data_6Z3E # _entry.id 6Z3E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6Z3E pdb_00006z3e 10.2210/pdb6z3e/pdb WWPDB D_1292108811 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-12-01 2 'Structure model' 1 1 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6Z3E _pdbx_database_status.recvd_initial_deposition_date 2020-05-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Schwefel, D.' 1 0000-0002-2945-0908 'Daumke, O.' 2 0000-0002-6190-1414 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of GDP-bound human GIMAP5' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schwefel, D.' 1 ? primary 'Daumke, O.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GTPase IMAP family member 5' 31139.219 1 ? ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE" 443.201 1 ? ? ? ? 4 water nat water 18.015 14 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Immune-associated nucleotide-binding protein 5,Immunity-associated nucleotide 4-like 1 protein,Immunity-associated nucleotide 5 protein,hIAN5,Immunity-associated protein 3 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPMGGFQRGKYGTMAEGRSEDNLSATPPALRIILVGKTGCGKSATGNSILGQPVFESKLRAQSVTRTCQVKTGTWNGRKV LVVDTPSIFESQADTQELYKNIGDCYLLSAPGPHVLLLVIQLGRFTAQDTVAIRKVKEVFGTGAMRHVVILFTHKEDLGG QALDDYVANTDNCSLKDLVRECERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQLLQRTGAGAC QEDYRQYQAKVEWQVEKHKQELRENESNWAYKALLRVK ; _entity_poly.pdbx_seq_one_letter_code_can ;GPMGGFQRGKYGTMAEGRSEDNLSATPPALRIILVGKTGCGKSATGNSILGQPVFESKLRAQSVTRTCQVKTGTWNGRKV LVVDTPSIFESQADTQELYKNIGDCYLLSAPGPHVLLLVIQLGRFTAQDTVAIRKVKEVFGTGAMRHVVILFTHKEDLGG QALDDYVANTDNCSLKDLVRECERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQLLQRTGAGAC QEDYRQYQAKVEWQVEKHKQELRENESNWAYKALLRVK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 "GUANOSINE-5'-DIPHOSPHATE" GDP 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 MET n 1 4 GLY n 1 5 GLY n 1 6 PHE n 1 7 GLN n 1 8 ARG n 1 9 GLY n 1 10 LYS n 1 11 TYR n 1 12 GLY n 1 13 THR n 1 14 MET n 1 15 ALA n 1 16 GLU n 1 17 GLY n 1 18 ARG n 1 19 SER n 1 20 GLU n 1 21 ASP n 1 22 ASN n 1 23 LEU n 1 24 SER n 1 25 ALA n 1 26 THR n 1 27 PRO n 1 28 PRO n 1 29 ALA n 1 30 LEU n 1 31 ARG n 1 32 ILE n 1 33 ILE n 1 34 LEU n 1 35 VAL n 1 36 GLY n 1 37 LYS n 1 38 THR n 1 39 GLY n 1 40 CYS n 1 41 GLY n 1 42 LYS n 1 43 SER n 1 44 ALA n 1 45 THR n 1 46 GLY n 1 47 ASN n 1 48 SER n 1 49 ILE n 1 50 LEU n 1 51 GLY n 1 52 GLN n 1 53 PRO n 1 54 VAL n 1 55 PHE n 1 56 GLU n 1 57 SER n 1 58 LYS n 1 59 LEU n 1 60 ARG n 1 61 ALA n 1 62 GLN n 1 63 SER n 1 64 VAL n 1 65 THR n 1 66 ARG n 1 67 THR n 1 68 CYS n 1 69 GLN n 1 70 VAL n 1 71 LYS n 1 72 THR n 1 73 GLY n 1 74 THR n 1 75 TRP n 1 76 ASN n 1 77 GLY n 1 78 ARG n 1 79 LYS n 1 80 VAL n 1 81 LEU n 1 82 VAL n 1 83 VAL n 1 84 ASP n 1 85 THR n 1 86 PRO n 1 87 SER n 1 88 ILE n 1 89 PHE n 1 90 GLU n 1 91 SER n 1 92 GLN n 1 93 ALA n 1 94 ASP n 1 95 THR n 1 96 GLN n 1 97 GLU n 1 98 LEU n 1 99 TYR n 1 100 LYS n 1 101 ASN n 1 102 ILE n 1 103 GLY n 1 104 ASP n 1 105 CYS n 1 106 TYR n 1 107 LEU n 1 108 LEU n 1 109 SER n 1 110 ALA n 1 111 PRO n 1 112 GLY n 1 113 PRO n 1 114 HIS n 1 115 VAL n 1 116 LEU n 1 117 LEU n 1 118 LEU n 1 119 VAL n 1 120 ILE n 1 121 GLN n 1 122 LEU n 1 123 GLY n 1 124 ARG n 1 125 PHE n 1 126 THR n 1 127 ALA n 1 128 GLN n 1 129 ASP n 1 130 THR n 1 131 VAL n 1 132 ALA n 1 133 ILE n 1 134 ARG n 1 135 LYS n 1 136 VAL n 1 137 LYS n 1 138 GLU n 1 139 VAL n 1 140 PHE n 1 141 GLY n 1 142 THR n 1 143 GLY n 1 144 ALA n 1 145 MET n 1 146 ARG n 1 147 HIS n 1 148 VAL n 1 149 VAL n 1 150 ILE n 1 151 LEU n 1 152 PHE n 1 153 THR n 1 154 HIS n 1 155 LYS n 1 156 GLU n 1 157 ASP n 1 158 LEU n 1 159 GLY n 1 160 GLY n 1 161 GLN n 1 162 ALA n 1 163 LEU n 1 164 ASP n 1 165 ASP n 1 166 TYR n 1 167 VAL n 1 168 ALA n 1 169 ASN n 1 170 THR n 1 171 ASP n 1 172 ASN n 1 173 CYS n 1 174 SER n 1 175 LEU n 1 176 LYS n 1 177 ASP n 1 178 LEU n 1 179 VAL n 1 180 ARG n 1 181 GLU n 1 182 CYS n 1 183 GLU n 1 184 ARG n 1 185 ARG n 1 186 TYR n 1 187 CYS n 1 188 ALA n 1 189 PHE n 1 190 ASN n 1 191 ASN n 1 192 TRP n 1 193 GLY n 1 194 SER n 1 195 VAL n 1 196 GLU n 1 197 GLU n 1 198 GLN n 1 199 ARG n 1 200 GLN n 1 201 GLN n 1 202 GLN n 1 203 ALA n 1 204 GLU n 1 205 LEU n 1 206 LEU n 1 207 ALA n 1 208 VAL n 1 209 ILE n 1 210 GLU n 1 211 ARG n 1 212 LEU n 1 213 GLY n 1 214 ARG n 1 215 GLU n 1 216 ARG n 1 217 GLU n 1 218 GLY n 1 219 SER n 1 220 PHE n 1 221 HIS n 1 222 SER n 1 223 ASN n 1 224 ASP n 1 225 LEU n 1 226 PHE n 1 227 LEU n 1 228 ASP n 1 229 ALA n 1 230 GLN n 1 231 LEU n 1 232 LEU n 1 233 GLN n 1 234 ARG n 1 235 THR n 1 236 GLY n 1 237 ALA n 1 238 GLY n 1 239 ALA n 1 240 CYS n 1 241 GLN n 1 242 GLU n 1 243 ASP n 1 244 TYR n 1 245 ARG n 1 246 GLN n 1 247 TYR n 1 248 GLN n 1 249 ALA n 1 250 LYS n 1 251 VAL n 1 252 GLU n 1 253 TRP n 1 254 GLN n 1 255 VAL n 1 256 GLU n 1 257 LYS n 1 258 HIS n 1 259 LYS n 1 260 GLN n 1 261 GLU n 1 262 LEU n 1 263 ARG n 1 264 GLU n 1 265 ASN n 1 266 GLU n 1 267 SER n 1 268 ASN n 1 269 TRP n 1 270 ALA n 1 271 TYR n 1 272 LYS n 1 273 ALA n 1 274 LEU n 1 275 LEU n 1 276 ARG n 1 277 VAL n 1 278 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 278 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'GIMAP5, IAN4L1, IAN5, IMAP3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GDP 'RNA linking' n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 PRO 2 0 ? ? ? A . n A 1 3 MET 3 1 ? ? ? A . n A 1 4 GLY 4 2 ? ? ? A . n A 1 5 GLY 5 3 ? ? ? A . n A 1 6 PHE 6 4 ? ? ? A . n A 1 7 GLN 7 5 ? ? ? A . n A 1 8 ARG 8 6 ? ? ? A . n A 1 9 GLY 9 7 ? ? ? A . n A 1 10 LYS 10 8 ? ? ? A . n A 1 11 TYR 11 9 ? ? ? A . n A 1 12 GLY 12 10 ? ? ? A . n A 1 13 THR 13 11 ? ? ? A . n A 1 14 MET 14 12 ? ? ? A . n A 1 15 ALA 15 13 ? ? ? A . n A 1 16 GLU 16 14 ? ? ? A . n A 1 17 GLY 17 15 ? ? ? A . n A 1 18 ARG 18 16 ? ? ? A . n A 1 19 SER 19 17 ? ? ? A . n A 1 20 GLU 20 18 ? ? ? A . n A 1 21 ASP 21 19 ? ? ? A . n A 1 22 ASN 22 20 ? ? ? A . n A 1 23 LEU 23 21 ? ? ? A . n A 1 24 SER 24 22 ? ? ? A . n A 1 25 ALA 25 23 ? ? ? A . n A 1 26 THR 26 24 ? ? ? A . n A 1 27 PRO 27 25 ? ? ? A . n A 1 28 PRO 28 26 ? ? ? A . n A 1 29 ALA 29 27 27 ALA ALA A . n A 1 30 LEU 30 28 28 LEU LEU A . n A 1 31 ARG 31 29 29 ARG ARG A . n A 1 32 ILE 32 30 30 ILE ILE A . n A 1 33 ILE 33 31 31 ILE ILE A . n A 1 34 LEU 34 32 32 LEU LEU A . n A 1 35 VAL 35 33 33 VAL VAL A . n A 1 36 GLY 36 34 34 GLY GLY A . n A 1 37 LYS 37 35 35 LYS LYS A . n A 1 38 THR 38 36 36 THR THR A . n A 1 39 GLY 39 37 37 GLY GLY A . n A 1 40 CYS 40 38 38 CYS CYS A . n A 1 41 GLY 41 39 39 GLY GLY A . n A 1 42 LYS 42 40 40 LYS LYS A . n A 1 43 SER 43 41 41 SER SER A . n A 1 44 ALA 44 42 42 ALA ALA A . n A 1 45 THR 45 43 43 THR THR A . n A 1 46 GLY 46 44 44 GLY GLY A . n A 1 47 ASN 47 45 45 ASN ASN A . n A 1 48 SER 48 46 46 SER SER A . n A 1 49 ILE 49 47 47 ILE ILE A . n A 1 50 LEU 50 48 48 LEU LEU A . n A 1 51 GLY 51 49 49 GLY GLY A . n A 1 52 GLN 52 50 50 GLN GLN A . n A 1 53 PRO 53 51 51 PRO PRO A . n A 1 54 VAL 54 52 52 VAL VAL A . n A 1 55 PHE 55 53 53 PHE PHE A . n A 1 56 GLU 56 54 54 GLU GLU A . n A 1 57 SER 57 55 55 SER SER A . n A 1 58 LYS 58 56 56 LYS LYS A . n A 1 59 LEU 59 57 57 LEU LEU A . n A 1 60 ARG 60 58 58 ARG ARG A . n A 1 61 ALA 61 59 59 ALA ALA A . n A 1 62 GLN 62 60 60 GLN GLN A . n A 1 63 SER 63 61 61 SER SER A . n A 1 64 VAL 64 62 62 VAL VAL A . n A 1 65 THR 65 63 63 THR THR A . n A 1 66 ARG 66 64 64 ARG ARG A . n A 1 67 THR 67 65 65 THR THR A . n A 1 68 CYS 68 66 66 CYS CYS A . n A 1 69 GLN 69 67 67 GLN GLN A . n A 1 70 VAL 70 68 68 VAL VAL A . n A 1 71 LYS 71 69 69 LYS LYS A . n A 1 72 THR 72 70 70 THR THR A . n A 1 73 GLY 73 71 71 GLY GLY A . n A 1 74 THR 74 72 72 THR THR A . n A 1 75 TRP 75 73 73 TRP TRP A . n A 1 76 ASN 76 74 74 ASN ASN A . n A 1 77 GLY 77 75 75 GLY GLY A . n A 1 78 ARG 78 76 76 ARG ARG A . n A 1 79 LYS 79 77 77 LYS LYS A . n A 1 80 VAL 80 78 78 VAL VAL A . n A 1 81 LEU 81 79 79 LEU LEU A . n A 1 82 VAL 82 80 80 VAL VAL A . n A 1 83 VAL 83 81 81 VAL VAL A . n A 1 84 ASP 84 82 82 ASP ASP A . n A 1 85 THR 85 83 83 THR THR A . n A 1 86 PRO 86 84 84 PRO PRO A . n A 1 87 SER 87 85 85 SER SER A . n A 1 88 ILE 88 86 86 ILE ILE A . n A 1 89 PHE 89 87 87 PHE PHE A . n A 1 90 GLU 90 88 88 GLU GLU A . n A 1 91 SER 91 89 89 SER SER A . n A 1 92 GLN 92 90 90 GLN GLN A . n A 1 93 ALA 93 91 91 ALA ALA A . n A 1 94 ASP 94 92 92 ASP ASP A . n A 1 95 THR 95 93 93 THR THR A . n A 1 96 GLN 96 94 94 GLN GLN A . n A 1 97 GLU 97 95 95 GLU GLU A . n A 1 98 LEU 98 96 96 LEU LEU A . n A 1 99 TYR 99 97 97 TYR TYR A . n A 1 100 LYS 100 98 98 LYS LYS A . n A 1 101 ASN 101 99 99 ASN ASN A . n A 1 102 ILE 102 100 100 ILE ILE A . n A 1 103 GLY 103 101 101 GLY GLY A . n A 1 104 ASP 104 102 102 ASP ASP A . n A 1 105 CYS 105 103 103 CYS CYS A . n A 1 106 TYR 106 104 104 TYR TYR A . n A 1 107 LEU 107 105 105 LEU LEU A . n A 1 108 LEU 108 106 106 LEU LEU A . n A 1 109 SER 109 107 107 SER SER A . n A 1 110 ALA 110 108 108 ALA ALA A . n A 1 111 PRO 111 109 109 PRO PRO A . n A 1 112 GLY 112 110 110 GLY GLY A . n A 1 113 PRO 113 111 111 PRO PRO A . n A 1 114 HIS 114 112 112 HIS HIS A . n A 1 115 VAL 115 113 113 VAL VAL A . n A 1 116 LEU 116 114 114 LEU LEU A . n A 1 117 LEU 117 115 115 LEU LEU A . n A 1 118 LEU 118 116 116 LEU LEU A . n A 1 119 VAL 119 117 117 VAL VAL A . n A 1 120 ILE 120 118 118 ILE ILE A . n A 1 121 GLN 121 119 119 GLN GLN A . n A 1 122 LEU 122 120 120 LEU LEU A . n A 1 123 GLY 123 121 121 GLY GLY A . n A 1 124 ARG 124 122 122 ARG ARG A . n A 1 125 PHE 125 123 123 PHE PHE A . n A 1 126 THR 126 124 124 THR THR A . n A 1 127 ALA 127 125 125 ALA ALA A . n A 1 128 GLN 128 126 126 GLN GLN A . n A 1 129 ASP 129 127 127 ASP ASP A . n A 1 130 THR 130 128 128 THR THR A . n A 1 131 VAL 131 129 129 VAL VAL A . n A 1 132 ALA 132 130 130 ALA ALA A . n A 1 133 ILE 133 131 131 ILE ILE A . n A 1 134 ARG 134 132 132 ARG ARG A . n A 1 135 LYS 135 133 133 LYS LYS A . n A 1 136 VAL 136 134 134 VAL VAL A . n A 1 137 LYS 137 135 135 LYS LYS A . n A 1 138 GLU 138 136 136 GLU GLU A . n A 1 139 VAL 139 137 137 VAL VAL A . n A 1 140 PHE 140 138 138 PHE PHE A . n A 1 141 GLY 141 139 139 GLY GLY A . n A 1 142 THR 142 140 140 THR THR A . n A 1 143 GLY 143 141 141 GLY GLY A . n A 1 144 ALA 144 142 142 ALA ALA A . n A 1 145 MET 145 143 143 MET MET A . n A 1 146 ARG 146 144 144 ARG ARG A . n A 1 147 HIS 147 145 145 HIS HIS A . n A 1 148 VAL 148 146 146 VAL VAL A . n A 1 149 VAL 149 147 147 VAL VAL A . n A 1 150 ILE 150 148 148 ILE ILE A . n A 1 151 LEU 151 149 149 LEU LEU A . n A 1 152 PHE 152 150 150 PHE PHE A . n A 1 153 THR 153 151 151 THR THR A . n A 1 154 HIS 154 152 152 HIS HIS A . n A 1 155 LYS 155 153 153 LYS LYS A . n A 1 156 GLU 156 154 154 GLU GLU A . n A 1 157 ASP 157 155 155 ASP ASP A . n A 1 158 LEU 158 156 156 LEU LEU A . n A 1 159 GLY 159 157 157 GLY GLY A . n A 1 160 GLY 160 158 158 GLY GLY A . n A 1 161 GLN 161 159 159 GLN GLN A . n A 1 162 ALA 162 160 160 ALA ALA A . n A 1 163 LEU 163 161 161 LEU LEU A . n A 1 164 ASP 164 162 162 ASP ASP A . n A 1 165 ASP 165 163 163 ASP ASP A . n A 1 166 TYR 166 164 164 TYR TYR A . n A 1 167 VAL 167 165 165 VAL VAL A . n A 1 168 ALA 168 166 166 ALA ALA A . n A 1 169 ASN 169 167 167 ASN ASN A . n A 1 170 THR 170 168 168 THR THR A . n A 1 171 ASP 171 169 169 ASP ASP A . n A 1 172 ASN 172 170 170 ASN ASN A . n A 1 173 CYS 173 171 171 CYS CYS A . n A 1 174 SER 174 172 172 SER SER A . n A 1 175 LEU 175 173 173 LEU LEU A . n A 1 176 LYS 176 174 174 LYS LYS A . n A 1 177 ASP 177 175 175 ASP ASP A . n A 1 178 LEU 178 176 176 LEU LEU A . n A 1 179 VAL 179 177 177 VAL VAL A . n A 1 180 ARG 180 178 178 ARG ARG A . n A 1 181 GLU 181 179 179 GLU GLU A . n A 1 182 CYS 182 180 180 CYS CYS A . n A 1 183 GLU 183 181 181 GLU GLU A . n A 1 184 ARG 184 182 182 ARG ARG A . n A 1 185 ARG 185 183 183 ARG ARG A . n A 1 186 TYR 186 184 184 TYR TYR A . n A 1 187 CYS 187 185 185 CYS CYS A . n A 1 188 ALA 188 186 186 ALA ALA A . n A 1 189 PHE 189 187 187 PHE PHE A . n A 1 190 ASN 190 188 188 ASN ASN A . n A 1 191 ASN 191 189 189 ASN ASN A . n A 1 192 TRP 192 190 190 TRP TRP A . n A 1 193 GLY 193 191 191 GLY GLY A . n A 1 194 SER 194 192 192 SER SER A . n A 1 195 VAL 195 193 193 VAL VAL A . n A 1 196 GLU 196 194 194 GLU GLU A . n A 1 197 GLU 197 195 195 GLU GLU A . n A 1 198 GLN 198 196 196 GLN GLN A . n A 1 199 ARG 199 197 197 ARG ARG A . n A 1 200 GLN 200 198 198 GLN GLN A . n A 1 201 GLN 201 199 199 GLN GLN A . n A 1 202 GLN 202 200 200 GLN GLN A . n A 1 203 ALA 203 201 201 ALA ALA A . n A 1 204 GLU 204 202 202 GLU GLU A . n A 1 205 LEU 205 203 203 LEU LEU A . n A 1 206 LEU 206 204 204 LEU LEU A . n A 1 207 ALA 207 205 205 ALA ALA A . n A 1 208 VAL 208 206 206 VAL VAL A . n A 1 209 ILE 209 207 207 ILE ILE A . n A 1 210 GLU 210 208 208 GLU GLU A . n A 1 211 ARG 211 209 209 ARG ARG A . n A 1 212 LEU 212 210 210 LEU LEU A . n A 1 213 GLY 213 211 211 GLY GLY A . n A 1 214 ARG 214 212 212 ARG ARG A . n A 1 215 GLU 215 213 213 GLU GLU A . n A 1 216 ARG 216 214 214 ARG ARG A . n A 1 217 GLU 217 215 215 GLU GLU A . n A 1 218 GLY 218 216 216 GLY GLY A . n A 1 219 SER 219 217 217 SER SER A . n A 1 220 PHE 220 218 218 PHE PHE A . n A 1 221 HIS 221 219 219 HIS HIS A . n A 1 222 SER 222 220 220 SER SER A . n A 1 223 ASN 223 221 221 ASN ASN A . n A 1 224 ASP 224 222 222 ASP ASP A . n A 1 225 LEU 225 223 223 LEU LEU A . n A 1 226 PHE 226 224 224 PHE PHE A . n A 1 227 LEU 227 225 225 LEU LEU A . n A 1 228 ASP 228 226 226 ASP ASP A . n A 1 229 ALA 229 227 227 ALA ALA A . n A 1 230 GLN 230 228 228 GLN GLN A . n A 1 231 LEU 231 229 229 LEU LEU A . n A 1 232 LEU 232 230 230 LEU LEU A . n A 1 233 GLN 233 231 231 GLN GLN A . n A 1 234 ARG 234 232 232 ARG ARG A . n A 1 235 THR 235 233 233 THR THR A . n A 1 236 GLY 236 234 234 GLY GLY A . n A 1 237 ALA 237 235 235 ALA ALA A . n A 1 238 GLY 238 236 236 GLY GLY A . n A 1 239 ALA 239 237 237 ALA ALA A . n A 1 240 CYS 240 238 238 CYS CYS A . n A 1 241 GLN 241 239 239 GLN GLN A . n A 1 242 GLU 242 240 240 GLU GLU A . n A 1 243 ASP 243 241 241 ASP ASP A . n A 1 244 TYR 244 242 242 TYR TYR A . n A 1 245 ARG 245 243 243 ARG ARG A . n A 1 246 GLN 246 244 244 GLN GLN A . n A 1 247 TYR 247 245 245 TYR TYR A . n A 1 248 GLN 248 246 246 GLN GLN A . n A 1 249 ALA 249 247 247 ALA ALA A . n A 1 250 LYS 250 248 248 LYS LYS A . n A 1 251 VAL 251 249 249 VAL VAL A . n A 1 252 GLU 252 250 250 GLU GLU A . n A 1 253 TRP 253 251 251 TRP TRP A . n A 1 254 GLN 254 252 252 GLN GLN A . n A 1 255 VAL 255 253 253 VAL VAL A . n A 1 256 GLU 256 254 254 GLU GLU A . n A 1 257 LYS 257 255 255 LYS LYS A . n A 1 258 HIS 258 256 256 HIS HIS A . n A 1 259 LYS 259 257 257 LYS LYS A . n A 1 260 GLN 260 258 258 GLN GLN A . n A 1 261 GLU 261 259 259 GLU GLU A . n A 1 262 LEU 262 260 260 LEU LEU A . n A 1 263 ARG 263 261 261 ARG ARG A . n A 1 264 GLU 264 262 262 GLU GLU A . n A 1 265 ASN 265 263 263 ASN ASN A . n A 1 266 GLU 266 264 ? ? ? A . n A 1 267 SER 267 265 ? ? ? A . n A 1 268 ASN 268 266 ? ? ? A . n A 1 269 TRP 269 267 ? ? ? A . n A 1 270 ALA 270 268 ? ? ? A . n A 1 271 TYR 271 269 ? ? ? A . n A 1 272 LYS 272 270 ? ? ? A . n A 1 273 ALA 273 271 ? ? ? A . n A 1 274 LEU 274 272 ? ? ? A . n A 1 275 LEU 275 273 ? ? ? A . n A 1 276 ARG 276 274 ? ? ? A . n A 1 277 VAL 277 275 ? ? ? A . n A 1 278 LYS 278 276 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 301 1 MG MG A . C 3 GDP 1 302 1 GDP GDP A . D 4 HOH 1 401 1 HOH HOH A . D 4 HOH 2 402 19 HOH HOH A . D 4 HOH 3 403 4 HOH HOH A . D 4 HOH 4 404 13 HOH HOH A . D 4 HOH 5 405 6 HOH HOH A . D 4 HOH 6 406 16 HOH HOH A . D 4 HOH 7 407 3 HOH HOH A . D 4 HOH 8 408 2 HOH HOH A . D 4 HOH 9 409 21 HOH HOH A . D 4 HOH 10 410 12 HOH HOH A . D 4 HOH 11 411 7 HOH HOH A . D 4 HOH 12 412 20 HOH HOH A . D 4 HOH 13 413 10 HOH HOH A . D 4 HOH 14 414 18 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.12_2829 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6Z3E _cell.details ? _cell.formula_units_Z ? _cell.length_a 41.280 _cell.length_a_esd ? _cell.length_b 57.230 _cell.length_b_esd ? _cell.length_c 106.760 _cell.length_c_esd ? _cell.volume 252215.627 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6Z3E _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6Z3E _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.02 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.26 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;16% 2-propanol 50 mM ammonium acetate ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-225' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2008-07-26 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 25.6825591945 _reflns.entry_id 6Z3E _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.8 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6579 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.7 _reflns.pdbx_Rmerge_I_obs 0.0166 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.37 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.8 _reflns_shell.d_res_low 2.9 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 595 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.475 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 27.7779106911 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6Z3E _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.80038678769 _refine.ls_d_res_low 39.0355231003 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6579 _refine.ls_number_reflns_R_free 309 _refine.ls_number_reflns_R_work 6270 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.0514905149 _refine.ls_percent_reflns_R_free 4.6967624259 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.217666000947 _refine.ls_R_factor_R_free 0.268149989389 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.215153938036 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.99501071312 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2xtp _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.3287354556 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.367330651165 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.80038678769 _refine_hist.d_res_low 39.0355231003 _refine_hist.number_atoms_solvent 14 _refine_hist.number_atoms_total 1915 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1872 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.00391852906709 ? 1966 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.819341518661 ? 2662 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0452000291228 ? 294 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0052578644946 ? 346 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.2906145126 ? 1630 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.8004 2.9004 . . 31 595 95.865237366 . . . 0.389409300673 . 0.281011119735 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9004 3.0165 . . 32 603 98.9096573209 . . . 0.414787683567 . 0.259735350036 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0165 3.1538 . . 23 623 99.0797546012 . . . 0.261874424713 . 0.226378875194 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1538 3.32 . . 29 605 99.3730407524 . . . 0.309648180709 . 0.224105775997 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.32 3.5278 . . 27 623 99.0853658537 . . . 0.249402451446 . 0.230129136357 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5278 3.8 . . 29 633 99.5488721805 . . . 0.262066270501 . 0.202460228285 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8 4.182 . . 31 631 99.6987951807 . . . 0.283699716613 . 0.192669429453 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.182 4.7862 . . 25 635 100.0 . . . 0.219549530579 . 0.178472180032 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.7862 6.0266 . . 37 641 99.5594713656 . . . 0.27517024657 . 0.2055956971 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.0266 39 . . 45 681 99.316005472 . . . 0.204964808956 . 0.218593340949 . . . . . . . . . . . # _struct.entry_id 6Z3E _struct.title 'Crystal structure of GDP-bound human GIMAP5, amino acid residues 1-276' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6Z3E _struct_keywords.text 'GTPase, immunity, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GIMA5_HUMAN _struct_ref.pdbx_db_accession Q96F15 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGGFQRGKYGTMAEGRSEDNLSATPPALRIILVGKTGCGKSATGNSILGQPVFESKLRAQSVTRTCQVKTGTWNGRKVLV VDTPSIFESQADTQELYKNIGDCYLLSAPGPHVLLLVIQLGRFTAQDTVAIRKVKEVFGTGAMRHVVILFTHKEDLGGQA LDDYVANTDNCSLKDLVRECERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQLLQRTGAGACQE DYRQYQAKVEWQVEKHKQELRENESNWAYKALLRVK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6Z3E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 278 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96F15 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 276 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 276 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6Z3E GLY A 1 ? UNP Q96F15 ? ? 'expression tag' -1 1 1 6Z3E PRO A 2 ? UNP Q96F15 ? ? 'expression tag' 0 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 900 ? 1 MORE -18 ? 1 'SSA (A^2)' 12380 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 41 ? GLY A 51 ? GLY A 39 GLY A 49 1 ? 11 HELX_P HELX_P2 AA2 THR A 95 ? ALA A 110 ? THR A 93 ALA A 108 1 ? 16 HELX_P HELX_P3 AA3 THR A 126 ? GLY A 141 ? THR A 124 GLY A 139 1 ? 16 HELX_P HELX_P4 AA4 GLY A 143 ? ARG A 146 ? GLY A 141 ARG A 144 5 ? 4 HELX_P HELX_P5 AA5 HIS A 154 ? GLY A 159 ? HIS A 152 GLY A 157 5 ? 6 HELX_P HELX_P6 AA6 ALA A 162 ? THR A 170 ? ALA A 160 THR A 168 1 ? 9 HELX_P HELX_P7 AA7 ASN A 172 ? CYS A 182 ? ASN A 170 CYS A 180 1 ? 11 HELX_P HELX_P8 AA8 SER A 194 ? ARG A 216 ? SER A 192 ARG A 214 1 ? 23 HELX_P HELX_P9 AA9 ASN A 223 ? ARG A 234 ? ASN A 221 ARG A 232 1 ? 12 HELX_P HELX_P10 AB1 ASP A 243 ? GLU A 264 ? ASP A 241 GLU A 262 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A SER 43 OG ? ? ? 1_555 B MG . MG ? ? A SER 41 A MG 301 1_555 ? ? ? ? ? ? ? 2.008 ? ? metalc2 metalc ? ? B MG . MG ? ? ? 1_555 C GDP . O3B ? ? A MG 301 A GDP 302 1_555 ? ? ? ? ? ? ? 1.994 ? ? metalc3 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 301 A HOH 414 1_555 ? ? ? ? ? ? ? 2.835 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OG ? A SER 43 ? A SER 41 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O3B ? C GDP . ? A GDP 302 ? 1_555 90.8 ? 2 OG ? A SER 43 ? A SER 41 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? D HOH . ? A HOH 414 ? 1_555 102.7 ? 3 O3B ? C GDP . ? A GDP 302 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? D HOH . ? A HOH 414 ? 1_555 161.8 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 110 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 108 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 111 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 109 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.85 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 69 ? TRP A 75 ? GLN A 67 TRP A 73 AA1 2 ARG A 78 ? ASP A 84 ? ARG A 76 ASP A 82 AA1 3 LEU A 30 ? VAL A 35 ? LEU A 28 VAL A 33 AA1 4 VAL A 115 ? GLN A 121 ? VAL A 113 GLN A 119 AA1 5 VAL A 148 ? THR A 153 ? VAL A 146 THR A 151 AA1 6 TYR A 186 ? ALA A 188 ? TYR A 184 ALA A 186 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 69 ? N GLN A 67 O ASP A 84 ? O ASP A 82 AA1 2 3 O LEU A 81 ? O LEU A 79 N LEU A 30 ? N LEU A 28 AA1 3 4 N ILE A 33 ? N ILE A 31 O LEU A 117 ? O LEU A 115 AA1 4 5 N LEU A 116 ? N LEU A 114 O VAL A 149 ? O VAL A 147 AA1 5 6 N PHE A 152 ? N PHE A 150 O CYS A 187 ? O CYS A 185 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 301 ? 4 'binding site for residue MG A 301' AC2 Software A GDP 302 ? 16 'binding site for residue GDP A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 SER A 43 ? SER A 41 . ? 1_555 ? 2 AC1 4 GLU A 56 ? GLU A 54 . ? 1_555 ? 3 AC1 4 GDP C . ? GDP A 302 . ? 1_555 ? 4 AC1 4 HOH D . ? HOH A 414 . ? 1_555 ? 5 AC2 16 LYS A 37 ? LYS A 35 . ? 1_555 ? 6 AC2 16 THR A 38 ? THR A 36 . ? 1_555 ? 7 AC2 16 GLY A 39 ? GLY A 37 . ? 1_555 ? 8 AC2 16 GLY A 41 ? GLY A 39 . ? 1_555 ? 9 AC2 16 LYS A 42 ? LYS A 40 . ? 1_555 ? 10 AC2 16 SER A 43 ? SER A 41 . ? 1_555 ? 11 AC2 16 ALA A 44 ? ALA A 42 . ? 1_555 ? 12 AC2 16 SER A 57 ? SER A 55 . ? 1_555 ? 13 AC2 16 LYS A 58 ? LYS A 56 . ? 1_555 ? 14 AC2 16 LEU A 59 ? LEU A 57 . ? 1_555 ? 15 AC2 16 HIS A 154 ? HIS A 152 . ? 1_555 ? 16 AC2 16 GLU A 156 ? GLU A 154 . ? 1_555 ? 17 AC2 16 PHE A 189 ? PHE A 187 . ? 1_555 ? 18 AC2 16 ASN A 191 ? ASN A 189 . ? 1_555 ? 19 AC2 16 TRP A 192 ? TRP A 190 . ? 1_555 ? 20 AC2 16 MG B . ? MG A 301 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 175 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 NH2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 178 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 58 ? ? -131.02 -30.48 2 1 PRO A 84 ? ? -77.90 -166.40 3 1 PHE A 87 ? ? -107.84 42.06 4 1 ALA A 237 ? ? -130.95 -34.19 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 16.1379746315 -0.422525822387 20.2385783104 0.0743948746959 ? -0.0442330329362 ? 0.0199916881337 ? 0.111127672982 ? -0.0647035802706 ? 0.137525752058 ? 1.99718763149 ? -0.45955894891 ? -0.326395904436 ? 1.96565076036 ? -0.313227252424 ? 3.76993722207 ? 0.0736453931312 ? 0.202625075066 ? -0.545254118038 ? -0.0311967522988 ? -0.111608369656 ? 0.223239453879 ? 0.101731299695 ? 0.0383393919046 ? 0.0804478295307 ? 2 'X-RAY DIFFRACTION' ? refined 20.2141514006 6.57250166985 19.5580336896 0.142905455349 ? 0.0114459315262 ? 0.00238510510979 ? 0.165791898676 ? 0.00663014105619 ? 0.173488004479 ? 1.77797892228 ? 0.48951618693 ? -0.124451207338 ? 2.43177184503 ? -0.895232626099 ? 0.708798998441 ? 0.209185717421 ? -0.12315650947 ? -0.320216916275 ? 0.106464149115 ? -0.273329732431 ? -0.110247976735 ? -0.00955202579548 ? 0.226887607501 ? 0.105721181335 ? 3 'X-RAY DIFFRACTION' ? refined 2.75454339488 6.902920245 17.1487922524 0.102743157245 ? 0.0345184767709 ? -0.0507967005068 ? 0.147109653483 ? -0.00710745218811 ? 0.207111509148 ? 1.87981207491 ? 0.456778682566 ? 0.157300039555 ? 1.59071453065 ? 0.446358496694 ? 1.15165963854 ? -0.191180763323 ? -0.187405773178 ? 0.140694671683 ? -0.145319953541 ? 0.167451875697 ? 0.342506740718 ? 0.0860880259829 ? -0.192664840347 ? 0.00719508967531 ? 4 'X-RAY DIFFRACTION' ? refined 10.2106392732 -0.308017283908 9.59591765612 0.241201090801 ? -0.0538980489234 ? 0.0402725604645 ? 0.101814035596 ? -0.0394013316317 ? 0.343079842743 ? 0.429886568363 ? -0.13103850074 ? 0.187474916512 ? 1.52965768607 ? -0.61401234901 ? 0.746964462801 ? -0.00102696141278 ? 0.151502192848 ? -0.150366847425 ? -0.425615732191 ? 0.0208177569036 ? 0.14130366849 ? 0.27795879194 ? -0.0558660952753 ? 0.0672162640118 ? 5 'X-RAY DIFFRACTION' ? refined 24.1173541673 21.2541009413 9.56682699361 0.467292343688 ? -0.109496579689 ? 0.0948274029776 ? 0.261693019367 ? 0.00551782412043 ? 0.212091688371 ? 5.4611201806 ? 0.302142797792 ? -1.7335529534 ? 1.52349104547 ? -0.195217836213 ? 2.22024649237 ? 0.621171096732 ? 0.635224470785 ? 0.797434031958 ? -0.44995096772 ? -0.427201969212 ? 0.0189177323387 ? -0.39677550111 ? 0.274951436058 ? -0.14162616604 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? '(chain A and resseq 27:56)' 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? '(chain A and resseq 57:108)' 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? '(chain A and resseq 109:180)' 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? '(chain A and resseq 181:231)' 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? '(chain A and resseq 232:263)' # _pdbx_entry_details.entry_id 6Z3E _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A PRO 0 ? A PRO 2 3 1 Y 1 A MET 1 ? A MET 3 4 1 Y 1 A GLY 2 ? A GLY 4 5 1 Y 1 A GLY 3 ? A GLY 5 6 1 Y 1 A PHE 4 ? A PHE 6 7 1 Y 1 A GLN 5 ? A GLN 7 8 1 Y 1 A ARG 6 ? A ARG 8 9 1 Y 1 A GLY 7 ? A GLY 9 10 1 Y 1 A LYS 8 ? A LYS 10 11 1 Y 1 A TYR 9 ? A TYR 11 12 1 Y 1 A GLY 10 ? A GLY 12 13 1 Y 1 A THR 11 ? A THR 13 14 1 Y 1 A MET 12 ? A MET 14 15 1 Y 1 A ALA 13 ? A ALA 15 16 1 Y 1 A GLU 14 ? A GLU 16 17 1 Y 1 A GLY 15 ? A GLY 17 18 1 Y 1 A ARG 16 ? A ARG 18 19 1 Y 1 A SER 17 ? A SER 19 20 1 Y 1 A GLU 18 ? A GLU 20 21 1 Y 1 A ASP 19 ? A ASP 21 22 1 Y 1 A ASN 20 ? A ASN 22 23 1 Y 1 A LEU 21 ? A LEU 23 24 1 Y 1 A SER 22 ? A SER 24 25 1 Y 1 A ALA 23 ? A ALA 25 26 1 Y 1 A THR 24 ? A THR 26 27 1 Y 1 A PRO 25 ? A PRO 27 28 1 Y 1 A PRO 26 ? A PRO 28 29 1 Y 1 A GLU 264 ? A GLU 266 30 1 Y 1 A SER 265 ? A SER 267 31 1 Y 1 A ASN 266 ? A ASN 268 32 1 Y 1 A TRP 267 ? A TRP 269 33 1 Y 1 A ALA 268 ? A ALA 270 34 1 Y 1 A TYR 269 ? A TYR 271 35 1 Y 1 A LYS 270 ? A LYS 272 36 1 Y 1 A ALA 271 ? A ALA 273 37 1 Y 1 A LEU 272 ? A LEU 274 38 1 Y 1 A LEU 273 ? A LEU 275 39 1 Y 1 A ARG 274 ? A ARG 276 40 1 Y 1 A VAL 275 ? A VAL 277 41 1 Y 1 A LYS 276 ? A LYS 278 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GDP PB P N N 88 GDP O1B O N N 89 GDP O2B O N N 90 GDP O3B O N N 91 GDP O3A O N N 92 GDP PA P N N 93 GDP O1A O N N 94 GDP O2A O N N 95 GDP "O5'" O N N 96 GDP "C5'" C N N 97 GDP "C4'" C N R 98 GDP "O4'" O N N 99 GDP "C3'" C N S 100 GDP "O3'" O N N 101 GDP "C2'" C N R 102 GDP "O2'" O N N 103 GDP "C1'" C N R 104 GDP N9 N Y N 105 GDP C8 C Y N 106 GDP N7 N Y N 107 GDP C5 C Y N 108 GDP C6 C N N 109 GDP O6 O N N 110 GDP N1 N N N 111 GDP C2 C N N 112 GDP N2 N N N 113 GDP N3 N N N 114 GDP C4 C Y N 115 GDP HOB2 H N N 116 GDP HOB3 H N N 117 GDP HOA2 H N N 118 GDP "H5'" H N N 119 GDP "H5''" H N N 120 GDP "H4'" H N N 121 GDP "H3'" H N N 122 GDP "HO3'" H N N 123 GDP "H2'" H N N 124 GDP "HO2'" H N N 125 GDP "H1'" H N N 126 GDP H8 H N N 127 GDP HN1 H N N 128 GDP HN21 H N N 129 GDP HN22 H N N 130 GLN N N N N 131 GLN CA C N S 132 GLN C C N N 133 GLN O O N N 134 GLN CB C N N 135 GLN CG C N N 136 GLN CD C N N 137 GLN OE1 O N N 138 GLN NE2 N N N 139 GLN OXT O N N 140 GLN H H N N 141 GLN H2 H N N 142 GLN HA H N N 143 GLN HB2 H N N 144 GLN HB3 H N N 145 GLN HG2 H N N 146 GLN HG3 H N N 147 GLN HE21 H N N 148 GLN HE22 H N N 149 GLN HXT H N N 150 GLU N N N N 151 GLU CA C N S 152 GLU C C N N 153 GLU O O N N 154 GLU CB C N N 155 GLU CG C N N 156 GLU CD C N N 157 GLU OE1 O N N 158 GLU OE2 O N N 159 GLU OXT O N N 160 GLU H H N N 161 GLU H2 H N N 162 GLU HA H N N 163 GLU HB2 H N N 164 GLU HB3 H N N 165 GLU HG2 H N N 166 GLU HG3 H N N 167 GLU HE2 H N N 168 GLU HXT H N N 169 GLY N N N N 170 GLY CA C N N 171 GLY C C N N 172 GLY O O N N 173 GLY OXT O N N 174 GLY H H N N 175 GLY H2 H N N 176 GLY HA2 H N N 177 GLY HA3 H N N 178 GLY HXT H N N 179 HIS N N N N 180 HIS CA C N S 181 HIS C C N N 182 HIS O O N N 183 HIS CB C N N 184 HIS CG C Y N 185 HIS ND1 N Y N 186 HIS CD2 C Y N 187 HIS CE1 C Y N 188 HIS NE2 N Y N 189 HIS OXT O N N 190 HIS H H N N 191 HIS H2 H N N 192 HIS HA H N N 193 HIS HB2 H N N 194 HIS HB3 H N N 195 HIS HD1 H N N 196 HIS HD2 H N N 197 HIS HE1 H N N 198 HIS HE2 H N N 199 HIS HXT H N N 200 HOH O O N N 201 HOH H1 H N N 202 HOH H2 H N N 203 ILE N N N N 204 ILE CA C N S 205 ILE C C N N 206 ILE O O N N 207 ILE CB C N S 208 ILE CG1 C N N 209 ILE CG2 C N N 210 ILE CD1 C N N 211 ILE OXT O N N 212 ILE H H N N 213 ILE H2 H N N 214 ILE HA H N N 215 ILE HB H N N 216 ILE HG12 H N N 217 ILE HG13 H N N 218 ILE HG21 H N N 219 ILE HG22 H N N 220 ILE HG23 H N N 221 ILE HD11 H N N 222 ILE HD12 H N N 223 ILE HD13 H N N 224 ILE HXT H N N 225 LEU N N N N 226 LEU CA C N S 227 LEU C C N N 228 LEU O O N N 229 LEU CB C N N 230 LEU CG C N N 231 LEU CD1 C N N 232 LEU CD2 C N N 233 LEU OXT O N N 234 LEU H H N N 235 LEU H2 H N N 236 LEU HA H N N 237 LEU HB2 H N N 238 LEU HB3 H N N 239 LEU HG H N N 240 LEU HD11 H N N 241 LEU HD12 H N N 242 LEU HD13 H N N 243 LEU HD21 H N N 244 LEU HD22 H N N 245 LEU HD23 H N N 246 LEU HXT H N N 247 LYS N N N N 248 LYS CA C N S 249 LYS C C N N 250 LYS O O N N 251 LYS CB C N N 252 LYS CG C N N 253 LYS CD C N N 254 LYS CE C N N 255 LYS NZ N N N 256 LYS OXT O N N 257 LYS H H N N 258 LYS H2 H N N 259 LYS HA H N N 260 LYS HB2 H N N 261 LYS HB3 H N N 262 LYS HG2 H N N 263 LYS HG3 H N N 264 LYS HD2 H N N 265 LYS HD3 H N N 266 LYS HE2 H N N 267 LYS HE3 H N N 268 LYS HZ1 H N N 269 LYS HZ2 H N N 270 LYS HZ3 H N N 271 LYS HXT H N N 272 MET N N N N 273 MET CA C N S 274 MET C C N N 275 MET O O N N 276 MET CB C N N 277 MET CG C N N 278 MET SD S N N 279 MET CE C N N 280 MET OXT O N N 281 MET H H N N 282 MET H2 H N N 283 MET HA H N N 284 MET HB2 H N N 285 MET HB3 H N N 286 MET HG2 H N N 287 MET HG3 H N N 288 MET HE1 H N N 289 MET HE2 H N N 290 MET HE3 H N N 291 MET HXT H N N 292 MG MG MG N N 293 PHE N N N N 294 PHE CA C N S 295 PHE C C N N 296 PHE O O N N 297 PHE CB C N N 298 PHE CG C Y N 299 PHE CD1 C Y N 300 PHE CD2 C Y N 301 PHE CE1 C Y N 302 PHE CE2 C Y N 303 PHE CZ C Y N 304 PHE OXT O N N 305 PHE H H N N 306 PHE H2 H N N 307 PHE HA H N N 308 PHE HB2 H N N 309 PHE HB3 H N N 310 PHE HD1 H N N 311 PHE HD2 H N N 312 PHE HE1 H N N 313 PHE HE2 H N N 314 PHE HZ H N N 315 PHE HXT H N N 316 PRO N N N N 317 PRO CA C N S 318 PRO C C N N 319 PRO O O N N 320 PRO CB C N N 321 PRO CG C N N 322 PRO CD C N N 323 PRO OXT O N N 324 PRO H H N N 325 PRO HA H N N 326 PRO HB2 H N N 327 PRO HB3 H N N 328 PRO HG2 H N N 329 PRO HG3 H N N 330 PRO HD2 H N N 331 PRO HD3 H N N 332 PRO HXT H N N 333 SER N N N N 334 SER CA C N S 335 SER C C N N 336 SER O O N N 337 SER CB C N N 338 SER OG O N N 339 SER OXT O N N 340 SER H H N N 341 SER H2 H N N 342 SER HA H N N 343 SER HB2 H N N 344 SER HB3 H N N 345 SER HG H N N 346 SER HXT H N N 347 THR N N N N 348 THR CA C N S 349 THR C C N N 350 THR O O N N 351 THR CB C N R 352 THR OG1 O N N 353 THR CG2 C N N 354 THR OXT O N N 355 THR H H N N 356 THR H2 H N N 357 THR HA H N N 358 THR HB H N N 359 THR HG1 H N N 360 THR HG21 H N N 361 THR HG22 H N N 362 THR HG23 H N N 363 THR HXT H N N 364 TRP N N N N 365 TRP CA C N S 366 TRP C C N N 367 TRP O O N N 368 TRP CB C N N 369 TRP CG C Y N 370 TRP CD1 C Y N 371 TRP CD2 C Y N 372 TRP NE1 N Y N 373 TRP CE2 C Y N 374 TRP CE3 C Y N 375 TRP CZ2 C Y N 376 TRP CZ3 C Y N 377 TRP CH2 C Y N 378 TRP OXT O N N 379 TRP H H N N 380 TRP H2 H N N 381 TRP HA H N N 382 TRP HB2 H N N 383 TRP HB3 H N N 384 TRP HD1 H N N 385 TRP HE1 H N N 386 TRP HE3 H N N 387 TRP HZ2 H N N 388 TRP HZ3 H N N 389 TRP HH2 H N N 390 TRP HXT H N N 391 TYR N N N N 392 TYR CA C N S 393 TYR C C N N 394 TYR O O N N 395 TYR CB C N N 396 TYR CG C Y N 397 TYR CD1 C Y N 398 TYR CD2 C Y N 399 TYR CE1 C Y N 400 TYR CE2 C Y N 401 TYR CZ C Y N 402 TYR OH O N N 403 TYR OXT O N N 404 TYR H H N N 405 TYR H2 H N N 406 TYR HA H N N 407 TYR HB2 H N N 408 TYR HB3 H N N 409 TYR HD1 H N N 410 TYR HD2 H N N 411 TYR HE1 H N N 412 TYR HE2 H N N 413 TYR HH H N N 414 TYR HXT H N N 415 VAL N N N N 416 VAL CA C N S 417 VAL C C N N 418 VAL O O N N 419 VAL CB C N N 420 VAL CG1 C N N 421 VAL CG2 C N N 422 VAL OXT O N N 423 VAL H H N N 424 VAL H2 H N N 425 VAL HA H N N 426 VAL HB H N N 427 VAL HG11 H N N 428 VAL HG12 H N N 429 VAL HG13 H N N 430 VAL HG21 H N N 431 VAL HG22 H N N 432 VAL HG23 H N N 433 VAL HXT H N N 434 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GDP PB O1B doub N N 83 GDP PB O2B sing N N 84 GDP PB O3B sing N N 85 GDP PB O3A sing N N 86 GDP O2B HOB2 sing N N 87 GDP O3B HOB3 sing N N 88 GDP O3A PA sing N N 89 GDP PA O1A doub N N 90 GDP PA O2A sing N N 91 GDP PA "O5'" sing N N 92 GDP O2A HOA2 sing N N 93 GDP "O5'" "C5'" sing N N 94 GDP "C5'" "C4'" sing N N 95 GDP "C5'" "H5'" sing N N 96 GDP "C5'" "H5''" sing N N 97 GDP "C4'" "O4'" sing N N 98 GDP "C4'" "C3'" sing N N 99 GDP "C4'" "H4'" sing N N 100 GDP "O4'" "C1'" sing N N 101 GDP "C3'" "O3'" sing N N 102 GDP "C3'" "C2'" sing N N 103 GDP "C3'" "H3'" sing N N 104 GDP "O3'" "HO3'" sing N N 105 GDP "C2'" "O2'" sing N N 106 GDP "C2'" "C1'" sing N N 107 GDP "C2'" "H2'" sing N N 108 GDP "O2'" "HO2'" sing N N 109 GDP "C1'" N9 sing N N 110 GDP "C1'" "H1'" sing N N 111 GDP N9 C8 sing Y N 112 GDP N9 C4 sing Y N 113 GDP C8 N7 doub Y N 114 GDP C8 H8 sing N N 115 GDP N7 C5 sing Y N 116 GDP C5 C6 sing N N 117 GDP C5 C4 doub Y N 118 GDP C6 O6 doub N N 119 GDP C6 N1 sing N N 120 GDP N1 C2 sing N N 121 GDP N1 HN1 sing N N 122 GDP C2 N2 sing N N 123 GDP C2 N3 doub N N 124 GDP N2 HN21 sing N N 125 GDP N2 HN22 sing N N 126 GDP N3 C4 sing N N 127 GLN N CA sing N N 128 GLN N H sing N N 129 GLN N H2 sing N N 130 GLN CA C sing N N 131 GLN CA CB sing N N 132 GLN CA HA sing N N 133 GLN C O doub N N 134 GLN C OXT sing N N 135 GLN CB CG sing N N 136 GLN CB HB2 sing N N 137 GLN CB HB3 sing N N 138 GLN CG CD sing N N 139 GLN CG HG2 sing N N 140 GLN CG HG3 sing N N 141 GLN CD OE1 doub N N 142 GLN CD NE2 sing N N 143 GLN NE2 HE21 sing N N 144 GLN NE2 HE22 sing N N 145 GLN OXT HXT sing N N 146 GLU N CA sing N N 147 GLU N H sing N N 148 GLU N H2 sing N N 149 GLU CA C sing N N 150 GLU CA CB sing N N 151 GLU CA HA sing N N 152 GLU C O doub N N 153 GLU C OXT sing N N 154 GLU CB CG sing N N 155 GLU CB HB2 sing N N 156 GLU CB HB3 sing N N 157 GLU CG CD sing N N 158 GLU CG HG2 sing N N 159 GLU CG HG3 sing N N 160 GLU CD OE1 doub N N 161 GLU CD OE2 sing N N 162 GLU OE2 HE2 sing N N 163 GLU OXT HXT sing N N 164 GLY N CA sing N N 165 GLY N H sing N N 166 GLY N H2 sing N N 167 GLY CA C sing N N 168 GLY CA HA2 sing N N 169 GLY CA HA3 sing N N 170 GLY C O doub N N 171 GLY C OXT sing N N 172 GLY OXT HXT sing N N 173 HIS N CA sing N N 174 HIS N H sing N N 175 HIS N H2 sing N N 176 HIS CA C sing N N 177 HIS CA CB sing N N 178 HIS CA HA sing N N 179 HIS C O doub N N 180 HIS C OXT sing N N 181 HIS CB CG sing N N 182 HIS CB HB2 sing N N 183 HIS CB HB3 sing N N 184 HIS CG ND1 sing Y N 185 HIS CG CD2 doub Y N 186 HIS ND1 CE1 doub Y N 187 HIS ND1 HD1 sing N N 188 HIS CD2 NE2 sing Y N 189 HIS CD2 HD2 sing N N 190 HIS CE1 NE2 sing Y N 191 HIS CE1 HE1 sing N N 192 HIS NE2 HE2 sing N N 193 HIS OXT HXT sing N N 194 HOH O H1 sing N N 195 HOH O H2 sing N N 196 ILE N CA sing N N 197 ILE N H sing N N 198 ILE N H2 sing N N 199 ILE CA C sing N N 200 ILE CA CB sing N N 201 ILE CA HA sing N N 202 ILE C O doub N N 203 ILE C OXT sing N N 204 ILE CB CG1 sing N N 205 ILE CB CG2 sing N N 206 ILE CB HB sing N N 207 ILE CG1 CD1 sing N N 208 ILE CG1 HG12 sing N N 209 ILE CG1 HG13 sing N N 210 ILE CG2 HG21 sing N N 211 ILE CG2 HG22 sing N N 212 ILE CG2 HG23 sing N N 213 ILE CD1 HD11 sing N N 214 ILE CD1 HD12 sing N N 215 ILE CD1 HD13 sing N N 216 ILE OXT HXT sing N N 217 LEU N CA sing N N 218 LEU N H sing N N 219 LEU N H2 sing N N 220 LEU CA C sing N N 221 LEU CA CB sing N N 222 LEU CA HA sing N N 223 LEU C O doub N N 224 LEU C OXT sing N N 225 LEU CB CG sing N N 226 LEU CB HB2 sing N N 227 LEU CB HB3 sing N N 228 LEU CG CD1 sing N N 229 LEU CG CD2 sing N N 230 LEU CG HG sing N N 231 LEU CD1 HD11 sing N N 232 LEU CD1 HD12 sing N N 233 LEU CD1 HD13 sing N N 234 LEU CD2 HD21 sing N N 235 LEU CD2 HD22 sing N N 236 LEU CD2 HD23 sing N N 237 LEU OXT HXT sing N N 238 LYS N CA sing N N 239 LYS N H sing N N 240 LYS N H2 sing N N 241 LYS CA C sing N N 242 LYS CA CB sing N N 243 LYS CA HA sing N N 244 LYS C O doub N N 245 LYS C OXT sing N N 246 LYS CB CG sing N N 247 LYS CB HB2 sing N N 248 LYS CB HB3 sing N N 249 LYS CG CD sing N N 250 LYS CG HG2 sing N N 251 LYS CG HG3 sing N N 252 LYS CD CE sing N N 253 LYS CD HD2 sing N N 254 LYS CD HD3 sing N N 255 LYS CE NZ sing N N 256 LYS CE HE2 sing N N 257 LYS CE HE3 sing N N 258 LYS NZ HZ1 sing N N 259 LYS NZ HZ2 sing N N 260 LYS NZ HZ3 sing N N 261 LYS OXT HXT sing N N 262 MET N CA sing N N 263 MET N H sing N N 264 MET N H2 sing N N 265 MET CA C sing N N 266 MET CA CB sing N N 267 MET CA HA sing N N 268 MET C O doub N N 269 MET C OXT sing N N 270 MET CB CG sing N N 271 MET CB HB2 sing N N 272 MET CB HB3 sing N N 273 MET CG SD sing N N 274 MET CG HG2 sing N N 275 MET CG HG3 sing N N 276 MET SD CE sing N N 277 MET CE HE1 sing N N 278 MET CE HE2 sing N N 279 MET CE HE3 sing N N 280 MET OXT HXT sing N N 281 PHE N CA sing N N 282 PHE N H sing N N 283 PHE N H2 sing N N 284 PHE CA C sing N N 285 PHE CA CB sing N N 286 PHE CA HA sing N N 287 PHE C O doub N N 288 PHE C OXT sing N N 289 PHE CB CG sing N N 290 PHE CB HB2 sing N N 291 PHE CB HB3 sing N N 292 PHE CG CD1 doub Y N 293 PHE CG CD2 sing Y N 294 PHE CD1 CE1 sing Y N 295 PHE CD1 HD1 sing N N 296 PHE CD2 CE2 doub Y N 297 PHE CD2 HD2 sing N N 298 PHE CE1 CZ doub Y N 299 PHE CE1 HE1 sing N N 300 PHE CE2 CZ sing Y N 301 PHE CE2 HE2 sing N N 302 PHE CZ HZ sing N N 303 PHE OXT HXT sing N N 304 PRO N CA sing N N 305 PRO N CD sing N N 306 PRO N H sing N N 307 PRO CA C sing N N 308 PRO CA CB sing N N 309 PRO CA HA sing N N 310 PRO C O doub N N 311 PRO C OXT sing N N 312 PRO CB CG sing N N 313 PRO CB HB2 sing N N 314 PRO CB HB3 sing N N 315 PRO CG CD sing N N 316 PRO CG HG2 sing N N 317 PRO CG HG3 sing N N 318 PRO CD HD2 sing N N 319 PRO CD HD3 sing N N 320 PRO OXT HXT sing N N 321 SER N CA sing N N 322 SER N H sing N N 323 SER N H2 sing N N 324 SER CA C sing N N 325 SER CA CB sing N N 326 SER CA HA sing N N 327 SER C O doub N N 328 SER C OXT sing N N 329 SER CB OG sing N N 330 SER CB HB2 sing N N 331 SER CB HB3 sing N N 332 SER OG HG sing N N 333 SER OXT HXT sing N N 334 THR N CA sing N N 335 THR N H sing N N 336 THR N H2 sing N N 337 THR CA C sing N N 338 THR CA CB sing N N 339 THR CA HA sing N N 340 THR C O doub N N 341 THR C OXT sing N N 342 THR CB OG1 sing N N 343 THR CB CG2 sing N N 344 THR CB HB sing N N 345 THR OG1 HG1 sing N N 346 THR CG2 HG21 sing N N 347 THR CG2 HG22 sing N N 348 THR CG2 HG23 sing N N 349 THR OXT HXT sing N N 350 TRP N CA sing N N 351 TRP N H sing N N 352 TRP N H2 sing N N 353 TRP CA C sing N N 354 TRP CA CB sing N N 355 TRP CA HA sing N N 356 TRP C O doub N N 357 TRP C OXT sing N N 358 TRP CB CG sing N N 359 TRP CB HB2 sing N N 360 TRP CB HB3 sing N N 361 TRP CG CD1 doub Y N 362 TRP CG CD2 sing Y N 363 TRP CD1 NE1 sing Y N 364 TRP CD1 HD1 sing N N 365 TRP CD2 CE2 doub Y N 366 TRP CD2 CE3 sing Y N 367 TRP NE1 CE2 sing Y N 368 TRP NE1 HE1 sing N N 369 TRP CE2 CZ2 sing Y N 370 TRP CE3 CZ3 doub Y N 371 TRP CE3 HE3 sing N N 372 TRP CZ2 CH2 doub Y N 373 TRP CZ2 HZ2 sing N N 374 TRP CZ3 CH2 sing Y N 375 TRP CZ3 HZ3 sing N N 376 TRP CH2 HH2 sing N N 377 TRP OXT HXT sing N N 378 TYR N CA sing N N 379 TYR N H sing N N 380 TYR N H2 sing N N 381 TYR CA C sing N N 382 TYR CA CB sing N N 383 TYR CA HA sing N N 384 TYR C O doub N N 385 TYR C OXT sing N N 386 TYR CB CG sing N N 387 TYR CB HB2 sing N N 388 TYR CB HB3 sing N N 389 TYR CG CD1 doub Y N 390 TYR CG CD2 sing Y N 391 TYR CD1 CE1 sing Y N 392 TYR CD1 HD1 sing N N 393 TYR CD2 CE2 doub Y N 394 TYR CD2 HD2 sing N N 395 TYR CE1 CZ doub Y N 396 TYR CE1 HE1 sing N N 397 TYR CE2 CZ sing Y N 398 TYR CE2 HE2 sing N N 399 TYR CZ OH sing N N 400 TYR OH HH sing N N 401 TYR OXT HXT sing N N 402 VAL N CA sing N N 403 VAL N H sing N N 404 VAL N H2 sing N N 405 VAL CA C sing N N 406 VAL CA CB sing N N 407 VAL CA HA sing N N 408 VAL C O doub N N 409 VAL C OXT sing N N 410 VAL CB CG1 sing N N 411 VAL CB CG2 sing N N 412 VAL CB HB sing N N 413 VAL CG1 HG11 sing N N 414 VAL CG1 HG12 sing N N 415 VAL CG1 HG13 sing N N 416 VAL CG2 HG21 sing N N 417 VAL CG2 HG22 sing N N 418 VAL CG2 HG23 sing N N 419 VAL OXT HXT sing N N 420 # _pdbx_audit_support.funding_organization 'Helmholtz Association' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2XTP _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 6Z3E _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.024225 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017473 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009367 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? 9.41153 2.53737 2.59044 63.03566 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? 9.05267 ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 1.42069 35.72801 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_