data_6Z9C # _entry.id 6Z9C # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6Z9C pdb_00006z9c 10.2210/pdb6z9c/pdb WWPDB D_1292109084 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-06-17 2 'Structure model' 1 1 2021-05-05 3 'Structure model' 1 2 2021-06-02 4 'Structure model' 1 3 2024-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' 13 3 'Structure model' '_citation_author.identifier_ORCID' 14 3 'Structure model' '_citation_author.name' 15 4 'Structure model' '_database_2.pdbx_DOI' 16 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6Z9C _pdbx_database_status.recvd_initial_deposition_date 2020-06-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kulik, A.A.' 1 ? 'Maruszczak, K.' 2 ? 'Nabi, N.L.M.' 3 ? 'Bingham, R.J.' 4 0000-0003-3805-0364 'Cooper, C.D.O.' 5 0000-0002-9197-8041 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Protein Sci.' _citation.journal_id_ASTM PRCIEI _citation.journal_id_CSD 0795 _citation.journal_id_ISSN 1469-896X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 30 _citation.language ? _citation.page_first 1196 _citation.page_last 1209 _citation.title 'Crystal structure and molecular dynamics of human POLDIP2, a multifaceted adaptor protein in metabolism and genome stability.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/pro.4085 _citation.pdbx_database_id_PubMed 33884680 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kulik, A.A.' 1 ? primary 'Maruszczak, K.K.' 2 ? primary 'Thomas, D.C.' 3 ? primary 'Nabi-Aldridge, N.L.A.' 4 ? primary 'Carr, M.' 5 ? primary 'Bingham, R.J.' 6 ? primary 'Cooper, C.D.O.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polymerase delta-interacting protein 2' 37020.445 1 ? ? ? ? 2 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 3 water nat water 18.015 24 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '38 kDa DNA polymerase delta interaction protein,p38' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMLSSRNRPEGKVLETVGVFEVPKQNGKYETGQLFLHSIFGYRGVVLFPWQARLYDRDVASAAPEKAENPAGHGSKEVKG KTHTYYQVLIDARDCPHISQRSQTEAVTFLANHDDSRALYAIPGLDYVSHEDILPYTSTDQVPIQHELFERFLLYDQTKA PPFVARETLRAWQEKNHPWLELSDVHRETTENIRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFS LSGTLETVRGRGVVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEKTPPSGLHW ; _entity_poly.pdbx_seq_one_letter_code_can ;SMLSSRNRPEGKVLETVGVFEVPKQNGKYETGQLFLHSIFGYRGVVLFPWQARLYDRDVASAAPEKAENPAGHGSKEVKG KTHTYYQVLIDARDCPHISQRSQTEAVTFLANHDDSRALYAIPGLDYVSHEDILPYTSTDQVPIQHELFERFLLYDQTKA PPFVARETLRAWQEKNHPWLELSDVHRETTENIRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFS LSGTLETVRGRGVVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEKTPPSGLHW ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SODIUM ION' NA 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 LEU n 1 4 SER n 1 5 SER n 1 6 ARG n 1 7 ASN n 1 8 ARG n 1 9 PRO n 1 10 GLU n 1 11 GLY n 1 12 LYS n 1 13 VAL n 1 14 LEU n 1 15 GLU n 1 16 THR n 1 17 VAL n 1 18 GLY n 1 19 VAL n 1 20 PHE n 1 21 GLU n 1 22 VAL n 1 23 PRO n 1 24 LYS n 1 25 GLN n 1 26 ASN n 1 27 GLY n 1 28 LYS n 1 29 TYR n 1 30 GLU n 1 31 THR n 1 32 GLY n 1 33 GLN n 1 34 LEU n 1 35 PHE n 1 36 LEU n 1 37 HIS n 1 38 SER n 1 39 ILE n 1 40 PHE n 1 41 GLY n 1 42 TYR n 1 43 ARG n 1 44 GLY n 1 45 VAL n 1 46 VAL n 1 47 LEU n 1 48 PHE n 1 49 PRO n 1 50 TRP n 1 51 GLN n 1 52 ALA n 1 53 ARG n 1 54 LEU n 1 55 TYR n 1 56 ASP n 1 57 ARG n 1 58 ASP n 1 59 VAL n 1 60 ALA n 1 61 SER n 1 62 ALA n 1 63 ALA n 1 64 PRO n 1 65 GLU n 1 66 LYS n 1 67 ALA n 1 68 GLU n 1 69 ASN n 1 70 PRO n 1 71 ALA n 1 72 GLY n 1 73 HIS n 1 74 GLY n 1 75 SER n 1 76 LYS n 1 77 GLU n 1 78 VAL n 1 79 LYS n 1 80 GLY n 1 81 LYS n 1 82 THR n 1 83 HIS n 1 84 THR n 1 85 TYR n 1 86 TYR n 1 87 GLN n 1 88 VAL n 1 89 LEU n 1 90 ILE n 1 91 ASP n 1 92 ALA n 1 93 ARG n 1 94 ASP n 1 95 CYS n 1 96 PRO n 1 97 HIS n 1 98 ILE n 1 99 SER n 1 100 GLN n 1 101 ARG n 1 102 SER n 1 103 GLN n 1 104 THR n 1 105 GLU n 1 106 ALA n 1 107 VAL n 1 108 THR n 1 109 PHE n 1 110 LEU n 1 111 ALA n 1 112 ASN n 1 113 HIS n 1 114 ASP n 1 115 ASP n 1 116 SER n 1 117 ARG n 1 118 ALA n 1 119 LEU n 1 120 TYR n 1 121 ALA n 1 122 ILE n 1 123 PRO n 1 124 GLY n 1 125 LEU n 1 126 ASP n 1 127 TYR n 1 128 VAL n 1 129 SER n 1 130 HIS n 1 131 GLU n 1 132 ASP n 1 133 ILE n 1 134 LEU n 1 135 PRO n 1 136 TYR n 1 137 THR n 1 138 SER n 1 139 THR n 1 140 ASP n 1 141 GLN n 1 142 VAL n 1 143 PRO n 1 144 ILE n 1 145 GLN n 1 146 HIS n 1 147 GLU n 1 148 LEU n 1 149 PHE n 1 150 GLU n 1 151 ARG n 1 152 PHE n 1 153 LEU n 1 154 LEU n 1 155 TYR n 1 156 ASP n 1 157 GLN n 1 158 THR n 1 159 LYS n 1 160 ALA n 1 161 PRO n 1 162 PRO n 1 163 PHE n 1 164 VAL n 1 165 ALA n 1 166 ARG n 1 167 GLU n 1 168 THR n 1 169 LEU n 1 170 ARG n 1 171 ALA n 1 172 TRP n 1 173 GLN n 1 174 GLU n 1 175 LYS n 1 176 ASN n 1 177 HIS n 1 178 PRO n 1 179 TRP n 1 180 LEU n 1 181 GLU n 1 182 LEU n 1 183 SER n 1 184 ASP n 1 185 VAL n 1 186 HIS n 1 187 ARG n 1 188 GLU n 1 189 THR n 1 190 THR n 1 191 GLU n 1 192 ASN n 1 193 ILE n 1 194 ARG n 1 195 VAL n 1 196 THR n 1 197 VAL n 1 198 ILE n 1 199 PRO n 1 200 PHE n 1 201 TYR n 1 202 MET n 1 203 GLY n 1 204 MET n 1 205 ARG n 1 206 GLU n 1 207 ALA n 1 208 GLN n 1 209 ASN n 1 210 SER n 1 211 HIS n 1 212 VAL n 1 213 TYR n 1 214 TRP n 1 215 TRP n 1 216 ARG n 1 217 TYR n 1 218 CYS n 1 219 ILE n 1 220 ARG n 1 221 LEU n 1 222 GLU n 1 223 ASN n 1 224 LEU n 1 225 ASP n 1 226 SER n 1 227 ASP n 1 228 VAL n 1 229 VAL n 1 230 GLN n 1 231 LEU n 1 232 ARG n 1 233 GLU n 1 234 ARG n 1 235 HIS n 1 236 TRP n 1 237 ARG n 1 238 ILE n 1 239 PHE n 1 240 SER n 1 241 LEU n 1 242 SER n 1 243 GLY n 1 244 THR n 1 245 LEU n 1 246 GLU n 1 247 THR n 1 248 VAL n 1 249 ARG n 1 250 GLY n 1 251 ARG n 1 252 GLY n 1 253 VAL n 1 254 VAL n 1 255 GLY n 1 256 ARG n 1 257 GLU n 1 258 PRO n 1 259 VAL n 1 260 LEU n 1 261 SER n 1 262 LYS n 1 263 GLU n 1 264 GLN n 1 265 PRO n 1 266 ALA n 1 267 PHE n 1 268 GLN n 1 269 TYR n 1 270 SER n 1 271 SER n 1 272 HIS n 1 273 VAL n 1 274 SER n 1 275 LEU n 1 276 GLN n 1 277 ALA n 1 278 SER n 1 279 SER n 1 280 GLY n 1 281 HIS n 1 282 MET n 1 283 TRP n 1 284 GLY n 1 285 THR n 1 286 PHE n 1 287 ARG n 1 288 PHE n 1 289 GLU n 1 290 ARG n 1 291 PRO n 1 292 ASP n 1 293 GLY n 1 294 SER n 1 295 HIS n 1 296 PHE n 1 297 ASP n 1 298 VAL n 1 299 ARG n 1 300 ILE n 1 301 PRO n 1 302 PRO n 1 303 PHE n 1 304 SER n 1 305 LEU n 1 306 GLU n 1 307 SER n 1 308 ASN n 1 309 LYS n 1 310 ASP n 1 311 GLU n 1 312 LYS n 1 313 THR n 1 314 PRO n 1 315 PRO n 1 316 SER n 1 317 GLY n 1 318 LEU n 1 319 HIS n 1 320 TRP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 320 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'POLDIP2, PDIP38, POLD4, HSPC017' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant 'R3 pRARE2' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pNH-TrxT _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 49 49 SER SER A . n A 1 2 MET 2 50 50 MET MET A . n A 1 3 LEU 3 51 51 LEU LEU A . n A 1 4 SER 4 52 52 SER SER A . n A 1 5 SER 5 53 53 SER SER A . n A 1 6 ARG 6 54 54 ARG ARG A . n A 1 7 ASN 7 55 55 ASN ASN A . n A 1 8 ARG 8 56 56 ARG ARG A . n A 1 9 PRO 9 57 ? ? ? A . n A 1 10 GLU 10 58 ? ? ? A . n A 1 11 GLY 11 59 ? ? ? A . n A 1 12 LYS 12 60 ? ? ? A . n A 1 13 VAL 13 61 ? ? ? A . n A 1 14 LEU 14 62 ? ? ? A . n A 1 15 GLU 15 63 ? ? ? A . n A 1 16 THR 16 64 ? ? ? A . n A 1 17 VAL 17 65 65 VAL VAL A . n A 1 18 GLY 18 66 66 GLY GLY A . n A 1 19 VAL 19 67 67 VAL VAL A . n A 1 20 PHE 20 68 68 PHE PHE A . n A 1 21 GLU 21 69 69 GLU GLU A . n A 1 22 VAL 22 70 70 VAL VAL A . n A 1 23 PRO 23 71 71 PRO PRO A . n A 1 24 LYS 24 72 72 LYS LYS A . n A 1 25 GLN 25 73 73 GLN GLN A . n A 1 26 ASN 26 74 74 ASN ASN A . n A 1 27 GLY 27 75 75 GLY GLY A . n A 1 28 LYS 28 76 76 LYS LYS A . n A 1 29 TYR 29 77 77 TYR TYR A . n A 1 30 GLU 30 78 78 GLU GLU A . n A 1 31 THR 31 79 79 THR THR A . n A 1 32 GLY 32 80 80 GLY GLY A . n A 1 33 GLN 33 81 81 GLN GLN A . n A 1 34 LEU 34 82 82 LEU LEU A . n A 1 35 PHE 35 83 83 PHE PHE A . n A 1 36 LEU 36 84 84 LEU LEU A . n A 1 37 HIS 37 85 85 HIS HIS A . n A 1 38 SER 38 86 86 SER SER A . n A 1 39 ILE 39 87 87 ILE ILE A . n A 1 40 PHE 40 88 88 PHE PHE A . n A 1 41 GLY 41 89 89 GLY GLY A . n A 1 42 TYR 42 90 90 TYR TYR A . n A 1 43 ARG 43 91 91 ARG ARG A . n A 1 44 GLY 44 92 92 GLY GLY A . n A 1 45 VAL 45 93 93 VAL VAL A . n A 1 46 VAL 46 94 94 VAL VAL A . n A 1 47 LEU 47 95 95 LEU LEU A . n A 1 48 PHE 48 96 96 PHE PHE A . n A 1 49 PRO 49 97 97 PRO PRO A . n A 1 50 TRP 50 98 98 TRP TRP A . n A 1 51 GLN 51 99 99 GLN GLN A . n A 1 52 ALA 52 100 100 ALA ALA A . n A 1 53 ARG 53 101 101 ARG ARG A . n A 1 54 LEU 54 102 102 LEU LEU A . n A 1 55 TYR 55 103 103 TYR TYR A . n A 1 56 ASP 56 104 104 ASP ASP A . n A 1 57 ARG 57 105 105 ARG ARG A . n A 1 58 ASP 58 106 106 ASP ASP A . n A 1 59 VAL 59 107 107 VAL VAL A . n A 1 60 ALA 60 108 108 ALA ALA A . n A 1 61 SER 61 109 ? ? ? A . n A 1 62 ALA 62 110 ? ? ? A . n A 1 63 ALA 63 111 ? ? ? A . n A 1 64 PRO 64 112 ? ? ? A . n A 1 65 GLU 65 113 ? ? ? A . n A 1 66 LYS 66 114 ? ? ? A . n A 1 67 ALA 67 115 ? ? ? A . n A 1 68 GLU 68 116 ? ? ? A . n A 1 69 ASN 69 117 ? ? ? A . n A 1 70 PRO 70 118 ? ? ? A . n A 1 71 ALA 71 119 ? ? ? A . n A 1 72 GLY 72 120 ? ? ? A . n A 1 73 HIS 73 121 ? ? ? A . n A 1 74 GLY 74 122 ? ? ? A . n A 1 75 SER 75 123 ? ? ? A . n A 1 76 LYS 76 124 ? ? ? A . n A 1 77 GLU 77 125 ? ? ? A . n A 1 78 VAL 78 126 126 VAL VAL A . n A 1 79 LYS 79 127 127 LYS LYS A . n A 1 80 GLY 80 128 128 GLY GLY A . n A 1 81 LYS 81 129 129 LYS LYS A . n A 1 82 THR 82 130 130 THR THR A . n A 1 83 HIS 83 131 131 HIS HIS A . n A 1 84 THR 84 132 132 THR THR A . n A 1 85 TYR 85 133 133 TYR TYR A . n A 1 86 TYR 86 134 134 TYR TYR A . n A 1 87 GLN 87 135 135 GLN GLN A . n A 1 88 VAL 88 136 136 VAL VAL A . n A 1 89 LEU 89 137 137 LEU LEU A . n A 1 90 ILE 90 138 138 ILE ILE A . n A 1 91 ASP 91 139 139 ASP ASP A . n A 1 92 ALA 92 140 140 ALA ALA A . n A 1 93 ARG 93 141 141 ARG ARG A . n A 1 94 ASP 94 142 142 ASP ASP A . n A 1 95 CYS 95 143 143 CYS CYS A . n A 1 96 PRO 96 144 144 PRO PRO A . n A 1 97 HIS 97 145 ? ? ? A . n A 1 98 ILE 98 146 ? ? ? A . n A 1 99 SER 99 147 ? ? ? A . n A 1 100 GLN 100 148 ? ? ? A . n A 1 101 ARG 101 149 ? ? ? A . n A 1 102 SER 102 150 ? ? ? A . n A 1 103 GLN 103 151 ? ? ? A . n A 1 104 THR 104 152 ? ? ? A . n A 1 105 GLU 105 153 ? ? ? A . n A 1 106 ALA 106 154 ? ? ? A . n A 1 107 VAL 107 155 ? ? ? A . n A 1 108 THR 108 156 ? ? ? A . n A 1 109 PHE 109 157 ? ? ? A . n A 1 110 LEU 110 158 ? ? ? A . n A 1 111 ALA 111 159 ? ? ? A . n A 1 112 ASN 112 160 ? ? ? A . n A 1 113 HIS 113 161 ? ? ? A . n A 1 114 ASP 114 162 ? ? ? A . n A 1 115 ASP 115 163 ? ? ? A . n A 1 116 SER 116 164 ? ? ? A . n A 1 117 ARG 117 165 ? ? ? A . n A 1 118 ALA 118 166 ? ? ? A . n A 1 119 LEU 119 167 ? ? ? A . n A 1 120 TYR 120 168 168 TYR TYR A . n A 1 121 ALA 121 169 169 ALA ALA A . n A 1 122 ILE 122 170 170 ILE ILE A . n A 1 123 PRO 123 171 171 PRO PRO A . n A 1 124 GLY 124 172 172 GLY GLY A . n A 1 125 LEU 125 173 173 LEU LEU A . n A 1 126 ASP 126 174 174 ASP ASP A . n A 1 127 TYR 127 175 175 TYR TYR A . n A 1 128 VAL 128 176 176 VAL VAL A . n A 1 129 SER 129 177 177 SER SER A . n A 1 130 HIS 130 178 178 HIS HIS A . n A 1 131 GLU 131 179 179 GLU GLU A . n A 1 132 ASP 132 180 180 ASP ASP A . n A 1 133 ILE 133 181 181 ILE ILE A . n A 1 134 LEU 134 182 182 LEU LEU A . n A 1 135 PRO 135 183 183 PRO PRO A . n A 1 136 TYR 136 184 184 TYR TYR A . n A 1 137 THR 137 185 185 THR THR A . n A 1 138 SER 138 186 186 SER SER A . n A 1 139 THR 139 187 187 THR THR A . n A 1 140 ASP 140 188 188 ASP ASP A . n A 1 141 GLN 141 189 189 GLN GLN A . n A 1 142 VAL 142 190 190 VAL VAL A . n A 1 143 PRO 143 191 191 PRO PRO A . n A 1 144 ILE 144 192 192 ILE ILE A . n A 1 145 GLN 145 193 193 GLN GLN A . n A 1 146 HIS 146 194 194 HIS HIS A . n A 1 147 GLU 147 195 195 GLU GLU A . n A 1 148 LEU 148 196 196 LEU LEU A . n A 1 149 PHE 149 197 197 PHE PHE A . n A 1 150 GLU 150 198 198 GLU GLU A . n A 1 151 ARG 151 199 199 ARG ARG A . n A 1 152 PHE 152 200 200 PHE PHE A . n A 1 153 LEU 153 201 201 LEU LEU A . n A 1 154 LEU 154 202 202 LEU LEU A . n A 1 155 TYR 155 203 203 TYR TYR A . n A 1 156 ASP 156 204 204 ASP ASP A . n A 1 157 GLN 157 205 205 GLN GLN A . n A 1 158 THR 158 206 206 THR THR A . n A 1 159 LYS 159 207 207 LYS LYS A . n A 1 160 ALA 160 208 208 ALA ALA A . n A 1 161 PRO 161 209 209 PRO PRO A . n A 1 162 PRO 162 210 210 PRO PRO A . n A 1 163 PHE 163 211 211 PHE PHE A . n A 1 164 VAL 164 212 212 VAL VAL A . n A 1 165 ALA 165 213 213 ALA ALA A . n A 1 166 ARG 166 214 214 ARG ARG A . n A 1 167 GLU 167 215 215 GLU GLU A . n A 1 168 THR 168 216 216 THR THR A . n A 1 169 LEU 169 217 217 LEU LEU A . n A 1 170 ARG 170 218 218 ARG ARG A . n A 1 171 ALA 171 219 219 ALA ALA A . n A 1 172 TRP 172 220 220 TRP TRP A . n A 1 173 GLN 173 221 221 GLN GLN A . n A 1 174 GLU 174 222 222 GLU GLU A . n A 1 175 LYS 175 223 223 LYS LYS A . n A 1 176 ASN 176 224 224 ASN ASN A . n A 1 177 HIS 177 225 225 HIS HIS A . n A 1 178 PRO 178 226 226 PRO PRO A . n A 1 179 TRP 179 227 227 TRP TRP A . n A 1 180 LEU 180 228 228 LEU LEU A . n A 1 181 GLU 181 229 229 GLU GLU A . n A 1 182 LEU 182 230 230 LEU LEU A . n A 1 183 SER 183 231 231 SER SER A . n A 1 184 ASP 184 232 232 ASP ASP A . n A 1 185 VAL 185 233 233 VAL VAL A . n A 1 186 HIS 186 234 234 HIS HIS A . n A 1 187 ARG 187 235 235 ARG ARG A . n A 1 188 GLU 188 236 236 GLU GLU A . n A 1 189 THR 189 237 237 THR THR A . n A 1 190 THR 190 238 238 THR THR A . n A 1 191 GLU 191 239 239 GLU GLU A . n A 1 192 ASN 192 240 240 ASN ASN A . n A 1 193 ILE 193 241 241 ILE ILE A . n A 1 194 ARG 194 242 242 ARG ARG A . n A 1 195 VAL 195 243 243 VAL VAL A . n A 1 196 THR 196 244 244 THR THR A . n A 1 197 VAL 197 245 245 VAL VAL A . n A 1 198 ILE 198 246 246 ILE ILE A . n A 1 199 PRO 199 247 247 PRO PRO A . n A 1 200 PHE 200 248 248 PHE PHE A . n A 1 201 TYR 201 249 249 TYR TYR A . n A 1 202 MET 202 250 250 MET MET A . n A 1 203 GLY 203 251 251 GLY GLY A . n A 1 204 MET 204 252 252 MET MET A . n A 1 205 ARG 205 253 253 ARG ARG A . n A 1 206 GLU 206 254 ? ? ? A . n A 1 207 ALA 207 255 ? ? ? A . n A 1 208 GLN 208 256 ? ? ? A . n A 1 209 ASN 209 257 ? ? ? A . n A 1 210 SER 210 258 258 SER SER A . n A 1 211 HIS 211 259 259 HIS HIS A . n A 1 212 VAL 212 260 260 VAL VAL A . n A 1 213 TYR 213 261 261 TYR TYR A . n A 1 214 TRP 214 262 262 TRP TRP A . n A 1 215 TRP 215 263 263 TRP TRP A . n A 1 216 ARG 216 264 264 ARG ARG A . n A 1 217 TYR 217 265 265 TYR TYR A . n A 1 218 CYS 218 266 266 CYS CYS A . n A 1 219 ILE 219 267 267 ILE ILE A . n A 1 220 ARG 220 268 268 ARG ARG A . n A 1 221 LEU 221 269 269 LEU LEU A . n A 1 222 GLU 222 270 270 GLU GLU A . n A 1 223 ASN 223 271 271 ASN ASN A . n A 1 224 LEU 224 272 272 LEU LEU A . n A 1 225 ASP 225 273 273 ASP ASP A . n A 1 226 SER 226 274 274 SER SER A . n A 1 227 ASP 227 275 275 ASP ASP A . n A 1 228 VAL 228 276 276 VAL VAL A . n A 1 229 VAL 229 277 277 VAL VAL A . n A 1 230 GLN 230 278 278 GLN GLN A . n A 1 231 LEU 231 279 279 LEU LEU A . n A 1 232 ARG 232 280 280 ARG ARG A . n A 1 233 GLU 233 281 281 GLU GLU A . n A 1 234 ARG 234 282 282 ARG ARG A . n A 1 235 HIS 235 283 283 HIS HIS A . n A 1 236 TRP 236 284 284 TRP TRP A . n A 1 237 ARG 237 285 285 ARG ARG A . n A 1 238 ILE 238 286 286 ILE ILE A . n A 1 239 PHE 239 287 287 PHE PHE A . n A 1 240 SER 240 288 288 SER SER A . n A 1 241 LEU 241 289 289 LEU LEU A . n A 1 242 SER 242 290 290 SER SER A . n A 1 243 GLY 243 291 291 GLY GLY A . n A 1 244 THR 244 292 292 THR THR A . n A 1 245 LEU 245 293 293 LEU LEU A . n A 1 246 GLU 246 294 294 GLU GLU A . n A 1 247 THR 247 295 295 THR THR A . n A 1 248 VAL 248 296 296 VAL VAL A . n A 1 249 ARG 249 297 297 ARG ARG A . n A 1 250 GLY 250 298 298 GLY GLY A . n A 1 251 ARG 251 299 299 ARG ARG A . n A 1 252 GLY 252 300 300 GLY GLY A . n A 1 253 VAL 253 301 301 VAL VAL A . n A 1 254 VAL 254 302 302 VAL VAL A . n A 1 255 GLY 255 303 303 GLY GLY A . n A 1 256 ARG 256 304 304 ARG ARG A . n A 1 257 GLU 257 305 305 GLU GLU A . n A 1 258 PRO 258 306 306 PRO PRO A . n A 1 259 VAL 259 307 307 VAL VAL A . n A 1 260 LEU 260 308 308 LEU LEU A . n A 1 261 SER 261 309 309 SER SER A . n A 1 262 LYS 262 310 310 LYS LYS A . n A 1 263 GLU 263 311 311 GLU GLU A . n A 1 264 GLN 264 312 312 GLN GLN A . n A 1 265 PRO 265 313 313 PRO PRO A . n A 1 266 ALA 266 314 314 ALA ALA A . n A 1 267 PHE 267 315 315 PHE PHE A . n A 1 268 GLN 268 316 316 GLN GLN A . n A 1 269 TYR 269 317 317 TYR TYR A . n A 1 270 SER 270 318 318 SER SER A . n A 1 271 SER 271 319 319 SER SER A . n A 1 272 HIS 272 320 320 HIS HIS A . n A 1 273 VAL 273 321 321 VAL VAL A . n A 1 274 SER 274 322 322 SER SER A . n A 1 275 LEU 275 323 323 LEU LEU A . n A 1 276 GLN 276 324 324 GLN GLN A . n A 1 277 ALA 277 325 325 ALA ALA A . n A 1 278 SER 278 326 326 SER SER A . n A 1 279 SER 279 327 327 SER SER A . n A 1 280 GLY 280 328 328 GLY GLY A . n A 1 281 HIS 281 329 329 HIS HIS A . n A 1 282 MET 282 330 330 MET MET A . n A 1 283 TRP 283 331 331 TRP TRP A . n A 1 284 GLY 284 332 332 GLY GLY A . n A 1 285 THR 285 333 333 THR THR A . n A 1 286 PHE 286 334 334 PHE PHE A . n A 1 287 ARG 287 335 335 ARG ARG A . n A 1 288 PHE 288 336 336 PHE PHE A . n A 1 289 GLU 289 337 337 GLU GLU A . n A 1 290 ARG 290 338 338 ARG ARG A . n A 1 291 PRO 291 339 339 PRO PRO A . n A 1 292 ASP 292 340 340 ASP ASP A . n A 1 293 GLY 293 341 341 GLY GLY A . n A 1 294 SER 294 342 342 SER SER A . n A 1 295 HIS 295 343 343 HIS HIS A . n A 1 296 PHE 296 344 344 PHE PHE A . n A 1 297 ASP 297 345 345 ASP ASP A . n A 1 298 VAL 298 346 346 VAL VAL A . n A 1 299 ARG 299 347 347 ARG ARG A . n A 1 300 ILE 300 348 348 ILE ILE A . n A 1 301 PRO 301 349 349 PRO PRO A . n A 1 302 PRO 302 350 350 PRO PRO A . n A 1 303 PHE 303 351 351 PHE PHE A . n A 1 304 SER 304 352 352 SER SER A . n A 1 305 LEU 305 353 353 LEU LEU A . n A 1 306 GLU 306 354 354 GLU GLU A . n A 1 307 SER 307 355 355 SER SER A . n A 1 308 ASN 308 356 356 ASN ASN A . n A 1 309 LYS 309 357 357 LYS LYS A . n A 1 310 ASP 310 358 358 ASP ASP A . n A 1 311 GLU 311 359 ? ? ? A . n A 1 312 LYS 312 360 ? ? ? A . n A 1 313 THR 313 361 ? ? ? A . n A 1 314 PRO 314 362 ? ? ? A . n A 1 315 PRO 315 363 ? ? ? A . n A 1 316 SER 316 364 ? ? ? A . n A 1 317 GLY 317 365 ? ? ? A . n A 1 318 LEU 318 366 ? ? ? A . n A 1 319 HIS 319 367 ? ? ? A . n A 1 320 TRP 320 368 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NA 1 401 1 NA NA A . C 3 HOH 1 501 6 HOH HOH A . C 3 HOH 2 502 13 HOH HOH A . C 3 HOH 3 503 5 HOH HOH A . C 3 HOH 4 504 8 HOH HOH A . C 3 HOH 5 505 2 HOH HOH A . C 3 HOH 6 506 12 HOH HOH A . C 3 HOH 7 507 10 HOH HOH A . C 3 HOH 8 508 4 HOH HOH A . C 3 HOH 9 509 15 HOH HOH A . C 3 HOH 10 510 3 HOH HOH A . C 3 HOH 11 511 25 HOH HOH A . C 3 HOH 12 512 17 HOH HOH A . C 3 HOH 13 513 20 HOH HOH A . C 3 HOH 14 514 26 HOH HOH A . C 3 HOH 15 515 22 HOH HOH A . C 3 HOH 16 516 7 HOH HOH A . C 3 HOH 17 517 14 HOH HOH A . C 3 HOH 18 518 23 HOH HOH A . C 3 HOH 19 519 24 HOH HOH A . C 3 HOH 20 520 18 HOH HOH A . C 3 HOH 21 521 19 HOH HOH A . C 3 HOH 22 522 11 HOH HOH A . C 3 HOH 23 523 9 HOH HOH A . C 3 HOH 24 524 16 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 56 ? CG ? A ARG 8 CG 2 1 Y 1 A ARG 56 ? CD ? A ARG 8 CD 3 1 Y 1 A ARG 56 ? NE ? A ARG 8 NE 4 1 Y 1 A ARG 56 ? CZ ? A ARG 8 CZ 5 1 Y 1 A ARG 56 ? NH1 ? A ARG 8 NH1 6 1 Y 1 A ARG 56 ? NH2 ? A ARG 8 NH2 7 1 Y 1 A ASN 74 ? CG ? A ASN 26 CG 8 1 Y 1 A ASN 74 ? OD1 ? A ASN 26 OD1 9 1 Y 1 A ASN 74 ? ND2 ? A ASN 26 ND2 10 1 Y 1 A GLN 189 ? CG ? A GLN 141 CG 11 1 Y 1 A GLN 189 ? CD ? A GLN 141 CD 12 1 Y 1 A GLN 189 ? OE1 ? A GLN 141 OE1 13 1 Y 1 A GLN 189 ? NE2 ? A GLN 141 NE2 14 1 Y 1 A ASP 358 ? CG ? A ASP 310 CG 15 1 Y 1 A ASP 358 ? OD1 ? A ASP 310 OD1 16 1 Y 1 A ASP 358 ? OD2 ? A ASP 310 OD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.22 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.2 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? PROTEUM2 ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 6Z9C _cell.details ? _cell.formula_units_Z ? _cell.length_a 120.138 _cell.length_a_esd ? _cell.length_b 120.138 _cell.length_b_esd ? _cell.length_c 49.516 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6Z9C _symmetry.cell_setting ? _symmetry.Int_Tables_number 171 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 62' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6Z9C _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.79 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.01 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2M Calcium acetate hydrate 0.1M Sodium cacodylate pH 6.5 40% (v/v) PEG 300 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 110 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'Microfocus Source' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'Bruker PHOTON II' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-02-22 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'MULTILAYER MIRRORS' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'SEALED TUBE' _diffrn_source.target ? _diffrn_source.type 'BRUKER IMUS MICROFOCUS' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 45.3 _reflns.entry_id 6Z9C _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.687 _reflns.d_resolution_low 104.042 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11561 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.100 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.147 _reflns.pdbx_netI_over_av_sigmaI 5.000 _reflns.pdbx_netI_over_sigmaI 13.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.159 _reflns.pdbx_Rpim_I_all 0.058 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.690 2.830 ? 0.400 6052 ? ? ? 1656 98.700 ? ? ? ? 2.049 ? ? ? ? ? ? ? ? 3.700 2.049 ? ? 0.700 2.397 1.216 ? 1 1 ? ? ? 2.830 3.000 ? 1.000 7015 ? ? ? 1590 99.700 ? ? ? ? 0.799 ? ? ? ? ? ? ? ? 4.400 0.799 ? ? 1.900 0.909 0.424 ? 2 1 ? ? ? 3.000 3.210 ? 1.700 8370 ? ? ? 1473 99.900 ? ? ? ? 0.460 ? ? ? ? ? ? ? ? 5.700 0.460 ? ? 3.700 0.506 0.208 ? 3 1 ? ? ? 3.210 3.470 ? 2.600 11909 ? ? ? 1410 100.000 ? ? ? ? 0.293 ? ? ? ? ? ? ? ? 8.400 0.293 ? ? 7.200 0.312 0.105 ? 4 1 ? ? ? 3.470 3.800 ? 4.300 11682 ? ? ? 1285 100.000 ? ? ? ? 0.180 ? ? ? ? ? ? ? ? 9.100 0.180 ? ? 11.700 0.191 0.062 ? 5 1 ? ? ? 3.800 4.250 ? 6.700 10634 ? ? ? 1159 100.000 ? ? ? ? 0.114 ? ? ? ? ? ? ? ? 9.200 0.114 ? ? 17.800 0.121 0.039 ? 6 1 ? ? ? 4.250 4.910 ? 10.700 9598 ? ? ? 1043 100.000 ? ? ? ? 0.070 ? ? ? ? ? ? ? ? 9.200 0.070 ? ? 28.600 0.074 0.024 ? 7 1 ? ? ? 4.910 6.010 ? 10.200 7942 ? ? ? 880 100.000 ? ? ? ? 0.073 ? ? ? ? ? ? ? ? 9.000 0.073 ? ? 27.400 0.077 0.025 ? 8 1 ? ? ? 6.010 8.500 ? 11.800 6227 ? ? ? 693 100.000 ? ? ? ? 0.064 ? ? ? ? ? ? ? ? 9.000 0.064 ? ? 31.400 0.068 0.022 ? 9 1 ? ? ? 8.500 23.869 ? 20.700 2998 ? ? ? 372 94.300 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? 8.100 0.033 ? ? 57.100 0.035 0.012 ? 10 1 ? ? ? # _refine.aniso_B[1][1] -0.2000 _refine.aniso_B[1][2] -0.1000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -0.2000 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.6600 _refine.B_iso_max 125.520 _refine.B_iso_mean 42.6020 _refine.B_iso_min 7.010 _refine.correlation_coeff_Fo_to_Fc 0.9190 _refine.correlation_coeff_Fo_to_Fc_free 0.8440 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6Z9C _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8000 _refine.ls_d_res_low 23.8800 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9711 _refine.ls_number_reflns_R_free 524 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6700 _refine.ls_percent_reflns_R_free 5.1000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2199 _refine.ls_R_factor_R_free 0.2881 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2163 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model '1VBV, 5HDW' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.9240 _refine.pdbx_overall_ESU_R_Free 0.3900 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 16.9460 _refine.overall_SU_ML 0.3130 _refine.overall_SU_R_Cruickshank_DPI 0.9236 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.8000 _refine_hist.d_res_low 23.8800 _refine_hist.number_atoms_solvent 24 _refine_hist.number_atoms_total 2155 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 258 _refine_hist.pdbx_B_iso_mean_ligand 29.38 _refine_hist.pdbx_B_iso_mean_solvent 24.40 _refine_hist.pdbx_number_atoms_protein 2130 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.013 2226 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.003 0.017 2015 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.608 1.649 3023 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.178 1.575 4647 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 9.060 5.000 261 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 30.173 19.857 140 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 22.487 15.000 362 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 22.133 15.000 24 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.062 0.200 270 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 2486 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 550 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.8000 _refine_ls_shell.d_res_low 2.8730 _refine_ls_shell.number_reflns_all 754 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 52 _refine_ls_shell.number_reflns_R_work 702 _refine_ls_shell.percent_reflns_obs 99.8700 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4260 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3900 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 6Z9C _struct.title 'Structure of human POLDIP2, a multifaceted adaptor protein in metabolism and genome stability' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6Z9C _struct_keywords.text 'POLDIP2 PDIP38 Mitochondria Nucleus Primpol DNA polymerase, REPLICATION' _struct_keywords.pdbx_keywords REPLICATION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PDIP2_HUMAN _struct_ref.pdbx_db_accession Q9Y2S7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LSSRNRPEGKVLETVGVFEVPKQNGKYETGQLFLHSIFGYRGVVLFPWQARLYDRDVASAAPEKAENPAGHGSKEVKGKT HTYYQVLIDARDCPHISQRSQTEAVTFLANHDDSRALYAIPGLDYVSHEDILPYTSTDQVPIQHELFERFLLYDQTKAPP FVARETLRAWQEKNHPWLELSDVHRETTENIRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFSLS GTLETVRGRGVVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEKTPPSGLHW ; _struct_ref.pdbx_align_begin 51 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6Z9C _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 320 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y2S7 _struct_ref_seq.db_align_beg 51 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 368 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 51 _struct_ref_seq.pdbx_auth_seq_align_end 368 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6Z9C SER A 1 ? UNP Q9Y2S7 ? ? 'expression tag' 49 1 1 6Z9C MET A 2 ? UNP Q9Y2S7 ? ? 'expression tag' 50 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 120 ? 1 MORE -8 ? 1 'SSA (A^2)' 13490 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Confirmed monomeric protein by size exclusion chromatography.' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 147 ? PHE A 152 ? GLU A 195 PHE A 200 1 ? 6 HELX_P HELX_P2 AA2 GLU A 167 ? LEU A 180 ? GLU A 215 LEU A 228 1 ? 14 HELX_P HELX_P3 AA3 GLU A 181 ? SER A 183 ? GLU A 229 SER A 231 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 30 OE1 ? ? ? 1_555 B NA . NA ? ? A GLU 78 A NA 401 1_555 ? ? ? ? ? ? ? 2.138 ? ? metalc2 metalc ? ? A ALA 160 O ? ? ? 1_555 B NA . NA ? ? A ALA 208 A NA 401 1_555 ? ? ? ? ? ? ? 1.962 ? ? metalc3 metalc ? ? B NA . NA ? ? ? 1_555 C HOH . O ? ? A NA 401 A HOH 519 1_555 ? ? ? ? ? ? ? 2.472 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 30 ? A GLU 78 ? 1_555 NA ? B NA . ? A NA 401 ? 1_555 O ? A ALA 160 ? A ALA 208 ? 1_555 98.8 ? 2 OE1 ? A GLU 30 ? A GLU 78 ? 1_555 NA ? B NA . ? A NA 401 ? 1_555 O ? C HOH . ? A HOH 519 ? 1_555 95.3 ? 3 O ? A ALA 160 ? A ALA 208 ? 1_555 NA ? B NA . ? A NA 401 ? 1_555 O ? C HOH . ? A HOH 519 ? 1_555 118.3 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 160 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 208 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 161 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 209 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -16.34 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 9 ? AA2 ? 8 ? AA3 ? 2 ? AA4 ? 3 ? AA5 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 2 ? LEU A 3 ? MET A 50 LEU A 51 AA1 2 ALA A 266 ? LEU A 275 ? ALA A 314 LEU A 323 AA1 3 TYR A 213 ? ASN A 223 ? TYR A 261 ASN A 271 AA1 4 ILE A 193 ? MET A 204 ? ILE A 241 MET A 252 AA1 5 VAL A 185 ? THR A 190 ? VAL A 233 THR A 238 AA1 6 ARG A 43 ? ASP A 56 ? ARG A 91 ASP A 104 AA1 7 LEU A 34 ? HIS A 37 ? LEU A 82 HIS A 85 AA1 8 ILE A 133 ? THR A 137 ? ILE A 181 THR A 185 AA1 9 VAL A 19 ? PHE A 20 ? VAL A 67 PHE A 68 AA2 1 MET A 2 ? LEU A 3 ? MET A 50 LEU A 51 AA2 2 ALA A 266 ? LEU A 275 ? ALA A 314 LEU A 323 AA2 3 TYR A 213 ? ASN A 223 ? TYR A 261 ASN A 271 AA2 4 ILE A 193 ? MET A 204 ? ILE A 241 MET A 252 AA2 5 VAL A 185 ? THR A 190 ? VAL A 233 THR A 238 AA2 6 ARG A 43 ? ASP A 56 ? ARG A 91 ASP A 104 AA2 7 LYS A 81 ? ILE A 90 ? LYS A 129 ILE A 138 AA2 8 LEU A 125 ? SER A 129 ? LEU A 173 SER A 177 AA3 1 LEU A 153 ? TYR A 155 ? LEU A 201 TYR A 203 AA3 2 PHE A 163 ? ALA A 165 ? PHE A 211 ALA A 213 AA4 1 LEU A 245 ? ARG A 251 ? LEU A 293 ARG A 299 AA4 2 VAL A 229 ? SER A 240 ? VAL A 277 SER A 288 AA4 3 VAL A 259 ? LEU A 260 ? VAL A 307 LEU A 308 AA5 1 LEU A 245 ? ARG A 251 ? LEU A 293 ARG A 299 AA5 2 VAL A 229 ? SER A 240 ? VAL A 277 SER A 288 AA5 3 GLY A 280 ? GLU A 289 ? GLY A 328 GLU A 337 AA5 4 HIS A 295 ? LEU A 305 ? HIS A 343 LEU A 353 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N MET A 2 ? N MET A 50 O GLN A 268 ? O GLN A 316 AA1 2 3 O PHE A 267 ? O PHE A 315 N LEU A 221 ? N LEU A 269 AA1 3 4 O GLU A 222 ? O GLU A 270 N ARG A 194 ? N ARG A 242 AA1 4 5 O VAL A 197 ? O VAL A 245 N HIS A 186 ? N HIS A 234 AA1 5 6 O VAL A 185 ? O VAL A 233 N TYR A 55 ? N TYR A 103 AA1 6 7 O GLY A 44 ? O GLY A 92 N PHE A 35 ? N PHE A 83 AA1 7 8 N LEU A 36 ? N LEU A 84 O LEU A 134 ? O LEU A 182 AA1 8 9 O THR A 137 ? O THR A 185 N VAL A 19 ? N VAL A 67 AA2 1 2 N MET A 2 ? N MET A 50 O GLN A 268 ? O GLN A 316 AA2 2 3 O PHE A 267 ? O PHE A 315 N LEU A 221 ? N LEU A 269 AA2 3 4 O GLU A 222 ? O GLU A 270 N ARG A 194 ? N ARG A 242 AA2 4 5 O VAL A 197 ? O VAL A 245 N HIS A 186 ? N HIS A 234 AA2 5 6 O VAL A 185 ? O VAL A 233 N TYR A 55 ? N TYR A 103 AA2 6 7 N TRP A 50 ? N TRP A 98 O TYR A 85 ? O TYR A 133 AA2 7 8 N TYR A 86 ? N TYR A 134 O VAL A 128 ? O VAL A 176 AA3 1 2 N LEU A 154 ? N LEU A 202 O VAL A 164 ? O VAL A 212 AA4 1 2 O VAL A 248 ? O VAL A 296 N TRP A 236 ? N TRP A 284 AA4 2 3 N VAL A 229 ? N VAL A 277 O LEU A 260 ? O LEU A 308 AA5 1 2 O VAL A 248 ? O VAL A 296 N TRP A 236 ? N TRP A 284 AA5 2 3 N ARG A 232 ? N ARG A 280 O ARG A 287 ? O ARG A 335 AA5 3 4 N GLY A 280 ? N GLY A 328 O LEU A 305 ? O LEU A 353 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NA _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'binding site for residue NA A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 30 ? GLU A 78 . ? 1_555 ? 2 AC1 4 ALA A 160 ? ALA A 208 . ? 1_555 ? 3 AC1 4 GLY A 255 ? GLY A 303 . ? 5_554 ? 4 AC1 4 HOH C . ? HOH A 519 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 50 ? ? -171.72 128.61 2 1 SER A 53 ? ? -137.57 -55.51 3 1 ASN A 55 ? ? -115.44 -92.95 4 1 ASP A 106 ? ? -90.84 47.47 5 1 ALA A 169 ? ? -109.18 78.00 6 1 THR A 187 ? ? -140.04 19.82 7 1 HIS A 194 ? ? -170.32 143.48 8 1 ASP A 204 ? ? -177.64 103.27 9 1 PRO A 210 ? ? -83.16 42.57 10 1 GLU A 215 ? ? 71.92 -27.24 11 1 ARG A 280 ? ? -122.38 -51.25 12 1 GLN A 324 ? ? -110.46 57.64 # _pdbx_phasing_MR.entry_id 6Z9C _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 2.690 _pdbx_phasing_MR.d_res_low_rotation 23.870 _pdbx_phasing_MR.d_res_high_translation 2.690 _pdbx_phasing_MR.d_res_low_translation 23.870 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # _pdbx_entry_details.entry_id 6Z9C _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PRO 57 ? A PRO 9 2 1 Y 1 A GLU 58 ? A GLU 10 3 1 Y 1 A GLY 59 ? A GLY 11 4 1 Y 1 A LYS 60 ? A LYS 12 5 1 Y 1 A VAL 61 ? A VAL 13 6 1 Y 1 A LEU 62 ? A LEU 14 7 1 Y 1 A GLU 63 ? A GLU 15 8 1 Y 1 A THR 64 ? A THR 16 9 1 Y 1 A SER 109 ? A SER 61 10 1 Y 1 A ALA 110 ? A ALA 62 11 1 Y 1 A ALA 111 ? A ALA 63 12 1 Y 1 A PRO 112 ? A PRO 64 13 1 Y 1 A GLU 113 ? A GLU 65 14 1 Y 1 A LYS 114 ? A LYS 66 15 1 Y 1 A ALA 115 ? A ALA 67 16 1 Y 1 A GLU 116 ? A GLU 68 17 1 Y 1 A ASN 117 ? A ASN 69 18 1 Y 1 A PRO 118 ? A PRO 70 19 1 Y 1 A ALA 119 ? A ALA 71 20 1 Y 1 A GLY 120 ? A GLY 72 21 1 Y 1 A HIS 121 ? A HIS 73 22 1 Y 1 A GLY 122 ? A GLY 74 23 1 Y 1 A SER 123 ? A SER 75 24 1 Y 1 A LYS 124 ? A LYS 76 25 1 Y 1 A GLU 125 ? A GLU 77 26 1 Y 1 A HIS 145 ? A HIS 97 27 1 Y 1 A ILE 146 ? A ILE 98 28 1 Y 1 A SER 147 ? A SER 99 29 1 Y 1 A GLN 148 ? A GLN 100 30 1 Y 1 A ARG 149 ? A ARG 101 31 1 Y 1 A SER 150 ? A SER 102 32 1 Y 1 A GLN 151 ? A GLN 103 33 1 Y 1 A THR 152 ? A THR 104 34 1 Y 1 A GLU 153 ? A GLU 105 35 1 Y 1 A ALA 154 ? A ALA 106 36 1 Y 1 A VAL 155 ? A VAL 107 37 1 Y 1 A THR 156 ? A THR 108 38 1 Y 1 A PHE 157 ? A PHE 109 39 1 Y 1 A LEU 158 ? A LEU 110 40 1 Y 1 A ALA 159 ? A ALA 111 41 1 Y 1 A ASN 160 ? A ASN 112 42 1 Y 1 A HIS 161 ? A HIS 113 43 1 Y 1 A ASP 162 ? A ASP 114 44 1 Y 1 A ASP 163 ? A ASP 115 45 1 Y 1 A SER 164 ? A SER 116 46 1 Y 1 A ARG 165 ? A ARG 117 47 1 Y 1 A ALA 166 ? A ALA 118 48 1 Y 1 A LEU 167 ? A LEU 119 49 1 Y 1 A GLU 254 ? A GLU 206 50 1 Y 1 A ALA 255 ? A ALA 207 51 1 Y 1 A GLN 256 ? A GLN 208 52 1 Y 1 A ASN 257 ? A ASN 209 53 1 Y 1 A GLU 359 ? A GLU 311 54 1 Y 1 A LYS 360 ? A LYS 312 55 1 Y 1 A THR 361 ? A THR 313 56 1 Y 1 A PRO 362 ? A PRO 314 57 1 Y 1 A PRO 363 ? A PRO 315 58 1 Y 1 A SER 364 ? A SER 316 59 1 Y 1 A GLY 365 ? A GLY 317 60 1 Y 1 A LEU 366 ? A LEU 318 61 1 Y 1 A HIS 367 ? A HIS 319 62 1 Y 1 A TRP 368 ? A TRP 320 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 NA NA NA N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_initial_refinement_model.id _pdbx_initial_refinement_model.entity_id_list _pdbx_initial_refinement_model.type _pdbx_initial_refinement_model.source_name _pdbx_initial_refinement_model.accession_code _pdbx_initial_refinement_model.details 1 ? 'experimental model' PDB 1VBV '1VBV, 5HDW' 2 ? 'experimental model' PDB 5HDW '1VBV, 5HDW' # _atom_sites.entry_id 6Z9C _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008324 _atom_sites.fract_transf_matrix[1][2] 0.004806 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009611 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020195 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N NA O S # loop_