data_6ZDY # _entry.id 6ZDY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6ZDY pdb_00006zdy 10.2210/pdb6zdy/pdb WWPDB D_1292109408 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-01-13 2 'Structure model' 1 1 2024-01-24 3 'Structure model' 1 2 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 3 'Structure model' pdbx_entry_details 6 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6ZDY _pdbx_database_status.recvd_initial_deposition_date 2020-06-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Yatime, L.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-3650-8012 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Struct.Biol. _citation.journal_id_ASTM JSBIEM _citation.journal_id_CSD 0803 _citation.journal_id_ISSN 1095-8657 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 213 _citation.language ? _citation.page_first 107689 _citation.page_last 107689 _citation.title 'Divalent cations influence the dimerization mode of murine S100A9 protein by modulating its disulfide bond pattern.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jsb.2020.107689 _citation.pdbx_database_id_PubMed 33359632 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Signor, L.' 1 ? primary 'Paris, T.' 2 ? primary 'Mas, C.' 3 ? primary 'Picard, A.' 4 ? primary 'Lutfalla, G.' 5 ? primary 'Boeri Erba, E.' 6 ? primary 'Yatime, L.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein S100-A9' 13200.057 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 5 water nat water 18.015 97 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Calgranulin-B,Leukocyte L1 complex heavy chain,Migration inhibitory factor-related protein 14,p14,S100 calcium-binding protein A9' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFE ECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFE ECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 'ZINC ION' ZN 4 'SULFATE ION' SO4 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 ALA n 1 5 ASN n 1 6 LYS n 1 7 ALA n 1 8 PRO n 1 9 SER n 1 10 GLN n 1 11 MET n 1 12 GLU n 1 13 ARG n 1 14 SER n 1 15 ILE n 1 16 THR n 1 17 THR n 1 18 ILE n 1 19 ILE n 1 20 ASP n 1 21 THR n 1 22 PHE n 1 23 HIS n 1 24 GLN n 1 25 TYR n 1 26 SER n 1 27 ARG n 1 28 LYS n 1 29 GLU n 1 30 GLY n 1 31 HIS n 1 32 PRO n 1 33 ASP n 1 34 THR n 1 35 LEU n 1 36 SER n 1 37 LYS n 1 38 LYS n 1 39 GLU n 1 40 PHE n 1 41 ARG n 1 42 GLN n 1 43 MET n 1 44 VAL n 1 45 GLU n 1 46 ALA n 1 47 GLN n 1 48 LEU n 1 49 ALA n 1 50 THR n 1 51 PHE n 1 52 MET n 1 53 LYS n 1 54 LYS n 1 55 GLU n 1 56 LYS n 1 57 ARG n 1 58 ASN n 1 59 GLU n 1 60 ALA n 1 61 LEU n 1 62 ILE n 1 63 ASN n 1 64 ASP n 1 65 ILE n 1 66 MET n 1 67 GLU n 1 68 ASP n 1 69 LEU n 1 70 ASP n 1 71 THR n 1 72 ASN n 1 73 GLN n 1 74 ASP n 1 75 ASN n 1 76 GLN n 1 77 LEU n 1 78 SER n 1 79 PHE n 1 80 GLU n 1 81 GLU n 1 82 CYS n 1 83 MET n 1 84 MET n 1 85 LEU n 1 86 MET n 1 87 ALA n 1 88 LYS n 1 89 LEU n 1 90 ILE n 1 91 PHE n 1 92 ALA n 1 93 CYS n 1 94 HIS n 1 95 GLU n 1 96 LYS n 1 97 LEU n 1 98 HIS n 1 99 GLU n 1 100 ASN n 1 101 ASN n 1 102 PRO n 1 103 ARG n 1 104 GLY n 1 105 HIS n 1 106 GLY n 1 107 HIS n 1 108 SER n 1 109 HIS n 1 110 GLY n 1 111 LYS n 1 112 GLY n 1 113 CYS n 1 114 GLY n 1 115 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 115 _entity_src_gen.gene_src_common_name 'House mouse' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'S100a9, Cagb, Mrp14' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pETM11 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 ALA 2 0 ? ? ? A . n A 1 3 MET 3 1 ? ? ? A . n A 1 4 ALA 4 2 ? ? ? A . n A 1 5 ASN 5 3 ? ? ? A . n A 1 6 LYS 6 4 ? ? ? A . n A 1 7 ALA 7 5 5 ALA ALA A . n A 1 8 PRO 8 6 6 PRO PRO A . n A 1 9 SER 9 7 7 SER SER A . n A 1 10 GLN 10 8 8 GLN GLN A . n A 1 11 MET 11 9 9 MET MET A . n A 1 12 GLU 12 10 10 GLU GLU A . n A 1 13 ARG 13 11 11 ARG ARG A . n A 1 14 SER 14 12 12 SER SER A . n A 1 15 ILE 15 13 13 ILE ILE A . n A 1 16 THR 16 14 14 THR THR A . n A 1 17 THR 17 15 15 THR THR A . n A 1 18 ILE 18 16 16 ILE ILE A . n A 1 19 ILE 19 17 17 ILE ILE A . n A 1 20 ASP 20 18 18 ASP ASP A . n A 1 21 THR 21 19 19 THR THR A . n A 1 22 PHE 22 20 20 PHE PHE A . n A 1 23 HIS 23 21 21 HIS HIS A . n A 1 24 GLN 24 22 22 GLN GLN A . n A 1 25 TYR 25 23 23 TYR TYR A . n A 1 26 SER 26 24 24 SER SER A . n A 1 27 ARG 27 25 25 ARG ARG A . n A 1 28 LYS 28 26 26 LYS LYS A . n A 1 29 GLU 29 27 27 GLU GLU A . n A 1 30 GLY 30 28 28 GLY GLY A . n A 1 31 HIS 31 29 29 HIS HIS A . n A 1 32 PRO 32 30 30 PRO PRO A . n A 1 33 ASP 33 31 31 ASP ASP A . n A 1 34 THR 34 32 32 THR THR A . n A 1 35 LEU 35 33 33 LEU LEU A . n A 1 36 SER 36 34 34 SER SER A . n A 1 37 LYS 37 35 35 LYS LYS A . n A 1 38 LYS 38 36 36 LYS LYS A . n A 1 39 GLU 39 37 37 GLU GLU A . n A 1 40 PHE 40 38 38 PHE PHE A . n A 1 41 ARG 41 39 39 ARG ARG A . n A 1 42 GLN 42 40 40 GLN GLN A . n A 1 43 MET 43 41 41 MET MET A . n A 1 44 VAL 44 42 42 VAL VAL A . n A 1 45 GLU 45 43 43 GLU GLU A . n A 1 46 ALA 46 44 44 ALA ALA A . n A 1 47 GLN 47 45 45 GLN GLN A . n A 1 48 LEU 48 46 46 LEU LEU A . n A 1 49 ALA 49 47 47 ALA ALA A . n A 1 50 THR 50 48 48 THR THR A . n A 1 51 PHE 51 49 49 PHE PHE A . n A 1 52 MET 52 50 50 MET MET A . n A 1 53 LYS 53 51 51 LYS LYS A . n A 1 54 LYS 54 52 52 LYS LYS A . n A 1 55 GLU 55 53 53 GLU GLU A . n A 1 56 LYS 56 54 54 LYS LYS A . n A 1 57 ARG 57 55 55 ARG ARG A . n A 1 58 ASN 58 56 56 ASN ASN A . n A 1 59 GLU 59 57 57 GLU GLU A . n A 1 60 ALA 60 58 58 ALA ALA A . n A 1 61 LEU 61 59 59 LEU LEU A . n A 1 62 ILE 62 60 60 ILE ILE A . n A 1 63 ASN 63 61 61 ASN ASN A . n A 1 64 ASP 64 62 62 ASP ASP A . n A 1 65 ILE 65 63 63 ILE ILE A . n A 1 66 MET 66 64 64 MET MET A . n A 1 67 GLU 67 65 65 GLU GLU A . n A 1 68 ASP 68 66 66 ASP ASP A . n A 1 69 LEU 69 67 67 LEU LEU A . n A 1 70 ASP 70 68 68 ASP ASP A . n A 1 71 THR 71 69 69 THR THR A . n A 1 72 ASN 72 70 70 ASN ASN A . n A 1 73 GLN 73 71 71 GLN GLN A . n A 1 74 ASP 74 72 72 ASP ASP A . n A 1 75 ASN 75 73 73 ASN ASN A . n A 1 76 GLN 76 74 74 GLN GLN A . n A 1 77 LEU 77 75 75 LEU LEU A . n A 1 78 SER 78 76 76 SER SER A . n A 1 79 PHE 79 77 77 PHE PHE A . n A 1 80 GLU 80 78 78 GLU GLU A . n A 1 81 GLU 81 79 79 GLU GLU A . n A 1 82 CYS 82 80 80 CYS CYS A . n A 1 83 MET 83 81 81 MET MET A . n A 1 84 MET 84 82 82 MET MET A . n A 1 85 LEU 85 83 83 LEU LEU A . n A 1 86 MET 86 84 84 MET MET A . n A 1 87 ALA 87 85 85 ALA ALA A . n A 1 88 LYS 88 86 86 LYS LYS A . n A 1 89 LEU 89 87 87 LEU LEU A . n A 1 90 ILE 90 88 88 ILE ILE A . n A 1 91 PHE 91 89 89 PHE PHE A . n A 1 92 ALA 92 90 90 ALA ALA A . n A 1 93 CYS 93 91 91 CYS CYS A . n A 1 94 HIS 94 92 92 HIS HIS A . n A 1 95 GLU 95 93 93 GLU GLU A . n A 1 96 LYS 96 94 94 LYS LYS A . n A 1 97 LEU 97 95 95 LEU LEU A . n A 1 98 HIS 98 96 96 HIS HIS A . n A 1 99 GLU 99 97 97 GLU GLU A . n A 1 100 ASN 100 98 98 ASN ASN A . n A 1 101 ASN 101 99 99 ASN ASN A . n A 1 102 PRO 102 100 100 PRO PRO A . n A 1 103 ARG 103 101 101 ARG ARG A . n A 1 104 GLY 104 102 102 GLY GLY A . n A 1 105 HIS 105 103 103 HIS HIS A . n A 1 106 GLY 106 104 104 GLY GLY A . n A 1 107 HIS 107 105 105 HIS HIS A . n A 1 108 SER 108 106 106 SER SER A . n A 1 109 HIS 109 107 107 HIS HIS A . n A 1 110 GLY 110 108 108 GLY GLY A . n A 1 111 LYS 111 109 109 LYS LYS A . n A 1 112 GLY 112 110 110 GLY GLY A . n A 1 113 CYS 113 111 111 CYS CYS A . n A 1 114 GLY 114 112 112 GLY GLY A . n A 1 115 LYS 115 113 ? ? ? A . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 CA ? ? CA ? ? 'SUBJECT OF INVESTIGATION' ? 2 ZN ? ? ZN ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 201 1 CA CA A . C 2 CA 1 202 2 CA CA A . D 3 ZN 1 203 1 ZN ZN A . E 3 ZN 1 204 2 ZN ZN A . F 4 SO4 1 205 1 SO4 SO4 A . G 5 HOH 1 301 66 HOH HOH A . G 5 HOH 2 302 54 HOH HOH A . G 5 HOH 3 303 77 HOH HOH A . G 5 HOH 4 304 14 HOH HOH A . G 5 HOH 5 305 84 HOH HOH A . G 5 HOH 6 306 53 HOH HOH A . G 5 HOH 7 307 48 HOH HOH A . G 5 HOH 8 308 23 HOH HOH A . G 5 HOH 9 309 35 HOH HOH A . G 5 HOH 10 310 31 HOH HOH A . G 5 HOH 11 311 40 HOH HOH A . G 5 HOH 12 312 1 HOH HOH A . G 5 HOH 13 313 93 HOH HOH A . G 5 HOH 14 314 21 HOH HOH A . G 5 HOH 15 315 15 HOH HOH A . G 5 HOH 16 316 27 HOH HOH A . G 5 HOH 17 317 28 HOH HOH A . G 5 HOH 18 318 20 HOH HOH A . G 5 HOH 19 319 85 HOH HOH A . G 5 HOH 20 320 95 HOH HOH A . G 5 HOH 21 321 5 HOH HOH A . G 5 HOH 22 322 26 HOH HOH A . G 5 HOH 23 323 2 HOH HOH A . G 5 HOH 24 324 39 HOH HOH A . G 5 HOH 25 325 22 HOH HOH A . G 5 HOH 26 326 16 HOH HOH A . G 5 HOH 27 327 76 HOH HOH A . G 5 HOH 28 328 7 HOH HOH A . G 5 HOH 29 329 72 HOH HOH A . G 5 HOH 30 330 4 HOH HOH A . G 5 HOH 31 331 24 HOH HOH A . G 5 HOH 32 332 6 HOH HOH A . G 5 HOH 33 333 30 HOH HOH A . G 5 HOH 34 334 64 HOH HOH A . G 5 HOH 35 335 38 HOH HOH A . G 5 HOH 36 336 13 HOH HOH A . G 5 HOH 37 337 52 HOH HOH A . G 5 HOH 38 338 37 HOH HOH A . G 5 HOH 39 339 9 HOH HOH A . G 5 HOH 40 340 8 HOH HOH A . G 5 HOH 41 341 34 HOH HOH A . G 5 HOH 42 342 18 HOH HOH A . G 5 HOH 43 343 45 HOH HOH A . G 5 HOH 44 344 25 HOH HOH A . G 5 HOH 45 345 65 HOH HOH A . G 5 HOH 46 346 19 HOH HOH A . G 5 HOH 47 347 91 HOH HOH A . G 5 HOH 48 348 92 HOH HOH A . G 5 HOH 49 349 49 HOH HOH A . G 5 HOH 50 350 36 HOH HOH A . G 5 HOH 51 351 51 HOH HOH A . G 5 HOH 52 352 96 HOH HOH A . G 5 HOH 53 353 62 HOH HOH A . G 5 HOH 54 354 33 HOH HOH A . G 5 HOH 55 355 12 HOH HOH A . G 5 HOH 56 356 3 HOH HOH A . G 5 HOH 57 357 78 HOH HOH A . G 5 HOH 58 358 29 HOH HOH A . G 5 HOH 59 359 55 HOH HOH A . G 5 HOH 60 360 82 HOH HOH A . G 5 HOH 61 361 50 HOH HOH A . G 5 HOH 62 362 17 HOH HOH A . G 5 HOH 63 363 89 HOH HOH A . G 5 HOH 64 364 46 HOH HOH A . G 5 HOH 65 365 75 HOH HOH A . G 5 HOH 66 366 63 HOH HOH A . G 5 HOH 67 367 68 HOH HOH A . G 5 HOH 68 368 58 HOH HOH A . G 5 HOH 69 369 79 HOH HOH A . G 5 HOH 70 370 11 HOH HOH A . G 5 HOH 71 371 88 HOH HOH A . G 5 HOH 72 372 10 HOH HOH A . G 5 HOH 73 373 69 HOH HOH A . G 5 HOH 74 374 86 HOH HOH A . G 5 HOH 75 375 42 HOH HOH A . G 5 HOH 76 376 60 HOH HOH A . G 5 HOH 77 377 67 HOH HOH A . G 5 HOH 78 378 81 HOH HOH A . G 5 HOH 79 379 32 HOH HOH A . G 5 HOH 80 380 44 HOH HOH A . G 5 HOH 81 381 97 HOH HOH A . G 5 HOH 82 382 94 HOH HOH A . G 5 HOH 83 383 70 HOH HOH A . G 5 HOH 84 384 74 HOH HOH A . G 5 HOH 85 385 59 HOH HOH A . G 5 HOH 86 386 90 HOH HOH A . G 5 HOH 87 387 61 HOH HOH A . G 5 HOH 88 388 71 HOH HOH A . G 5 HOH 89 389 41 HOH HOH A . G 5 HOH 90 390 73 HOH HOH A . G 5 HOH 91 391 56 HOH HOH A . G 5 HOH 92 392 43 HOH HOH A . G 5 HOH 93 393 57 HOH HOH A . G 5 HOH 94 394 83 HOH HOH A . G 5 HOH 95 395 87 HOH HOH A . G 5 HOH 96 396 80 HOH HOH A . G 5 HOH 97 397 47 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? 'Wolfgang Kabsch' Wolfgang.Kabsch@mpimf-heidelberg.mpg.de ? ? ? ? ? http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/ ? XDS ? ? package . 1 ? 'data scaling' ? ? 'Wolfgang Kabsch' ? ? ? ? ? ? http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ? XSCALE ? ? package . 2 ? phasing ? ? 'Randy J. Read' cimr-phaser@lists.cam.ac.uk ? ? ? ? ? http://www-structmed.cimr.cam.ac.uk/phaser/ ? PHASER ? ? program . 3 ? refinement ? ? 'Paul D. Adams' PDAdams@lbl.gov ? ? ? ? C++ http://www.phenix-online.org/ ? PHENIX ? ? package 1.11.1_2575 4 ? 'data extraction' ? ? PDB deposit@deposit.rcsb.org 'Apr. 1, 2019' ? ? ? C++ http://sw-tools.pdb.org/apps/PDB_EXTRACT/ ? PDB_EXTRACT ? ? package 3.25 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 125.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6ZDY _cell.details ? _cell.formula_units_Z ? _cell.length_a 72.840 _cell.length_a_esd ? _cell.length_b 40.620 _cell.length_b_esd ? _cell.length_c 53.090 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6ZDY _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6ZDY _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.44 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.53 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M ammonium sulfate, 4 mM spermine tetrahydrochloride, 50 mM Bis-Tris, 45% MPD' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-12-10 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.27 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.27 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 22.550 _reflns.entry_id 6ZDY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.450 _reflns.d_resolution_low 43.489 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22267 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.355 _reflns.pdbx_Rmerge_I_obs 0.054 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.570 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.072 _reflns.pdbx_scaling_rejects 6 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.059 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 141507 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 1.450 1.510 ? 1.930 ? 13504 2594 ? 2406 92.800 ? ? ? ? 0.710 ? ? ? ? ? ? ? ? 5.613 ? ? ? ? 0.782 ? ? 1 1 0.904 ? ? 1.510 1.580 ? 3.340 ? 16386 2537 ? 2473 97.500 ? ? ? ? 0.462 ? ? ? ? ? ? ? ? 6.626 ? ? ? ? 0.502 ? ? 2 1 0.965 ? ? 1.580 1.670 ? 5.050 ? 16582 2695 ? 2636 97.800 ? ? ? ? 0.286 ? ? ? ? ? ? ? ? 6.291 ? ? ? ? 0.313 ? ? 3 1 0.984 ? ? 1.670 1.750 ? 7.180 ? 12748 1928 ? 1892 98.100 ? ? ? ? 0.208 ? ? ? ? ? ? ? ? 6.738 ? ? ? ? 0.226 ? ? 4 1 0.990 ? ? 1.750 1.840 ? 10.260 ? 11613 1800 ? 1773 98.500 ? ? ? ? 0.132 ? ? ? ? ? ? ? ? 6.550 ? ? ? ? 0.144 ? ? 5 1 0.996 ? ? 1.840 1.930 ? 12.180 ? 8964 1485 ? 1458 98.200 ? ? ? ? 0.105 ? ? ? ? ? ? ? ? 6.148 ? ? ? ? 0.115 ? ? 6 1 0.996 ? ? 1.930 2.200 ? 18.740 ? 20645 3148 ? 3111 98.800 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? 6.636 ? ? ? ? 0.080 ? ? 7 1 0.997 ? ? 2.200 2.500 ? 24.960 ? 12738 2063 ? 2034 98.600 ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 6.263 ? ? ? ? 0.063 ? ? 8 1 0.997 ? ? 2.500 3.000 ? 29.230 ? 12249 1900 ? 1878 98.800 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? 6.522 ? ? ? ? 0.055 ? ? 9 1 0.998 ? ? 3.000 3.500 ? 30.750 ? 5572 967 ? 949 98.100 ? ? ? ? 0.046 ? ? ? ? ? ? ? ? 5.871 ? ? ? ? 0.050 ? ? 10 1 0.998 ? ? 3.500 4.000 ? 34.530 ? 3628 542 ? 540 99.600 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 6.719 ? ? ? ? 0.044 ? ? 11 1 0.997 ? ? 4.000 5.000 ? 34.090 ? 3448 541 ? 529 97.800 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 6.518 ? ? ? ? 0.048 ? ? 12 1 0.997 ? ? 5.000 6.000 ? 31.460 ? 1413 257 ? 251 97.700 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 5.629 ? ? ? ? 0.053 ? ? 13 1 0.997 ? ? 6.000 8.000 ? 32.330 ? 1098 194 ? 186 95.900 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 5.903 ? ? ? ? 0.056 ? ? 14 1 0.998 ? ? 8.000 10.000 ? 35.000 ? 481 73 ? 73 100.000 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 6.589 ? ? ? ? 0.059 ? ? 15 1 0.998 ? ? 10.000 15.000 ? 33.180 ? 320 55 ? 53 96.400 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 6.038 ? ? ? ? 0.064 ? ? 16 1 0.994 ? ? 15.000 20.000 ? 31.660 ? 75 14 ? 14 100.000 ? ? ? ? 0.046 ? ? ? ? ? ? ? ? 5.357 ? ? ? ? 0.051 ? ? 17 1 0.999 ? ? 20.000 43.489 ? 26.260 ? 43 12 ? 11 91.700 ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 3.909 ? ? ? ? 0.071 ? ? 18 1 0.991 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 129.320 _refine.B_iso_mean 39.4492 _refine.B_iso_min 22.390 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6ZDY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.4500 _refine.ls_d_res_low 43.4890 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22210 _refine.ls_number_reflns_R_free 1095 _refine.ls_number_reflns_R_work 21115 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.8400 _refine.ls_percent_reflns_R_free 4.9300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1769 _refine.ls_R_factor_R_free 0.1995 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1757 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.390 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1IRJ _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.4000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.4500 _refine_hist.d_res_low 43.4890 _refine_hist.number_atoms_solvent 97 _refine_hist.number_atoms_total 974 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 108 _refine_hist.pdbx_B_iso_mean_ligand 26.54 _refine_hist.pdbx_B_iso_mean_solvent 46.94 _refine_hist.pdbx_number_atoms_protein 868 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 ? 888 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.720 ? 1187 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.065 ? 123 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 157 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 20.267 ? 347 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.4500 1.5160 . . 133 2500 93.0000 . . . 0.3437 0.0000 0.2925 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5160 1.5960 . . 124 2602 97.0000 . . . 0.2498 0.0000 0.2049 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5960 1.6959 . . 123 2626 98.0000 . . . 0.2121 0.0000 0.1767 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6959 1.8269 . . 144 2643 98.0000 . . . 0.2020 0.0000 0.1647 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8269 2.0107 . . 130 2654 99.0000 . . . 0.1938 0.0000 0.1583 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0107 2.3017 . . 140 2685 99.0000 . . . 0.1843 0.0000 0.1481 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3017 2.8998 . . 150 2665 99.0000 . . . 0.2108 0.0000 0.1814 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8998 43.4 . . 151 2740 99.0000 . . . 0.1905 0.0000 0.1786 . . . . . . . . . . . # _struct.entry_id 6ZDY _struct.title 'Crystal structure of WT murine S100A9 bound to calcium and zinc' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6ZDY _struct_keywords.text 'Calcium-binding protein, homodimer, metal binding protein' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code S10A9_MOUSE _struct_ref.pdbx_db_accession P31725 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEEC MMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6ZDY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 115 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P31725 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 113 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 113 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 6ZDY GLY A 1 ? UNP P31725 ? ? 'expression tag' -1 1 1 6ZDY ALA A 2 ? UNP P31725 ? ? 'expression tag' 0 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4110 ? 1 MORE -199 ? 1 'SSA (A^2)' 12380 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'mass spectrometry' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 -30.4511730059 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 43.4887820313 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 9 ? ARG A 27 ? SER A 7 ARG A 25 1 ? 19 HELX_P HELX_P2 AA2 SER A 36 ? LEU A 48 ? SER A 34 LEU A 46 1 ? 13 HELX_P HELX_P3 AA3 MET A 52 ? ARG A 57 ? MET A 50 ARG A 55 1 ? 6 HELX_P HELX_P4 AA4 ASN A 58 ? ASP A 70 ? ASN A 56 ASP A 68 1 ? 13 HELX_P HELX_P5 AA5 SER A 78 ? ASN A 101 ? SER A 76 ASN A 99 1 ? 24 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 93 SG ? ? ? 1_555 A CYS 113 SG ? ? A CYS 91 A CYS 111 1_555 ? ? ? ? ? ? ? 2.043 ? ? metalc1 metalc ? ? A HIS 23 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 21 A ZN 203 1_555 ? ? ? ? ? ? ? 1.917 ? ? metalc2 metalc ? ? A SER 26 O ? ? ? 1_555 B CA . CA ? ? A SER 24 A CA 201 1_555 ? ? ? ? ? ? ? 2.307 ? ? metalc3 metalc ? ? A GLU 29 O ? ? ? 1_555 B CA . CA ? ? A GLU 27 A CA 201 1_555 ? ? ? ? ? ? ? 2.250 ? ? metalc4 metalc ? ? A HIS 31 O ? ? ? 1_555 B CA . CA ? ? A HIS 29 A CA 201 1_555 ? ? ? ? ? ? ? 2.431 ? ? metalc5 metalc ? ? A ASP 33 OD1 ? ? ? 1_555 D ZN . ZN ? ? A ASP 31 A ZN 203 1_555 ? ? ? ? ? ? ? 1.888 ? ? metalc6 metalc ? ? A THR 34 O ? ? ? 1_555 B CA . CA ? ? A THR 32 A CA 201 1_555 ? ? ? ? ? ? ? 2.336 ? ? metalc7 metalc ? ? A GLU 39 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 37 A CA 201 1_555 ? ? ? ? ? ? ? 2.437 ? ? metalc8 metalc ? ? A GLU 39 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 37 A CA 201 1_555 ? ? ? ? ? ? ? 2.642 ? ? metalc9 metalc ? ? A GLU 67 OE2 ? ? ? 1_555 E ZN . ZN ? ? A GLU 65 A ZN 204 4_546 ? ? ? ? ? ? ? 1.899 ? ? metalc10 metalc ? ? A ASP 70 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 68 A CA 202 1_555 ? ? ? ? ? ? ? 2.337 ? ? metalc11 metalc ? ? A ASN 72 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 70 A CA 202 1_555 ? ? ? ? ? ? ? 2.352 ? ? metalc12 metalc ? ? A ASP 74 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 72 A CA 202 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc13 metalc ? ? A GLN 76 O ? ? ? 1_555 C CA . CA ? ? A GLN 74 A CA 202 1_555 ? ? ? ? ? ? ? 2.356 ? ? metalc14 metalc ? ? A GLU 81 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 79 A CA 202 1_555 ? ? ? ? ? ? ? 2.409 ? ? metalc15 metalc ? ? A GLU 81 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 79 A CA 202 1_555 ? ? ? ? ? ? ? 2.555 ? ? metalc16 metalc ? ? A HIS 94 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 92 A ZN 203 2_556 ? ? ? ? ? ? ? 1.993 ? ? metalc17 metalc ? ? A HIS 98 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 96 A ZN 203 2_556 ? ? ? ? ? ? ? 2.008 ? ? metalc18 metalc ? ? A HIS 105 ND1 ? ? ? 1_555 E ZN . ZN ? ? A HIS 103 A ZN 204 1_555 ? ? ? ? ? ? ? 2.079 ? ? metalc19 metalc ? ? A HIS 107 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 105 A ZN 204 1_555 ? ? ? ? ? ? ? 2.065 ? ? metalc20 metalc ? ? A HIS 109 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 107 A ZN 204 1_555 ? ? ? ? ? ? ? 2.039 ? ? metalc21 metalc ? ? B CA . CA ? ? ? 1_555 G HOH . O ? ? A CA 201 A HOH 355 1_555 ? ? ? ? ? ? ? 2.525 ? ? metalc22 metalc ? ? C CA . CA ? ? ? 1_555 G HOH . O ? ? A CA 202 A HOH 356 1_555 ? ? ? ? ? ? ? 2.428 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 23 ? A HIS 21 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OD1 ? A ASP 33 ? A ASP 31 ? 1_555 98.4 ? 2 NE2 ? A HIS 23 ? A HIS 21 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 NE2 ? A HIS 94 ? A HIS 92 ? 1_555 74.0 ? 3 OD1 ? A ASP 33 ? A ASP 31 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 NE2 ? A HIS 94 ? A HIS 92 ? 1_555 118.3 ? 4 NE2 ? A HIS 23 ? A HIS 21 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 NE2 ? A HIS 98 ? A HIS 96 ? 1_555 71.6 ? 5 OD1 ? A ASP 33 ? A ASP 31 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 NE2 ? A HIS 98 ? A HIS 96 ? 1_555 117.5 ? 6 NE2 ? A HIS 94 ? A HIS 92 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 NE2 ? A HIS 98 ? A HIS 96 ? 1_555 2.6 ? 7 O ? A SER 26 ? A SER 24 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A GLU 29 ? A GLU 27 ? 1_555 105.3 ? 8 O ? A SER 26 ? A SER 24 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A HIS 31 ? A HIS 29 ? 1_555 81.9 ? 9 O ? A GLU 29 ? A GLU 27 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A HIS 31 ? A HIS 29 ? 1_555 90.0 ? 10 O ? A SER 26 ? A SER 24 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A THR 34 ? A THR 32 ? 1_555 88.5 ? 11 O ? A GLU 29 ? A GLU 27 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A THR 34 ? A THR 32 ? 1_555 164.0 ? 12 O ? A HIS 31 ? A HIS 29 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A THR 34 ? A THR 32 ? 1_555 83.9 ? 13 O ? A SER 26 ? A SER 24 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 39 ? A GLU 37 ? 1_555 101.9 ? 14 O ? A GLU 29 ? A GLU 27 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 39 ? A GLU 37 ? 1_555 107.9 ? 15 O ? A HIS 31 ? A HIS 29 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 39 ? A GLU 37 ? 1_555 159.7 ? 16 O ? A THR 34 ? A THR 32 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 39 ? A GLU 37 ? 1_555 76.3 ? 17 O ? A SER 26 ? A SER 24 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 39 ? A GLU 37 ? 1_555 76.0 ? 18 O ? A GLU 29 ? A GLU 27 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 39 ? A GLU 37 ? 1_555 73.4 ? 19 O ? A HIS 31 ? A HIS 29 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 39 ? A GLU 37 ? 1_555 147.4 ? 20 O ? A THR 34 ? A THR 32 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 39 ? A GLU 37 ? 1_555 118.7 ? 21 OE1 ? A GLU 39 ? A GLU 37 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 39 ? A GLU 37 ? 1_555 51.1 ? 22 O ? A SER 26 ? A SER 24 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? G HOH . ? A HOH 355 ? 1_555 161.1 ? 23 O ? A GLU 29 ? A GLU 27 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? G HOH . ? A HOH 355 ? 1_555 87.7 ? 24 O ? A HIS 31 ? A HIS 29 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? G HOH . ? A HOH 355 ? 1_555 84.5 ? 25 O ? A THR 34 ? A THR 32 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? G HOH . ? A HOH 355 ? 1_555 77.1 ? 26 OE1 ? A GLU 39 ? A GLU 37 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? G HOH . ? A HOH 355 ? 1_555 86.6 ? 27 OE2 ? A GLU 39 ? A GLU 37 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? G HOH . ? A HOH 355 ? 1_555 121.5 ? 28 OE2 ? A GLU 67 ? A GLU 65 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 4_546 ND1 ? A HIS 105 ? A HIS 103 ? 1_555 66.3 ? 29 OE2 ? A GLU 67 ? A GLU 65 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 4_546 NE2 ? A HIS 107 ? A HIS 105 ? 1_555 65.7 ? 30 ND1 ? A HIS 105 ? A HIS 103 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 4_546 NE2 ? A HIS 107 ? A HIS 105 ? 1_555 4.3 ? 31 OE2 ? A GLU 67 ? A GLU 65 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 4_546 NE2 ? A HIS 109 ? A HIS 107 ? 1_555 64.3 ? 32 ND1 ? A HIS 105 ? A HIS 103 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 4_546 NE2 ? A HIS 109 ? A HIS 107 ? 1_555 4.0 ? 33 NE2 ? A HIS 107 ? A HIS 105 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 4_546 NE2 ? A HIS 109 ? A HIS 107 ? 1_555 1.6 ? 34 OD1 ? A ASP 70 ? A ASP 68 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASN 72 ? A ASN 70 ? 1_555 86.2 ? 35 OD1 ? A ASP 70 ? A ASP 68 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 74 ? A ASP 72 ? 1_555 82.3 ? 36 OD1 ? A ASN 72 ? A ASN 70 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 74 ? A ASP 72 ? 1_555 78.2 ? 37 OD1 ? A ASP 70 ? A ASP 68 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A GLN 76 ? A GLN 74 ? 1_555 85.4 ? 38 OD1 ? A ASN 72 ? A ASN 70 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A GLN 76 ? A GLN 74 ? 1_555 156.4 ? 39 OD1 ? A ASP 74 ? A ASP 72 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A GLN 76 ? A GLN 74 ? 1_555 78.9 ? 40 OD1 ? A ASP 70 ? A ASP 68 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 81 ? A GLU 79 ? 1_555 112.8 ? 41 OD1 ? A ASN 72 ? A ASN 70 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 81 ? A GLU 79 ? 1_555 124.8 ? 42 OD1 ? A ASP 74 ? A ASP 72 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 81 ? A GLU 79 ? 1_555 151.7 ? 43 O ? A GLN 76 ? A GLN 74 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 81 ? A GLU 79 ? 1_555 78.7 ? 44 OD1 ? A ASP 70 ? A ASP 68 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 81 ? A GLU 79 ? 1_555 97.0 ? 45 OD1 ? A ASN 72 ? A ASN 70 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 81 ? A GLU 79 ? 1_555 75.0 ? 46 OD1 ? A ASP 74 ? A ASP 72 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 81 ? A GLU 79 ? 1_555 153.1 ? 47 O ? A GLN 76 ? A GLN 74 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 81 ? A GLU 79 ? 1_555 127.9 ? 48 OE1 ? A GLU 81 ? A GLU 79 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 81 ? A GLU 79 ? 1_555 52.4 ? 49 OD1 ? A ASP 70 ? A ASP 68 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? G HOH . ? A HOH 356 ? 1_555 164.4 ? 50 OD1 ? A ASN 72 ? A ASN 70 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? G HOH . ? A HOH 356 ? 1_555 87.2 ? 51 OD1 ? A ASP 74 ? A ASP 72 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? G HOH . ? A HOH 356 ? 1_555 82.5 ? 52 O ? A GLN 76 ? A GLN 74 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? G HOH . ? A HOH 356 ? 1_555 95.2 ? 53 OE1 ? A GLU 81 ? A GLU 79 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? G HOH . ? A HOH 356 ? 1_555 82.5 ? 54 OE2 ? A GLU 81 ? A GLU 79 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? G HOH . ? A HOH 356 ? 1_555 94.9 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 93 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 113 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 91 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 111 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 201 ? 6 'binding site for residue CA A 201' AC2 Software A CA 202 ? 6 'binding site for residue CA A 202' AC3 Software A ZN 203 ? 4 'binding site for residue ZN A 203' AC4 Software A ZN 204 ? 4 'binding site for residue ZN A 204' AC5 Software A SO4 205 ? 10 'binding site for residue SO4 A 205' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 SER A 26 ? SER A 24 . ? 1_555 ? 2 AC1 6 GLU A 29 ? GLU A 27 . ? 1_555 ? 3 AC1 6 HIS A 31 ? HIS A 29 . ? 1_555 ? 4 AC1 6 THR A 34 ? THR A 32 . ? 1_555 ? 5 AC1 6 GLU A 39 ? GLU A 37 . ? 1_555 ? 6 AC1 6 HOH G . ? HOH A 355 . ? 1_555 ? 7 AC2 6 ASP A 70 ? ASP A 68 . ? 1_555 ? 8 AC2 6 ASN A 72 ? ASN A 70 . ? 1_555 ? 9 AC2 6 ASP A 74 ? ASP A 72 . ? 1_555 ? 10 AC2 6 GLN A 76 ? GLN A 74 . ? 1_555 ? 11 AC2 6 GLU A 81 ? GLU A 79 . ? 1_555 ? 12 AC2 6 HOH G . ? HOH A 356 . ? 1_555 ? 13 AC3 4 HIS A 23 ? HIS A 21 . ? 1_555 ? 14 AC3 4 ASP A 33 ? ASP A 31 . ? 1_555 ? 15 AC3 4 HIS A 94 ? HIS A 92 . ? 2_556 ? 16 AC3 4 HIS A 98 ? HIS A 96 . ? 2_556 ? 17 AC4 4 GLU A 67 ? GLU A 65 . ? 4_556 ? 18 AC4 4 HIS A 105 ? HIS A 103 . ? 1_555 ? 19 AC4 4 HIS A 107 ? HIS A 105 . ? 1_555 ? 20 AC4 4 HIS A 109 ? HIS A 107 . ? 1_555 ? 21 AC5 10 LYS A 37 ? LYS A 35 . ? 2_555 ? 22 AC5 10 LYS A 37 ? LYS A 35 . ? 1_555 ? 23 AC5 10 ARG A 41 ? ARG A 39 . ? 2_555 ? 24 AC5 10 ARG A 41 ? ARG A 39 . ? 1_555 ? 25 AC5 10 ASN A 63 ? ASN A 61 . ? 1_555 ? 26 AC5 10 ASN A 63 ? ASN A 61 . ? 2_555 ? 27 AC5 10 HIS A 107 ? HIS A 105 . ? 3_444 ? 28 AC5 10 HIS A 107 ? HIS A 105 . ? 4_546 ? 29 AC5 10 HOH G . ? HOH A 340 . ? 1_555 ? 30 AC5 10 HOH G . ? HOH A 340 . ? 2_555 ? # _pdbx_entry_details.entry_id 6ZDY _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id MET _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 50 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -119.24 _pdbx_validate_torsion.psi 58.47 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A SO4 205 ? F SO4 . 2 1 A HOH 388 ? G HOH . 3 1 A HOH 395 ? G HOH . # _phasing.method MR # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 395 ? 6.19 . 2 1 O ? A HOH 396 ? 6.50 . 3 1 O ? A HOH 397 ? 6.99 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A ALA 0 ? A ALA 2 3 1 Y 1 A MET 1 ? A MET 3 4 1 Y 1 A ALA 2 ? A ALA 4 5 1 Y 1 A ASN 3 ? A ASN 5 6 1 Y 1 A LYS 4 ? A LYS 6 7 1 Y 1 A LYS 113 ? A LYS 115 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 SO4 S S N N 305 SO4 O1 O N N 306 SO4 O2 O N N 307 SO4 O3 O N N 308 SO4 O4 O N N 309 THR N N N N 310 THR CA C N S 311 THR C C N N 312 THR O O N N 313 THR CB C N R 314 THR OG1 O N N 315 THR CG2 C N N 316 THR OXT O N N 317 THR H H N N 318 THR H2 H N N 319 THR HA H N N 320 THR HB H N N 321 THR HG1 H N N 322 THR HG21 H N N 323 THR HG22 H N N 324 THR HG23 H N N 325 THR HXT H N N 326 TYR N N N N 327 TYR CA C N S 328 TYR C C N N 329 TYR O O N N 330 TYR CB C N N 331 TYR CG C Y N 332 TYR CD1 C Y N 333 TYR CD2 C Y N 334 TYR CE1 C Y N 335 TYR CE2 C Y N 336 TYR CZ C Y N 337 TYR OH O N N 338 TYR OXT O N N 339 TYR H H N N 340 TYR H2 H N N 341 TYR HA H N N 342 TYR HB2 H N N 343 TYR HB3 H N N 344 TYR HD1 H N N 345 TYR HD2 H N N 346 TYR HE1 H N N 347 TYR HE2 H N N 348 TYR HH H N N 349 TYR HXT H N N 350 VAL N N N N 351 VAL CA C N S 352 VAL C C N N 353 VAL O O N N 354 VAL CB C N N 355 VAL CG1 C N N 356 VAL CG2 C N N 357 VAL OXT O N N 358 VAL H H N N 359 VAL H2 H N N 360 VAL HA H N N 361 VAL HB H N N 362 VAL HG11 H N N 363 VAL HG12 H N N 364 VAL HG13 H N N 365 VAL HG21 H N N 366 VAL HG22 H N N 367 VAL HG23 H N N 368 VAL HXT H N N 369 ZN ZN ZN N N 370 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TYR N CA sing N N 310 TYR N H sing N N 311 TYR N H2 sing N N 312 TYR CA C sing N N 313 TYR CA CB sing N N 314 TYR CA HA sing N N 315 TYR C O doub N N 316 TYR C OXT sing N N 317 TYR CB CG sing N N 318 TYR CB HB2 sing N N 319 TYR CB HB3 sing N N 320 TYR CG CD1 doub Y N 321 TYR CG CD2 sing Y N 322 TYR CD1 CE1 sing Y N 323 TYR CD1 HD1 sing N N 324 TYR CD2 CE2 doub Y N 325 TYR CD2 HD2 sing N N 326 TYR CE1 CZ doub Y N 327 TYR CE1 HE1 sing N N 328 TYR CE2 CZ sing Y N 329 TYR CE2 HE2 sing N N 330 TYR CZ OH sing N N 331 TYR OH HH sing N N 332 TYR OXT HXT sing N N 333 VAL N CA sing N N 334 VAL N H sing N N 335 VAL N H2 sing N N 336 VAL CA C sing N N 337 VAL CA CB sing N N 338 VAL CA HA sing N N 339 VAL C O doub N N 340 VAL C OXT sing N N 341 VAL CB CG1 sing N N 342 VAL CB CG2 sing N N 343 VAL CB HB sing N N 344 VAL CG1 HG11 sing N N 345 VAL CG1 HG12 sing N N 346 VAL CG1 HG13 sing N N 347 VAL CG2 HG21 sing N N 348 VAL CG2 HG22 sing N N 349 VAL CG2 HG23 sing N N 350 VAL OXT HXT sing N N 351 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1IRJ _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 6ZDY _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013729 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.009613 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.024618 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022994 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA N O S ZN # loop_