_P24 AC6 TRP D 30 ? ALA D 32 ? TRP D 56 ALA D 58 5 ? 3 HELX_P HELX_P25 AC7 VAL D 43 ? ASN D 51 ? VAL D 69 ASN D 77 1 ? 9 HELX_P HELX_P26 AC8 LEU D 55 ? LEU D 59 ? LEU D 81 LEU D 85 5 ? 5 HELX_P HELX_P27 AC9 GLN D 94 ? ASP D 99 ? GLN D 120 ASP D 125 1 ? 6 HELX_P HELX_P28 AD1 ASP D 99 ? GLY D 113 ? ASP D 125 GLY D 139 1 ? 15 HELX_P HELX_P29 AD2 PHE D 116 ? ASP D 121 ? PHE D 142 ASP D 147 5 ? 6 HELX_P HELX_P30 AD3 ASN D 146 ? GLY D 162 ? ASN D 172 GLY D 188 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 8 ? AA3 ? 8 ? AA4 ? 8 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA3 6 7 ? anti-parallel AA3 7 8 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel AA4 5 6 ? anti-parallel AA4 6 7 ? anti-parallel AA4 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 34 ? THR A 42 ? LEU A 60 THR A 68 AA1 2 PRO A 12 ? LYS A 23 ? PRO A 38 LYS A 49 AA1 3 CYS A 63 ? LYS A 69 ? CYS A 89 LYS A 95 AA1 4 VAL A 123 ? ASN A 129 ? VAL A 149 ASN A 155 AA1 5 LYS A 136 ? THR A 141 ? LYS A 162 THR A 167 AA1 6 GLY A 85 ? THR A 90 ? GLY A 111 THR A 116 AA1 7 ILE A 169 ? SER A 173 ? ILE A 195 SER A 199 AA1 8 PHE A 189 ? VAL A 191 ? PHE A 215 VAL A 217 AA2 1 LEU B 34 ? THR B 42 ? LEU B 60 THR B 68 AA2 2 PRO B 12 ? LYS B 23 ? PRO B 38 LYS B 49 AA2 3 CYS B 63 ? LYS B 69 ? CYS B 89 LYS B 95 AA2 4 VAL B 123 ? VAL B 130 ? VAL B 149 VAL B 156 AA2 5 LYS B 136 ? THR B 141 ? LYS B 162 THR B 167 AA2 6 GLY B 85 ? THR B 90 ? GLY B 111 THR B 116 AA2 7 ILE B 169 ? SER B 173 ? ILE B 195 SER B 199 AA2 8 PHE B 189 ? VAL B 191 ? PHE B 215 VAL B 217 AA3 1 LEU C 34 ? THR C 42 ? LEU C 60 THR C 68 AA3 2 PRO C 12 ? PHE C 22 ? PRO C 38 PHE C 48 AA3 3 ASP C 64 ? LYS C 69 ? ASP C 90 LYS C 95 AA3 4 VAL C 123 ? ASN C 129 ? VAL C 149 ASN C 155 AA3 5 ASP C 135 ? THR C 141 ? ASP C 161 THR C 167 AA3 6 GLY C 85 ? LEU C 91 ? GLY C 111 LEU C 117 AA3 7 ILE C 169 ? SER C 173 ? ILE C 195 SER C 199 AA3 8 PHE C 189 ? VAL C 191 ? PHE C 215 VAL C 217 AA4 1 LEU D 34 ? THR D 42 ? LEU D 60 THR D 68 AA4 2 PRO D 12 ? PHE D 22 ? PRO D 38 PHE D 48 AA4 3 CYS D 63 ? LYS D 69 ? CYS D 89 LYS D 95 AA4 4 VAL D 123 ? VAL D 130 ? VAL D 149 VAL D 156 AA4 5 ASP D 135 ? THR D 141 ? ASP D 161 THR D 167 AA4 6 GLY D 85 ? LEU D 91 ? GLY D 111 LEU D 117 AA4 7 ILE D 169 ? SER D 173 ? ILE D 195 SER D 199 AA4 8 PHE D 189 ? VAL D 191 ? PHE D 215 VAL D 217 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ASP A 41 ? O ASP A 67 N LEU A 13 ? N LEU A 39 AA1 2 3 N TRP A 20 ? N TRP A 46 O SER A 66 ? O SER A 92 AA1 3 4 N TYR A 65 ? N TYR A 91 O VAL A 128 ? O VAL A 154 AA1 4 5 N GLY A 125 ? N GLY A 151 O TRP A 140 ? O TRP A 166 AA1 5 6 O THR A 141 ? O THR A 167 N GLY A 85 ? N GLY A 111 AA1 6 7 N LEU A 88 ? N LEU A 114 O GLY A 170 ? O GLY A 196 AA1 7 8 N ILE A 169 ? N ILE A 195 O VAL A 191 ? O VAL A 217 AA2 1 2 O ASP B 41 ? O ASP B 67 N LEU B 13 ? N LEU B 39 AA2 2 3 N TRP B 20 ? N TRP B 46 O SER B 66 ? O SER B 92 AA2 3 4 N LEU B 67 ? N LEU B 93 O ALA B 126 ? O ALA B 152 AA2 4 5 N CYS B 124 ? N CYS B 150 O TRP B 140 ? O TRP B 166 AA2 5 6 O THR B 141 ? O THR B 167 N GLY B 85 ? N GLY B 111 AA2 6 7 N ARG B 86 ? N ARG B 112 O GLN B 172 ? O GLN B 198 AA2 7 8 N ILE B 169 ? N ILE B 195 O VAL B 191 ? O VAL B 217 AA3 1 2 O ASP C 41 ? O ASP C 67 N LEU C 13 ? N LEU C 39 AA3 2 3 N TRP C 20 ? N TRP C 46 O SER C 66 ? O SER C 92 AA3 3 4 N LEU C 67 ? N LEU C 93 O ALA C 126 ? O ALA C 152 AA3 4 5 N GLY C 125 ? N GLY C 151 O TRP C 140 ? O TRP C 166 AA3 5 6 O THR C 141 ? O THR C 167 N GLY C 85 ? N GLY C 111 AA3 6 7 N ARG C 86 ? N ARG C 112 O GLN C 172 ? O GLN C 198 AA3 7 8 N ILE C 169 ? N ILE C 195 O VAL C 191 ? O VAL C 217 AA4 1 2 O ASP D 41 ? O ASP D 67 N LEU D 13 ? N LEU D 39 AA4 2 3 N TRP D 20 ? N TRP D 46 O SER D 66 ? O SER D 92 AA4 3 4 N LEU D 67 ? N LEU D 93 O ALA D 126 ? O ALA D 152 AA4 4 5 N ASN D 129 ? N ASN D 155 O LYS D 136 ? O LYS D 162 AA4 5 6 O THR D 141 ? O THR D 167 N GLY D 85 ? N GLY D 111 AA4 6 7 N ARG D 86 ? N ARG D 112 O GLN D 172 ? O GLN D 198 AA4 7 8 N ILE D 169 ? N ILE D 195 O VAL D 191 ? O VAL D 217 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A OYW 300 ? 12 'binding site for residue OYW A 300' AC2 Software A GOL 301 ? 5 'binding site for residue GOL A 301' AC3 Software B OYW 300 ? 14 'binding site for residue OYW B 300' AC4 Software B GOL 301 ? 2 'binding site for residue GOL B 301' AC5 Software C OYW 300 ? 11 'binding site for residue OYW C 300' AC6 Software D OYW 300 ? 11 'binding site for residue OYW D 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 TRP A 30 ? TRP A 56 . ? 1_555 ? 2 AC1 12 ASP A 64 ? ASP A 90 . ? 1_555 ? 3 AC1 12 SER A 66 ? SER A 92 . ? 1_555 ? 4 AC1 12 PRO A 74 ? PRO A 100 . ? 1_555 ? 5 AC1 12 MET A 75 ? MET A 101 . ? 1_555 ? 6 AC1 12 TRP A 76 ? TRP A 102 . ? 1_555 ? 7 AC1 12 GLU A 77 ? GLU A 103 . ? 1_555 ? 8 AC1 12 ASN A 129 ? ASN A 155 . ? 1_555 ? 9 AC1 12 ARG A 131 ? ARG A 157 . ? 1_555 ? 10 AC1 12 LYS A 136 ? LYS A 162 . ? 1_555 ? 11 AC1 12 TRP A 140 ? TRP A 166 . ? 1_555 ? 12 AC1 12 HOH K . ? HOH A 447 . ? 1_555 ? 13 AC2 5 THR A 90 ? THR A 116 . ? 1_555 ? 14 AC2 5 GLN A 95 ? GLN A 121 . ? 1_555 ? 15 AC2 5 LEU A 163 ? LEU A 189 . ? 1_555 ? 16 AC2 5 ILE A 167 ? ILE A 193 . ? 1_555 ? 17 AC2 5 HOH K . ? HOH A 438 . ? 1_555 ? 18 AC3 14 TRP B 30 ? TRP B 56 . ? 1_555 ? 19 AC3 14 ASP B 64 ? ASP B 90 . ? 1_555 ? 20 AC3 14 SER B 66 ? SER B 92 . ? 1_555 ? 21 AC3 14 PRO B 74 ? PRO B 100 . ? 1_555 ? 22 AC3 14 MET B 75 ? MET B 101 . ? 1_555 ? 23 AC3 14 TRP B 76 ? TRP B 102 . ? 1_555 ? 24 AC3 14 GLU B 77 ? GLU B 103 . ? 1_555 ? 25 AC3 14 ASN B 129 ? ASN B 155 . ? 1_555 ? 26 AC3 14 ARG B 131 ? ARG B 157 . ? 1_555 ? 27 AC3 14 LYS B 136 ? LYS B 162 . ? 1_555 ? 28 AC3 14 TRP B 140 ? TRP B 166 . ? 1_555 ? 29 AC3 14 HOH L . ? HOH B 407 . ? 1_555 ? 30 AC3 14 HOH L . ? HOH B 439 . ? 1_555 ? 31 AC3 14 HOH L . ? HOH B 445 . ? 1_555 ? 32 AC4 2 THR B 90 ? THR B 116 . ? 1_555 ? 33 AC4 2 GLN B 95 ? GLN B 121 . ? 1_555 ? 34 AC5 11 TRP C 30 ? TRP C 56 . ? 1_555 ? 35 AC5 11 ASP C 64 ? ASP C 90 . ? 1_555 ? 36 AC5 11 SER C 66 ? SER C 92 . ? 1_555 ? 37 AC5 11 PRO C 74 ? PRO C 100 . ? 1_555 ? 38 AC5 11 MET C 75 ? MET C 101 . ? 1_555 ? 39 AC5 11 TRP C 76 ? TRP C 102 . ? 1_555 ? 40 AC5 11 GLU C 77 ? GLU C 103 . ? 1_555 ? 41 AC5 11 ASN C 129 ? ASN C 155 . ? 1_555 ? 42 AC5 11 ARG C 131 ? ARG C 157 . ? 1_555 ? 43 AC5 11 LYS C 136 ? LYS C 162 . ? 1_555 ? 44 AC5 11 HOH M . ? HOH C 407 . ? 1_555 ? 45 AC6 11 TRP D 30 ? TRP D 56 . ? 1_555 ? 46 AC6 11 ASP D 64 ? ASP D 90 . ? 1_555 ? 47 AC6 11 SER D 66 ? SER D 92 . ? 1_555 ? 48 AC6 11 PRO D 74 ? PRO D 100 . ? 1_555 ? 49 AC6 11 MET D 75 ? MET D 101 . ? 1_555 ? 50 AC6 11 TRP D 76 ? TRP D 102 . ? 1_555 ? 51 AC6 11 GLU D 77 ? GLU D 103 . ? 1_555 ? 52 AC6 11 ASN D 129 ? ASN D 155 . ? 1_555 ? 53 AC6 11 ARG D 131 ? ARG D 157 . ? 1_555 ? 54 AC6 11 LYS D 136 ? LYS D 162 . ? 1_555 ? 55 AC6 11 HOH N . ? HOH D 425 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD2 _pdbx_validate_close_contact.auth_asym_id_1 D _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 125 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 NH2 _pdbx_validate_close_contact.auth_asym_id_2 D _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 128 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.16 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG C ARG 128 ? ? CD C ARG 128 ? ? NE C ARG 128 ? ? 129.80 111.80 18.00 2.10 N 2 1 NE C ARG 128 ? ? CZ C ARG 128 ? ? NH1 C ARG 128 ? ? 125.47 120.30 5.17 0.50 N 3 1 NE C ARG 128 ? ? CZ C ARG 128 ? ? NH2 C ARG 128 ? ? 116.69 120.30 -3.61 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 143 ? ? 61.42 -132.79 2 1 GLU B 32 ? ? -36.50 -35.22 3 1 ASP B 143 ? ? 62.48 -133.28 4 1 ASP C 143 ? ? 60.65 -132.88 5 1 ASP D 143 ? ? 59.53 -132.26 # _space_group_symop.id 1 _space_group_symop.operation_xyz x,y,z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -69.4633772416 59.8165366786 1.16480038177 0.163194261158 ? -0.208722209139 ? -0.0495486571718 ? 0.357471146245 ? 0.139605831823 ? 0.483151232893 ? 3.25536361395 ? -0.607071351591 ? 0.142405177791 ? 1.01282487348 ? -1.09158693143 ? 2.23457468005 ? 0.19205007131 ? 0.343317009755 ? -0.546715410996 ? -0.294420206679 ? 0.133619026627 ? 0.364792865539 ? 0.393689530832 ? -0.247093776645 ? -0.216398904477 ? 2 'X-RAY DIFFRACTION' ? refined -56.255051405 84.4238907461 7.57486945293 -0.00923111893197 ? 0.0630830296518 ? -0.14419598506 ? 0.168340746614 ? 0.173322986729 ? 0.519444124651 ? 1.09224766831 ? -0.448374063636 ? -0.201335985897 ? 0.18934033287 ? 0.0438639198453 ? 0.385614369168 ? 0.163697296019 ? 0.136941754503 ? 0.470618927666 ? -0.0705295127499 ? 0.102298986141 ? -0.0902130616907 ? -0.176993058627 ? 0.150770615939 ? 0.623667667078 ? 3 'X-RAY DIFFRACTION' ? refined -53.7621387869 72.9590304164 3.90768863141 0.125641753261 ? -0.00406249125402 ? -0.0889979301314 ? 0.21336246667 ? 0.0368812581207 ? 0.44430872214 ? 2.4776956837 ? 0.145020257862 ? -0.554188840776 ? 1.36744702903 ? 0.219574568342 ? 3.08507647635 ? 0.0234071785238 ? 0.262629373429 ? 0.202798208806 ? -0.294854601228 ? 0.0282627328697 ? -0.15066471195 ? -0.0466173823755 ? 0.249564204224 ? -0.290372801353 ? 4 'X-RAY DIFFRACTION' ? refined -63.1250225534 81.6242031208 19.9213490179 0.237990324726 ? -0.0419387586362 ? -0.0510309791428 ? 0.281840414209 ? -0.0553479964824 ? 0.403233579585 ? 4.69320566013 ? 1.76514519578 ? 3.45901840291 ? 6.37389618425 ? 2.74525845219 ? 3.7054975256 ? 0.000125602677245 ? -0.48394958332 ? 0.206323474859 ? -0.242376702301 ? 0.0290214728712 ? -0.283564523753 ? -0.484771413841 ? -0.164890365028 ? -0.0765697946286 ? 5 'X-RAY DIFFRACTION' ? refined -47.5659630324 68.9035858311 14.3934216514 0.134680506957 ? -0.100585564098 ? -0.0189508452143 ? 0.226522793612 ? 0.175006530177 ? 0.513550914013 ? 0.788038134454 ? 0.482257487532 ? -0.064264983808 ? 0.31360347463 ? -0.125375696075 ? 0.38058701693 ? -0.0336091662186 ? -0.194711384043 ? -0.0962552854487 ? -0.00444123724548 ? -0.169938117622 ? -0.0761306235777 ? 0.240775081945 ? 0.0638261307878 ? -0.305781847585 ? 6 'X-RAY DIFFRACTION' ? refined -53.742586525 70.2496294806 22.8941350509 0.233768728816 ? -0.0333495413613 ? -0.0128745709306 ? 0.300222247798 ? 0.11365437617 ? 0.310459202229 ? 1.83970375493 ? -0.146446924497 ? -0.258991376429 ? 2.88018301891 ? 0.66734067761 ? 3.08300630959 ? 0.00465737819869 ? -0.429235918045 ? -0.064527912291 ? 0.483846851374 ? 0.0494792495676 ? 0.171928873154 ? 0.08726654573 ? 0.057390223803 ? -0.00156815950184 ? 7 'X-RAY DIFFRACTION' ? refined -51.4535667442 75.176958665 31.3188392001 0.271185892622 ? 0.174447404184 ? 0.0608669195756 ? 0.33501338355 ? 0.21277572772 ? 0.494305779322 ? 1.19263148968 ? -1.58199812949 ? 1.35763109457 ? 3.35496008314 ? -0.743215313517 ? 2.45978466227 ? -0.193283115098 ? 0.0582046634851 ? 0.694943600156 ? 0.288561519151 ? 0.0677225382022 ? -0.502417927355 ? -0.568892235597 ? -0.161352767119 ? 0.0788791196708 ? 8 'X-RAY DIFFRACTION' ? refined -56.4479238656 41.8451095784 62.3100715099 0.383734644115 ? -0.155001179575 ? -0.105004898213 ? 0.32774421562 ? 0.0962120822735 ? 0.336241146947 ? 2.63602124156 ? -1.84556096315 ? -1.8469555985 ? 8.19966258412 ? -0.15680544942 ? 9.1611510446 ? -0.320174534691 ? 0.255747830181 ? -0.65675632779 ? 0.0667583018684 ? 0.51055764958 ? 0.415258798083 ? 0.311943893787 ? -0.992874120946 ? -0.284887747956 ? 9 'X-RAY DIFFRACTION' ? refined -28.6952276528 50.7994431675 55.5939447035 0.154330573172 ? 0.0434130355143 ? -0.0622126240038 ? -0.107179334784 ? 0.217949682979 ? 0.411412873877 ? 0.0798621593661 ? -0.14769223733 ? 0.00928504656121 ? 0.35476996774 ? -0.13145777521 ? 0.177894677949 ? -0.112532463301 ? 0.0132546821582 ? 0.106873360934 ? 0.318811511999 ? -0.00660903848955 ? -0.132709650382 ? -0.170710657604 ? 0.0346490121116 ? -0.137856104767 ? 10 'X-RAY DIFFRACTION' ? refined -33.5803503774 46.4312404743 58.4734209582 0.275557446077 ? 0.00118574952223 ? -0.163797590548 ? -0.017240739096 ? 0.132398532391 ? 0.364148651507 ? 0.0738319415593 ? 0.167309032941 ? -0.193430646321 ? 0.907436862336 ? -0.409416895286 ? 0.496057811268 ? -0.0569600792266 ? -0.0526557253213 ? -0.0037127556077 ? -0.189914442349 ? -0.156214773788 ? -0.0909897826714 ? 0.127020532591 ? -0.0268321795579 ? -1.04089596069 ? 11 'X-RAY DIFFRACTION' ? refined -39.0671880985 50.5497234782 54.9799084088 0.159977959737 ? -0.0359845050685 ? 0.0335806695776 ? 0.12731462823 ? 0.215182425761 ? 0.392210787063 ? 0.368913479944 ? -0.0138195498456 ? -0.199097773324 ? 1.00587751088 ? 0.222646341575 ? 0.488980585247 ? -0.0238255042541 ? -0.0441128111536 ? 0.0837457258138 ? 0.0603641507894 ? 0.107941988012 ? -0.23935494556 ? -0.0252506744096 ? -0.0481953731342 ? 0.151980629843 ? 12 'X-RAY DIFFRACTION' ? refined -39.3273811092 66.1336890285 47.5405590665 0.27311323766 ? -0.103384103242 ? -0.144551892346 ? 0.148082899496 ? 0.116928826952 ? 0.365827642979 ? 0.746427614013 ? 1.54877409096 ? 0.311513035245 ? 6.38586720626 ? 4.03615846206 ? 3.71442408593 ? 0.0542755411279 ? 0.0381980974001 ? 0.404671090051 ? 0.247022831994 ? -0.0531705554645 ? -0.047696692014 ? -0.401695185182 ? 0.133958859127 ? -0.0973570170313 ? 13 'X-RAY DIFFRACTION' ? refined -45.7232040643 54.2715342048 45.278480457 0.126940930811 ? -0.0184639682379 ? -0.0754995268755 ? 0.213245469701 ? 0.129337755537 ? 0.390477230016 ? 2.0438646712 ? 0.287945026261 ? -0.917281641139 ? 0.748189364421 ? 0.3587721612 ? 1.00309133298 ? -0.0590102821314 ? 0.29493060912 ? -0.292046226107 ? -0.204440340163 ? -0.0685350493738 ? 0.0768790577942 ? 0.0622424719102 ? -0.345759992949 ? -0.24245864573 ? 14 'X-RAY DIFFRACTION' ? refined -39.3238895709 58.3057513982 35.2242165502 0.428893905829 ? 0.0879795304077 ? 0.0251080119416 ? 0.307162965213 ? 0.13973157309 ? 0.378568051065 ? 0.915013454336 ? 0.460976545636 ? 0.928455226798 ? 5.63574468413 ? -0.113354220901 ? 1.00551883073 ? 0.340830651333 ? 0.715463216734 ? 0.234864240613 ? -0.795138046047 ? -0.218627903417 ? -0.763906067887 ? -0.274142091042 ? -0.136789182914 ? 0.024551957919 ? 15 'X-RAY DIFFRACTION' ? refined -37.5034241193 57.7213122448 72.8518777725 0.460146354479 ? -0.0901931779629 ? -0.0715945971759 ? 0.25974249229 ? 0.0358111125122 ? 0.191497641585 ? 4.05884333236 ? -1.2747704708 ? -4.08189607329 ? 5.71943239665 ? 2.43339670962 ? 5.41625362879 ? -0.140423964893 ? -0.520079670798 ? 0.0842718812462 ? 0.753004934075 ? -0.10645524404 ? 0.0331117219251 ? -0.0115646640577 ? 0.464704674548 ? -0.0685400596451 ? 16 'X-RAY DIFFRACTION' ? refined -50.7194149576 74.4831835558 76.3544428789 0.376559948917 ? -0.10625396739 ? 0.0609033195536 ? 0.200475069818 ? 0.0429227117925 ? 0.451310331625 ? 3.05885282229 ? 0.760906085999 ? -0.706258627259 ? 1.94551642933 ? -0.303996858032 ? 2.66917924467 ? 0.187617839721 ? -0.0202352466418 ? 0.227284301494 ? 0.498206908193 ? -0.0955799956841 ? 0.712121976284 ? -0.193369122735 ? -0.255525731886 ? -0.115357490652 ? 17 'X-RAY DIFFRACTION' ? refined -55.7403348318 67.5446704222 90.0058795742 0.705065401608 ? 0.0625327157238 ? 0.26563105493 ? 0.43112695317 ? 0.0809377032996 ? 0.426804685424 ? 1.6890123942 ? -0.363016103714 ? -0.731831328365 ? 0.793312685623 ? -1.72342350768 ? 5.25181883539 ? -0.0209681238709 ? -0.243450427275 ? -0.0649887965394 ? 0.285714895591 ? 0.0337306662408 ? 0.376949255957 ? -0.880943435982 ? -0.368790868307 ? -0.19247064843 ? 18 'X-RAY DIFFRACTION' ? refined -42.8568117488 76.8207725028 87.6200011825 0.749099638846 ? -0.0997376791474 ? 0.0311070568176 ? 0.291894968614 ? 0.0928857761058 ? 0.36342008595 ? 2.30850174335 ? -0.988768685446 ? -0.38929110526 ? 1.73991269519 ? -1.17769714245 ? 2.28398284396 ? 0.0688392140199 ? -0.21268254394 ? 0.322929762577 ? 0.837343460821 ? -0.0180183428641 ? -0.127874560159 ? -0.250375130594 ? 0.305175875375 ? 0.0528720305828 ? 19 'X-RAY DIFFRACTION' ? refined -37.0375243571 75.3788977077 95.8447749689 0.642219276218 ? -0.219497950279 ? -0.0993921424946 ? 0.375972395766 ? 0.0281087704869 ? 0.211216671369 ? 4.80242406409 ? -0.881309835579 ? -2.58439101767 ? 2.12935870657 ? -0.739982541091 ? 4.91091396329 ? 0.0218535704392 ? -0.475870254547 ? 0.0473967686819 ? 0.385911131786 ? -0.0697831338434 ? -0.337644505995 ? 0.187822221419 ? 0.394017256964 ? 0.0303498559193 ? 20 'X-RAY DIFFRACTION' ? refined -48.4143324661 77.3226274655 100.9553578 1.20659424031 ? -0.274268424088 ? 0.182559769791 ? 0.830945366008 ? -0.125789603177 ? 0.425919543298 ? 4.40062776757 ? 2.07409973688 ? 3.67163184491 ? 2.83483002855 ? 0.831337730774 ? 3.50020946271 ? 0.547079203804 ? -1.47967950073 ? 0.481902367261 ? 0.648321176175 ? -0.130959308918 ? 0.434304176385 ? 0.405205860847 ? 0.0701107006506 ? -0.394423944834 ? 21 'X-RAY DIFFRACTION' ? refined -49.5321195022 76.8099259877 -7.91626964615 0.225110927745 ? 0.14274434505 ? -0.0464993863233 ? 0.434134690219 ? 0.0939268481196 ? 0.145957303391 ? 2.00339756037 ? -0.211891370715 ? 1.37015775223 ? 1.81369697327 ? -1.04826485334 ? 2.80807802356 ? 0.12891289133 ? 0.139148531056 ? -0.117260212084 ? 0.153876846799 ? 0.034610707431 ? 0.0468839604106 ? -0.269065813467 ? -0.324052932303 ? 0.505580571469 ? 22 'X-RAY DIFFRACTION' ? refined -37.7552038787 52.7897262395 -14.3724240615 0.217558961 ? -0.0980379030917 ? -0.0669003338612 ? 0.391292725803 ? -0.0378188305578 ? 0.411006447541 ? 2.04798365708 ? 1.55467830131 ? 0.452183246166 ? 1.60492589393 ? 1.84207601828 ? 5.47594980657 ? -0.0141236516594 ? 0.181481413604 ? -0.774897035943 ? 0.449555596011 ? 0.241622252908 ? -0.52739066379 ? 0.924076753312 ? 0.271394363617 ? -0.328422114561 ? 23 'X-RAY DIFFRACTION' ? refined -33.9027018299 64.1281458297 -18.0109888532 0.205396358988 ? -0.0230886185156 ? -0.0156781844498 ? 0.479086541821 ? -0.0511333106281 ? 0.374616343578 ? 2.77311682305 ? 0.421535437329 ? 0.170679207738 ? 1.75048669806 ? -0.30747629933 ? 1.48453842546 ? -0.00466350612402 ? 0.510688740671 ? -0.40066379397 ? -0.0910070116942 ? 0.165299631163 ? -0.227186802054 ? 0.1275619426 ? 0.419539308874 ? -0.12077808441 ? 24 'X-RAY DIFFRACTION' ? refined -36.3408162667 67.0496687505 -28.0955507908 0.26427021936 ? -0.0525464296359 ? 0.001786364135 ? 0.464503444883 ? -0.0520874107233 ? 0.241941579778 ? 3.18492661367 ? -1.88951314137 ? 0.465606109172 ? 6.60956649508 ? -0.268098406235 ? 4.30880811242 ? -0.0117830053633 ? 0.435862567596 ? 0.13129235851 ? -0.743302164457 ? -0.0840180956319 ? -0.139289749506 ? 0.154495109903 ? -0.183394591762 ? 0.118028312257 ? 25 'X-RAY DIFFRACTION' ? refined -30.3658329567 66.0773131865 -34.8815555268 0.756415119406 ? -0.198548270425 ? 0.142701613095 ? 0.837925055487 ? -0.0341158706286 ? 0.333732019558 ? 3.71445319011 ? -0.413127333163 ? 2.08027304814 ? 5.34124859891 ? 3.69059801879 ? 4.07596669145 ? -0.297738358809 ? 0.986148687151 ? 0.343143154485 ? -1.10377145669 ? 0.363634704723 ? -0.727117264503 ? -0.188503011669 ? 0.408853360966 ? -0.181812809942 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 29 through 42 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 43 through 66 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 67 through 95 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 96 through 110 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 111 through 142 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 143 through 203 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 204 through 217 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 31 through 42 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 43 through 56 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 57 through 66 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 67 through 110 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 111 through 125 ) ; 13 'X-RAY DIFFRACTION' 13 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 126 through 187 ) ; 14 'X-RAY DIFFRACTION' 14 ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 188 through 217 ) ; 15 'X-RAY DIFFRACTION' 15 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 32 through 42 ) ; 16 'X-RAY DIFFRACTION' 16 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 43 through 95 ) ; 17 'X-RAY DIFFRACTION' 17 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 96 through 110 ) ; 18 'X-RAY DIFFRACTION' 18 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 111 through 172 ) ; 19 'X-RAY DIFFRACTION' 19 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 173 through 199 ) ; 20 'X-RAY DIFFRACTION' 20 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 200 through 217 ) ; 21 'X-RAY DIFFRACTION' 21 ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 31 through 42 ) ; 22 'X-RAY DIFFRACTION' 22 ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 43 through 66 ) ; 23 'X-RAY DIFFRACTION' 23 ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 67 through 142 ) ; 24 'X-RAY DIFFRACTION' 24 ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 143 through 187 ) ; 25 'X-RAY DIFFRACTION' 25 ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 188 through 217 ) ; # _pdbx_entry_details.entry_id 6YLV _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 27 ? A MET 1 2 1 Y 1 A VAL 28 ? A VAL 2 3 1 Y 1 A LYS 206 ? A LYS 180 4 1 Y 1 A SER 207 ? A SER 181 5 1 Y 1 A GLY 208 ? A GLY 182 6 1 Y 1 A SER 209 ? A SER 183 7 1 Y 1 A THR 210 ? A THR 184 8 1 Y 1 A THR 211 ? A THR 185 9 1 Y 1 B MET 27 ? B MET 1 10 1 Y 1 B VAL 28 ? B VAL 2 11 1 Y 1 B ALA 29 ? B ALA 3 12 1 Y 1 B ASN 30 ? B ASN 4 13 1 Y 1 B LYS 206 ? B LYS 180 14 1 Y 1 B SER 207 ? B SER 181 15 1 Y 1 C MET 27 ? C MET 1 16 1 Y 1 C VAL 28 ? C VAL 2 17 1 Y 1 C ALA 29 ? C ALA 3 18 1 Y 1 C ASN 30 ? C ASN 4 19 1 Y 1 C PRO 31 ? C PRO 5 20 1 Y 1 C THR 205 ? C THR 179 21 1 Y 1 C LYS 206 ? C LYS 180 22 1 Y 1 C SER 207 ? C SER 181 23 1 Y 1 C GLY 208 ? C GLY 182 24 1 Y 1 C SER 209 ? C SER 183 25 1 Y 1 C THR 210 ? C THR 184 26 1 Y 1 C THR 211 ? C THR 185 27 1 Y 1 D MET 27 ? D MET 1 28 1 Y 1 D VAL 28 ? D VAL 2 29 1 Y 1 D ALA 29 ? D ALA 3 30 1 Y 1 D ASN 30 ? D ASN 4 31 1 Y 1 D THR 203 ? D THR 177 32 1 Y 1 D ALA 204 ? D ALA 178 33 1 Y 1 D THR 205 ? D THR 179 34 1 Y 1 D LYS 206 ? D LYS 180 35 1 Y 1 D SER 207 ? D SER 181 36 1 Y 1 D GLY 208 ? D GLY 182 37 1 Y 1 D SER 209 ? D SER 183 38 1 Y 1 D THR 210 ? D THR 184 39 1 Y 1 D THR 211 ? D THR 185 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LYS N N N N 219 LYS CA C N S 220 LYS C C N N 221 LYS O O N N 222 LYS CB C N N 223 LYS CG C N N 224 LYS CD C N N 225 LYS CE C N N 226 LYS NZ N N N 227 LYS OXT O N N 228 LYS H H N N 229 LYS H2 H N N 230 LYS HA H N N 231 LYS HB2 H N N 232 LYS HB3 H N N 233 LYS HG2 H N N 234 LYS HG3 H N N 235 LYS HD2 H N N 236 LYS HD3 H N N 237 LYS HE2 H N N 238 LYS HE3 H N N 239 LYS HZ1 H N N 240 LYS HZ2 H N N 241 LYS HZ3 H N N 242 LYS HXT H N N 243 MET N N N N 244 MET CA C N S 245 MET C C N N 246 MET O O N N 247 MET CB C N N 248 MET CG C N N 249 MET SD S N N 250 MET CE C N N 251 MET OXT O N N 252 MET H H N N 253 MET H2 H N N 254 MET HA H N N 255 MET HB2 H N N 256 MET HB3 H N N 257 MET HG2 H N N 258 MET HG3 H N N 259 MET HE1 H N N 260 MET HE2 H N N 261 MET HE3 H N N 262 MET HXT H N N 263 OYW C1 C Y N 264 OYW C2 C N N 265 OYW C3 C N N 266 OYW C4 C Y N 267 OYW C5 C Y N 268 OYW C6 C N R 269 OYW C7 C N R 270 OYW C8 C N S 271 OYW C9 C N R 272 OYW C10 C N N 273 OYW C11 C N N 274 OYW C12 C Y N 275 OYW C13 C Y N 276 OYW C14 C Y N 277 OYW C15 C Y N 278 OYW C16 C Y N 279 OYW C17 C Y N 280 OYW N1 N Y N 281 OYW N2 N N N 282 OYW N3 N N N 283 OYW N4 N N N 284 OYW N5 N Y N 285 OYW O1 O N N 286 OYW O2 O N N 287 OYW O3 O N N 288 OYW O4 O N N 289 OYW O5 O N N 290 OYW O6 O N N 291 OYW O7 O N N 292 OYW O8 O N N 293 OYW O9 O N N 294 OYW O10 O N N 295 OYW O11 O N N 296 OYW O12 O N N 297 OYW O13 O N N 298 OYW O14 O N N 299 OYW P1 P N N 300 OYW P2 P N N 301 OYW P3 P N N 302 OYW CL1 CL N N 303 OYW H1 H N N 304 OYW H2 H N N 305 OYW H3 H N N 306 OYW H4 H N N 307 OYW H5 H N N 308 OYW H6 H N N 309 OYW H7 H N N 310 OYW H8 H N N 311 OYW H9 H N N 312 OYW H10 H N N 313 OYW H11 H N N 314 OYW H12 H N N 315 OYW H13 H N N 316 OYW H14 H N N 317 OYW H15 H N N 318 OYW H17 H N N 319 OYW H19 H N N 320 OYW H20 H N N 321 OYW H21 H N N 322 OYW H22 H N N 323 OYW O15 O N N 324 OYW C18 C N N 325 OYW C19 C N N 326 OYW C20 C N N 327 OYW C21 C N N 328 OYW C22 C N N 329 OYW O16 O N N 330 OYW O17 O N N 331 OYW H23 H N N 332 OYW H24 H N N 333 OYW H25 H N N 334 OYW H26 H N N 335 OYW H27 H N N 336 OYW H28 H N N 337 OYW H29 H N N 338 OYW H30 H N N 339 OYW N6 N Y N 340 OYW N7 N Y N 341 OYW C23 C Y N 342 OYW C24 C Y N 343 OYW C25 C Y N 344 OYW N8 N N N 345 OYW C26 C N N 346 OYW C27 C N N 347 OYW N9 N N N 348 OYW N10 N N N 349 OYW H18 H N N 350 OYW H31 H N N 351 OYW H34 H N N 352 OYW H35 H N N 353 OYW H16 H N N 354 OYW O18 O N N 355 PHE N N N N 356 PHE CA C N S 357 PHE C C N N 358 PHE O O N N 359 PHE CB C N N 360 PHE CG C Y N 361 PHE CD1 C Y N 362 PHE CD2 C Y N 363 PHE CE1 C Y N 364 PHE CE2 C Y N 365 PHE CZ C Y N 366 PHE OXT O N N 367 PHE H H N N 368 PHE H2 H N N 369 PHE HA H N N 370 PHE HB2 H N N 371 PHE HB3 H N N 372 PHE HD1 H N N 373 PHE HD2 H N N 374 PHE HE1 H N N 375 PHE HE2 H N N 376 PHE HZ H N N 377 PHE HXT H N N 378 PRO N N N N 379 PRO CA C N S 380 PRO C C N N 381 PRO O O N N 382 PRO CB C N N 383 PRO CG C N N 384 PRO CD C N N 385 PRO OXT O N N 386 PRO H H N N 387 PRO HA H N N 388 PRO HB2 H N N 389 PRO HB3 H N N 390 PRO HG2 H N N 391 PRO HG3 H N N 392 PRO HD2 H N N 393 PRO HD3 H N N 394 PRO HXT H N N 395 SER N N N N 396 SER CA C N S 397 SER C C N N 398 SER O O N N 399 SER CB C N N 400 SER OG O N N 401 SER OXT O N N 402 SER H H N N 403 SER H2 H N N 404 SER HA H N N 405 SER HB2 H N N 406 SER HB3 H N N 407 SER HG H N N 408 SER HXT H N N 409 THR N N N N 410 THR CA C N S 411 THR C C N N 412 THR O O N N 413 THR CB C N R 414 THR OG1 O N N 415 THR CG2 C N N 416 THR OXT O N N 417 THR H H N N 418 THR H2 H N N 419 THR HA H N N 420 THR HB H N N 421 THR HG1 H N N 422 THR HG21 H N N 423 THR HG22 H N N 424 THR HG23 H N N 425 THR HXT H N N 426 TRP N N N N 427 TRP CA C N S 428 TRP C C N N 429 TRP O O N N 430 TRP CB C N N 431 TRP CG C Y N 432 TRP CD1 C Y N 433 TRP CD2 C Y N 434 TRP NE1 N Y N 435 TRP CE2 C Y N 436 TRP CE3 C Y N 437 TRP CZ2 C Y N 438 TRP CZ3 C Y N 439 TRP CH2 C Y N 440 TRP OXT O N N 441 TRP H H N N 442 TRP H2 H N N 443 TRP HA H N N 444 TRP HB2 H N N 445 TRP HB3 H N N 446 TRP HD1 H N N 447 TRP HE1 H N N 448 TRP HE3 H N N 449 TRP HZ2 H N N 450 TRP HZ3 H N N 451 TRP HH2 H N N 452 TRP HXT H N N 453 TYR N N N N 454 TYR CA C N S 455 TYR C C N N 456 TYR O O N N 457 TYR CB C N N 458 TYR CG C Y N 459 TYR CD1 C Y N 460 TYR CD2 C Y N 461 TYR CE1 C Y N 462 TYR CE2 C Y N 463 TYR CZ C Y N 464 TYR OH O N N 465 TYR OXT O N N 466 TYR H H N N 467 TYR H2 H N N 468 TYR HA H N N 469 TYR HB2 H N N 470 TYR HB3 H N N 471 TYR HD1 H N N 472 TYR HD2 H N N 473 TYR HE1 H N N 474 TYR HE2 H N N 475 TYR HH H N N 476 TYR HXT H N N 477 VAL N N N N 478 VAL CA C N S 479 VAL C C N N 480 VAL O O N N 481 VAL CB C N N 482 VAL CG1 C N N 483 VAL CG2 C N N 484 VAL OXT O N N 485 VAL H H N N 486 VAL H2 H N N 487 VAL HA H N N 488 VAL HB H N N 489 VAL HG11 H N N 490 VAL HG12 H N N 491 VAL HG13 H N N 492 VAL HG21 H N N 493 VAL HG22 H N N 494 VAL HG23 H N N 495 VAL HXT H N N 496 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MET N CA sing N N 231 MET N H sing N N 232 MET N H2 sing N N 233 MET CA C sing N N 234 MET CA CB sing N N 235 MET CA HA sing N N 236 MET C O doub N N 237 MET C OXT sing N N 238 MET CB CG sing N N 239 MET CB HB2 sing N N 240 MET CB HB3 sing N N 241 MET CG SD sing N N 242 MET CG HG2 sing N N 243 MET CG HG3 sing N N 244 MET SD CE sing N N 245 MET CE HE1 sing N N 246 MET CE HE2 sing N N 247 MET CE HE3 sing N N 248 MET OXT HXT sing N N 249 OYW CL1 C15 sing N N 250 OYW C15 C13 doub Y N 251 OYW C15 C17 sing Y N 252 OYW C13 C14 sing Y N 253 OYW C17 C16 doub Y N 254 OYW O1 P1 doub N N 255 OYW O3 P1 sing N N 256 OYW C14 C12 doub Y N 257 OYW C16 C12 sing Y N 258 OYW O2 P1 sing N N 259 OYW P1 O4 sing N N 260 OYW O10 P2 doub N N 261 OYW C12 C11 sing N N 262 OYW O5 C6 sing N N 263 OYW O5 C9 sing N N 264 OYW C6 N5 sing N N 265 OYW C6 C7 sing N N 266 OYW O14 P3 doub N N 267 OYW N5 C1 sing Y N 268 OYW N5 C5 sing Y N 269 OYW C1 N1 doub Y N 270 OYW C9 C10 sing N N 271 OYW C9 C8 sing N N 272 OYW C5 N2 sing N N 273 OYW C5 C4 doub Y N 274 OYW N1 C11 sing N N 275 OYW N1 C4 sing Y N 276 OYW N2 C2 doub N N 277 OYW C10 O9 sing N N 278 OYW P2 O9 sing N N 279 OYW P2 O11 sing N N 280 OYW P2 O12 sing N N 281 OYW O4 P3 sing N N 282 OYW O7 C7 sing N N 283 OYW C4 C3 sing N N 284 OYW C2 N3 sing N N 285 OYW C2 N4 sing N N 286 OYW C3 N4 sing N N 287 OYW C3 O6 doub N N 288 OYW P3 O12 sing N N 289 OYW P3 O13 sing N N 290 OYW C7 C8 sing N N 291 OYW C8 O8 sing N N 292 OYW C1 H1 sing N N 293 OYW C6 H2 sing N N 294 OYW C7 H3 sing N N 295 OYW C8 H4 sing N N 296 OYW C9 H5 sing N N 297 OYW C10 H6 sing N N 298 OYW C10 H7 sing N N 299 OYW C11 H8 sing N N 300 OYW C11 H9 sing N N 301 OYW C13 H10 sing N N 302 OYW C14 H11 sing N N 303 OYW C16 H12 sing N N 304 OYW C17 H13 sing N N 305 OYW N3 H14 sing N N 306 OYW N3 H15 sing N N 307 OYW O2 H17 sing N N 308 OYW O7 H19 sing N N 309 OYW O8 H20 sing N N 310 OYW O11 H21 sing N N 311 OYW O13 H22 sing N N 312 OYW O15 C18 sing N N 313 OYW C18 C19 sing N N 314 OYW C19 C20 sing N N 315 OYW C20 C21 sing N N 316 OYW C21 O15 sing N N 317 OYW C22 O3 sing N N 318 OYW O16 C20 sing N N 319 OYW O17 C19 sing N N 320 OYW C21 C22 sing N N 321 OYW C18 H23 sing N N 322 OYW C19 H24 sing N N 323 OYW C20 H25 sing N N 324 OYW C21 H26 sing N N 325 OYW C22 H27 sing N N 326 OYW C22 H28 sing N N 327 OYW O16 H29 sing N N 328 OYW O17 H30 sing N N 329 OYW N6 C18 sing N N 330 OYW N7 C23 sing Y N 331 OYW C23 C24 doub Y N 332 OYW C24 N6 sing Y N 333 OYW N6 C25 sing Y N 334 OYW C25 N7 doub Y N 335 OYW N8 C26 sing N N 336 OYW C27 N9 doub N N 337 OYW N9 C24 sing N N 338 OYW C23 C26 sing N N 339 OYW N8 C27 sing N N 340 OYW N10 C27 sing N N 341 OYW C25 H18 sing N N 342 OYW N8 H31 sing N N 343 OYW N10 H34 sing N N 344 OYW N10 H35 sing N N 345 OYW N4 H16 sing N N 346 OYW C26 O18 doub N N 347 PHE N CA sing N N 348 PHE N H sing N N 349 PHE N H2 sing N N 350 PHE CA C sing N N 351 PHE CA CB sing N N 352 PHE CA HA sing N N 353 PHE C O doub N N 354 PHE C OXT sing N N 355 PHE CB CG sing N N 356 PHE CB HB2 sing N N 357 PHE CB HB3 sing N N 358 PHE CG CD1 doub Y N 359 PHE CG CD2 sing Y N 360 PHE CD1 CE1 sing Y N 361 PHE CD1 HD1 sing N N 362 PHE CD2 CE2 doub Y N 363 PHE CD2 HD2 sing N N 364 PHE CE1 CZ doub Y N 365 PHE CE1 HE1 sing N N 366 PHE CE2 CZ sing Y N 367 PHE CE2 HE2 sing N N 368 PHE CZ HZ sing N N 369 PHE OXT HXT sing N N 370 PRO N CA sing N N 371 PRO N CD sing N N 372 PRO N H sing N N 373 PRO CA C sing N N 374 PRO CA CB sing N N 375 PRO CA HA sing N N 376 PRO C O doub N N 377 PRO C OXT sing N N 378 PRO CB CG sing N N 379 PRO CB HB2 sing N N 380 PRO CB HB3 sing N N 381 PRO CG CD sing N N 382 PRO CG HG2 sing N N 383 PRO CG HG3 sing N N 384 PRO CD HD2 sing N N 385 PRO CD HD3 sing N N 386 PRO OXT HXT sing N N 387 SER N CA sing N N 388 SER N H sing N N 389 SER N H2 sing N N 390 SER CA C sing N N 391 SER CA CB sing N N 392 SER CA HA sing N N 393 SER C O doub N N 394 SER C OXT sing N N 395 SER CB OG sing N N 396 SER CB HB2 sing N N 397 SER CB HB3 sing N N 398 SER OG HG sing N N 399 SER OXT HXT sing N N 400 THR N CA sing N N 401 THR N H sing N N 402 THR N H2 sing N N 403 THR CA C sing N N 404 THR CA CB sing N N 405 THR CA HA sing N N 406 THR C O doub N N 407 THR C OXT sing N N 408 THR CB OG1 sing N N 409 THR CB CG2 sing N N 410 THR CB HB sing N N 411 THR OG1 HG1 sing N N 412 THR CG2 HG21 sing N N 413 THR CG2 HG22 sing N N 414 THR CG2 HG23 sing N N 415 THR OXT HXT sing N N 416 TRP N CA sing N N 417 TRP N H sing N N 418 TRP N H2 sing N N 419 TRP CA C sing N N 420 TRP CA CB sing N N 421 TRP CA HA sing N N 422 TRP C O doub N N 423 TRP C OXT sing N N 424 TRP CB CG sing N N 425 TRP CB HB2 sing N N 426 TRP CB HB3 sing N N 427 TRP CG CD1 doub Y N 428 TRP CG CD2 sing Y N 429 TRP CD1 NE1 sing Y N 430 TRP CD1 HD1 sing N N 431 TRP CD2 CE2 doub Y N 432 TRP CD2 CE3 sing Y N 433 TRP NE1 CE2 sing Y N 434 TRP NE1 HE1 sing N N 435 TRP CE2 CZ2 sing Y N 436 TRP CE3 CZ3 doub Y N 437 TRP CE3 HE3 sing N N 438 TRP CZ2 CH2 doub Y N 439 TRP CZ2 HZ2 sing N N 440 TRP CZ3 CH2 sing Y N 441 TRP CZ3 HZ3 sing N N 442 TRP CH2 HH2 sing N N 443 TRP OXT HXT sing N N 444 TYR N CA sing N N 445 TYR N H sing N N 446 TYR N H2 sing N N 447 TYR CA C sing N N 448 TYR CA CB sing N N 449 TYR CA HA sing N N 450 TYR C O doub N N 451 TYR C OXT sing N N 452 TYR CB CG sing N N 453 TYR CB HB2 sing N N 454 TYR CB HB3 sing N N 455 TYR CG CD1 doub Y N 456 TYR CG CD2 sing Y N 457 TYR CD1 CE1 sing Y N 458 TYR CD1 HD1 sing N N 459 TYR CD2 CE2 doub Y N 460 TYR CD2 HD2 sing N N 461 TYR CE1 CZ doub Y N 462 TYR CE1 HE1 sing N N 463 TYR CE2 CZ sing Y N 464 TYR CE2 HE2 sing N N 465 TYR CZ OH sing N N 466 TYR OH HH sing N N 467 TYR OXT HXT sing N N 468 VAL N CA sing N N 469 VAL N H sing N N 470 VAL N H2 sing N N 471 VAL CA C sing N N 472 VAL CA CB sing N N 473 VAL CA HA sing N N 474 VAL C O doub N N 475 VAL C OXT sing N N 476 VAL CB CG1 sing N N 477 VAL CB CG2 sing N N 478 VAL CB HB sing N N 479 VAL CG1 HG11 sing N N 480 VAL CG1 HG12 sing N N 481 VAL CG1 HG13 sing N N 482 VAL CG2 HG21 sing N N 483 VAL CG2 HG22 sing N N 484 VAL CG2 HG23 sing N N 485 VAL OXT HXT sing N N 486 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Foundation for Polish Science' Poland TEAM/2016_2/13 1 'Polish National Science Centre' Poland 'UMO- 2017/24/C/NZ1/00169' 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id OYW _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id OYW _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1L8B _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 1' _space_group.name_Hall 'P 1' _space_group.IT_number 1 _space_group.crystal_system triclinic _space_group.id 1 # _atom_sites.entry_id 6YLV _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.026076 _atom_sites.fract_transf_matrix[1][2] -0.005908 _atom_sites.fract_transf_matrix[1][3] -0.000260 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026709 _atom_sites.fract_transf_matrix[2][3] -0.002095 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006776 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 1.04373 23.83732 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? 9.05267 ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 1.42069 35.72801 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_