data_6ZLX # _entry.id 6ZLX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.345 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6ZLX ? ? WWPDB D_1292109757 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6ZLX _pdbx_database_status.recvd_initial_deposition_date 2020-07-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zeth, K.' 1 0000-0002-7078-6569 'Dougan, D.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'PDIP38 is a novel adaptor-like modulator of the mitochondrial AAA+ protease CLPXP' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Strack, P.' 1 ? primary 'Brodie, E.' 2 ? primary 'Zhan, H.' 3 ? primary 'Schuenemann, V.' 4 ? primary 'Saiyed, T.' 5 ? primary 'Zeth, K.' 6 ? primary 'Truscott, K.' 7 ? primary 'Dougan, D.' 8 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 6ZLX _cell.details ? _cell.formula_units_Z ? _cell.length_a 120.095 _cell.length_a_esd ? _cell.length_b 120.095 _cell.length_b_esd ? _cell.length_c 48.586 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6ZLX _symmetry.cell_setting ? _symmetry.Int_Tables_number 171 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 62' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polymerase delta-interacting protein 2' 34069.066 1 ? ? ? ? 2 non-polymer syn 'PLATINUM (II) ION' 195.078 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '38 kDa DNA polymerase delta interaction protein,p38' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VFEVPKQNGKYETGQLFLHSIFGYRGVVLFPWQARLYDRDVASAAPEKAENPAGHGSKEVKGKTHTYYQVLIDARDCPHI SQRSQTEAVTFLANHDDSRALYAIPGLDYVSHEDILPYTSTDQVPIQHELFERFLLYDQTKAPPFVARETLRAWQEKNHP WLELSDVHRETTENIRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFSLSGTLETVRGRGVVGREP VLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDE ; _entity_poly.pdbx_seq_one_letter_code_can ;VFEVPKQNGKYETGQLFLHSIFGYRGVVLFPWQARLYDRDVASAAPEKAENPAGHGSKEVKGKTHTYYQVLIDARDCPHI SQRSQTEAVTFLANHDDSRALYAIPGLDYVSHEDILPYTSTDQVPIQHELFERFLLYDQTKAPPFVARETLRAWQEKNHP WLELSDVHRETTENIRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFSLSGTLETVRGRGVVGREP VLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 PHE n 1 3 GLU n 1 4 VAL n 1 5 PRO n 1 6 LYS n 1 7 GLN n 1 8 ASN n 1 9 GLY n 1 10 LYS n 1 11 TYR n 1 12 GLU n 1 13 THR n 1 14 GLY n 1 15 GLN n 1 16 LEU n 1 17 PHE n 1 18 LEU n 1 19 HIS n 1 20 SER n 1 21 ILE n 1 22 PHE n 1 23 GLY n 1 24 TYR n 1 25 ARG n 1 26 GLY n 1 27 VAL n 1 28 VAL n 1 29 LEU n 1 30 PHE n 1 31 PRO n 1 32 TRP n 1 33 GLN n 1 34 ALA n 1 35 ARG n 1 36 LEU n 1 37 TYR n 1 38 ASP n 1 39 ARG n 1 40 ASP n 1 41 VAL n 1 42 ALA n 1 43 SER n 1 44 ALA n 1 45 ALA n 1 46 PRO n 1 47 GLU n 1 48 LYS n 1 49 ALA n 1 50 GLU n 1 51 ASN n 1 52 PRO n 1 53 ALA n 1 54 GLY n 1 55 HIS n 1 56 GLY n 1 57 SER n 1 58 LYS n 1 59 GLU n 1 60 VAL n 1 61 LYS n 1 62 GLY n 1 63 LYS n 1 64 THR n 1 65 HIS n 1 66 THR n 1 67 TYR n 1 68 TYR n 1 69 GLN n 1 70 VAL n 1 71 LEU n 1 72 ILE n 1 73 ASP n 1 74 ALA n 1 75 ARG n 1 76 ASP n 1 77 CYS n 1 78 PRO n 1 79 HIS n 1 80 ILE n 1 81 SER n 1 82 GLN n 1 83 ARG n 1 84 SER n 1 85 GLN n 1 86 THR n 1 87 GLU n 1 88 ALA n 1 89 VAL n 1 90 THR n 1 91 PHE n 1 92 LEU n 1 93 ALA n 1 94 ASN n 1 95 HIS n 1 96 ASP n 1 97 ASP n 1 98 SER n 1 99 ARG n 1 100 ALA n 1 101 LEU n 1 102 TYR n 1 103 ALA n 1 104 ILE n 1 105 PRO n 1 106 GLY n 1 107 LEU n 1 108 ASP n 1 109 TYR n 1 110 VAL n 1 111 SER n 1 112 HIS n 1 113 GLU n 1 114 ASP n 1 115 ILE n 1 116 LEU n 1 117 PRO n 1 118 TYR n 1 119 THR n 1 120 SER n 1 121 THR n 1 122 ASP n 1 123 GLN n 1 124 VAL n 1 125 PRO n 1 126 ILE n 1 127 GLN n 1 128 HIS n 1 129 GLU n 1 130 LEU n 1 131 PHE n 1 132 GLU n 1 133 ARG n 1 134 PHE n 1 135 LEU n 1 136 LEU n 1 137 TYR n 1 138 ASP n 1 139 GLN n 1 140 THR n 1 141 LYS n 1 142 ALA n 1 143 PRO n 1 144 PRO n 1 145 PHE n 1 146 VAL n 1 147 ALA n 1 148 ARG n 1 149 GLU n 1 150 THR n 1 151 LEU n 1 152 ARG n 1 153 ALA n 1 154 TRP n 1 155 GLN n 1 156 GLU n 1 157 LYS n 1 158 ASN n 1 159 HIS n 1 160 PRO n 1 161 TRP n 1 162 LEU n 1 163 GLU n 1 164 LEU n 1 165 SER n 1 166 ASP n 1 167 VAL n 1 168 HIS n 1 169 ARG n 1 170 GLU n 1 171 THR n 1 172 THR n 1 173 GLU n 1 174 ASN n 1 175 ILE n 1 176 ARG n 1 177 VAL n 1 178 THR n 1 179 VAL n 1 180 ILE n 1 181 PRO n 1 182 PHE n 1 183 TYR n 1 184 MET n 1 185 GLY n 1 186 MET n 1 187 ARG n 1 188 GLU n 1 189 ALA n 1 190 GLN n 1 191 ASN n 1 192 SER n 1 193 HIS n 1 194 VAL n 1 195 TYR n 1 196 TRP n 1 197 TRP n 1 198 ARG n 1 199 TYR n 1 200 CYS n 1 201 ILE n 1 202 ARG n 1 203 LEU n 1 204 GLU n 1 205 ASN n 1 206 LEU n 1 207 ASP n 1 208 SER n 1 209 ASP n 1 210 VAL n 1 211 VAL n 1 212 GLN n 1 213 LEU n 1 214 ARG n 1 215 GLU n 1 216 ARG n 1 217 HIS n 1 218 TRP n 1 219 ARG n 1 220 ILE n 1 221 PHE n 1 222 SER n 1 223 LEU n 1 224 SER n 1 225 GLY n 1 226 THR n 1 227 LEU n 1 228 GLU n 1 229 THR n 1 230 VAL n 1 231 ARG n 1 232 GLY n 1 233 ARG n 1 234 GLY n 1 235 VAL n 1 236 VAL n 1 237 GLY n 1 238 ARG n 1 239 GLU n 1 240 PRO n 1 241 VAL n 1 242 LEU n 1 243 SER n 1 244 LYS n 1 245 GLU n 1 246 GLN n 1 247 PRO n 1 248 ALA n 1 249 PHE n 1 250 GLN n 1 251 TYR n 1 252 SER n 1 253 SER n 1 254 HIS n 1 255 VAL n 1 256 SER n 1 257 LEU n 1 258 GLN n 1 259 ALA n 1 260 SER n 1 261 SER n 1 262 GLY n 1 263 HIS n 1 264 MET n 1 265 TRP n 1 266 GLY n 1 267 THR n 1 268 PHE n 1 269 ARG n 1 270 PHE n 1 271 GLU n 1 272 ARG n 1 273 PRO n 1 274 ASP n 1 275 GLY n 1 276 SER n 1 277 HIS n 1 278 PHE n 1 279 ASP n 1 280 VAL n 1 281 ARG n 1 282 ILE n 1 283 PRO n 1 284 PRO n 1 285 PHE n 1 286 SER n 1 287 LEU n 1 288 GLU n 1 289 SER n 1 290 ASN n 1 291 LYS n 1 292 ASP n 1 293 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 293 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'POLDIP2, PDIP38, POLD4, HSPC017' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PDIP2_HUMAN _struct_ref.pdbx_db_accession Q9Y2S7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VFEVPKQNGKYETGQLFLHSIFGYRGVVLFPWQARLYDRDVASAAPEKAENPAGHGSKEVKGKTHTYYQVLIDARDCPHI SQRSQTEAVTFLANHDDSRALYAIPGLDYVSHEDILPYTSTDQVPIQHELFERFLLYDQTKAPPFVARETLRAWQEKNHP WLELSDVHRETTENIRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFSLSGTLETVRGRGVVGREP VLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDE ; _struct_ref.pdbx_align_begin 67 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 6ZLX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 293 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y2S7 _struct_ref_seq.db_align_beg 67 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 359 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 68 _struct_ref_seq.pdbx_auth_seq_align_end 358 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PT non-polymer . 'PLATINUM (II) ION' ? 'Pt 2' 195.078 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6ZLX _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.50 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 64.88 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'BATCH MODE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG 8000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2010-01-20 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.07 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.07 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 6ZLX _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.39 _reflns.d_resolution_low 39.31 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10813 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.39 _reflns_shell.d_res_low 3.6 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1742 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.73 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6ZLX _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.394 _refine.ls_d_res_low 39.310 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5690 _refine.ls_number_reflns_R_free 285 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.81 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2493 _refine.ls_R_factor_R_free 0.2869 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2473 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.39 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.05 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.37 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.394 _refine_hist.d_res_low 39.310 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1975 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1973 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 2030 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.533 ? 2757 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.599 ? 1184 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.042 ? 289 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 357 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.3943 4.2757 . . 140 2665 100.00 . . . 0.3314 . 0.2864 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.2757 39.3 . . 145 2740 100.00 . . . 0.2741 . 0.2353 . . . . . . . . . . . # _struct.entry_id 6ZLX _struct.title 'The structure of the ClpX-associated factor PDIP38' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6ZLX _struct_keywords.text 'ClpX, PDIP38, activator of human ClpXP, CELL CYCLE' _struct_keywords.pdbx_keywords 'CELL CYCLE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 127 ? PHE A 134 ? GLN A 192 PHE A 199 1 ? 8 HELX_P HELX_P2 AA2 ARG A 148 ? GLU A 163 ? ARG A 213 GLU A 228 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id metalc1 _struct_conn.conn_type_id metalc _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 200 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id C _struct_conn.ptnr2_label_comp_id PT _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id PT _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 265 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id PT _struct_conn.ptnr2_auth_seq_id 402 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.662 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 7 ? AA3 ? 2 ? AA4 ? 3 ? AA5 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 109 ? SER A 111 ? TYR A 174 SER A 176 AA1 2 THR A 64 ? ILE A 72 ? THR A 130 ILE A 138 AA1 3 ARG A 25 ? ASP A 38 ? ARG A 92 ASP A 105 AA1 4 LEU A 16 ? HIS A 19 ? LEU A 83 HIS A 86 AA1 5 ILE A 115 ? PRO A 117 ? ILE A 180 PRO A 182 AA2 1 TYR A 109 ? SER A 111 ? TYR A 174 SER A 176 AA2 2 THR A 64 ? ILE A 72 ? THR A 130 ILE A 138 AA2 3 ARG A 25 ? ASP A 38 ? ARG A 92 ASP A 105 AA2 4 ASP A 166 ? THR A 171 ? ASP A 231 THR A 236 AA2 5 ILE A 175 ? MET A 184 ? ILE A 240 MET A 249 AA2 6 VAL A 194 ? ASN A 205 ? VAL A 259 ASN A 270 AA2 7 ALA A 248 ? GLN A 258 ? ALA A 313 GLN A 323 AA3 1 LEU A 135 ? ASP A 138 ? LEU A 200 ASP A 203 AA3 2 PHE A 145 ? ALA A 147 ? PHE A 210 ALA A 212 AA4 1 LEU A 227 ? ARG A 233 ? LEU A 292 ARG A 298 AA4 2 VAL A 211 ? SER A 222 ? VAL A 276 SER A 287 AA4 3 VAL A 241 ? LEU A 242 ? VAL A 306 LEU A 307 AA5 1 LEU A 227 ? ARG A 233 ? LEU A 292 ARG A 298 AA5 2 VAL A 211 ? SER A 222 ? VAL A 276 SER A 287 AA5 3 GLY A 262 ? GLU A 271 ? GLY A 327 GLU A 336 AA5 4 HIS A 277 ? SER A 286 ? HIS A 342 SER A 351 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 110 ? O VAL A 175 N TYR A 68 ? N TYR A 134 AA1 2 3 O HIS A 65 ? O HIS A 131 N ALA A 34 ? N ALA A 101 AA1 3 4 O GLY A 26 ? O GLY A 93 N PHE A 17 ? N PHE A 84 AA1 4 5 N LEU A 18 ? N LEU A 85 O LEU A 116 ? O LEU A 181 AA2 1 2 O VAL A 110 ? O VAL A 175 N TYR A 68 ? N TYR A 134 AA2 2 3 O HIS A 65 ? O HIS A 131 N ALA A 34 ? N ALA A 101 AA2 3 4 N TYR A 37 ? N TYR A 104 O ARG A 169 ? O ARG A 234 AA2 4 5 N HIS A 168 ? N HIS A 233 O VAL A 179 ? O VAL A 244 AA2 5 6 N ILE A 180 ? N ILE A 245 O CYS A 200 ? O CYS A 265 AA2 6 7 N LEU A 203 ? N LEU A 268 O PHE A 249 ? O PHE A 314 AA3 1 2 N LEU A 136 ? N LEU A 201 O VAL A 146 ? O VAL A 211 AA4 1 2 O GLU A 228 ? O GLU A 293 N ILE A 220 ? N ILE A 285 AA4 2 3 N VAL A 211 ? N VAL A 276 O LEU A 242 ? O LEU A 307 AA5 1 2 O GLU A 228 ? O GLU A 293 N ILE A 220 ? N ILE A 285 AA5 2 3 N GLU A 215 ? N GLU A 280 O ARG A 269 ? O ARG A 334 AA5 3 4 N MET A 264 ? N MET A 329 O PHE A 285 ? O PHE A 350 # _atom_sites.entry_id 6ZLX _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008327 _atom_sites.fract_transf_matrix[1][2] 0.004807 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009615 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020582 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O PT S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 68 68 VAL VAL A . n A 1 2 PHE 2 69 69 PHE PHE A . n A 1 3 GLU 3 70 70 GLU GLU A . n A 1 4 VAL 4 71 71 VAL VAL A . n A 1 5 PRO 5 72 72 PRO PRO A . n A 1 6 LYS 6 73 73 LYS LYS A . n A 1 7 GLN 7 74 74 GLN GLN A . n A 1 8 ASN 8 75 75 ASN ASN A . n A 1 9 GLY 9 76 76 GLY GLY A . n A 1 10 LYS 10 77 77 LYS LYS A . n A 1 11 TYR 11 78 78 TYR TYR A . n A 1 12 GLU 12 79 79 GLU GLU A . n A 1 13 THR 13 80 80 THR THR A . n A 1 14 GLY 14 81 81 GLY GLY A . n A 1 15 GLN 15 82 82 GLN GLN A . n A 1 16 LEU 16 83 83 LEU LEU A . n A 1 17 PHE 17 84 84 PHE PHE A . n A 1 18 LEU 18 85 85 LEU LEU A . n A 1 19 HIS 19 86 86 HIS HIS A . n A 1 20 SER 20 87 87 SER SER A . n A 1 21 ILE 21 88 88 ILE ILE A . n A 1 22 PHE 22 89 89 PHE PHE A . n A 1 23 GLY 23 90 90 GLY GLY A . n A 1 24 TYR 24 91 91 TYR TYR A . n A 1 25 ARG 25 92 92 ARG ARG A . n A 1 26 GLY 26 93 93 GLY GLY A . n A 1 27 VAL 27 94 94 VAL VAL A . n A 1 28 VAL 28 95 95 VAL VAL A . n A 1 29 LEU 29 96 96 LEU LEU A . n A 1 30 PHE 30 97 97 PHE PHE A . n A 1 31 PRO 31 98 98 PRO PRO A . n A 1 32 TRP 32 99 99 TRP TRP A . n A 1 33 GLN 33 100 100 GLN GLN A . n A 1 34 ALA 34 101 101 ALA ALA A . n A 1 35 ARG 35 102 102 ARG ARG A . n A 1 36 LEU 36 103 103 LEU LEU A . n A 1 37 TYR 37 104 104 TYR TYR A . n A 1 38 ASP 38 105 105 ASP ASP A . n A 1 39 ARG 39 106 106 ARG ARG A . n A 1 40 ASP 40 107 107 ASP ASP A . n A 1 41 VAL 41 107 ? ? ? A A n A 1 42 ALA 42 107 ? ? ? A B n A 1 43 SER 43 107 ? ? ? A C n A 1 44 ALA 44 107 ? ? ? A D n A 1 45 ALA 45 107 ? ? ? A E n A 1 46 PRO 46 107 ? ? ? A F n A 1 47 GLU 47 107 ? ? ? A G n A 1 48 LYS 48 107 ? ? ? A H n A 1 49 ALA 49 107 ? ? ? A I n A 1 50 GLU 50 107 ? ? ? A J n A 1 51 ASN 51 107 ? ? ? A K n A 1 52 PRO 52 107 ? ? ? A L n A 1 53 ALA 53 107 ? ? ? A M n A 1 54 GLY 54 107 ? ? ? A N n A 1 55 HIS 55 107 ? ? ? A O n A 1 56 GLY 56 107 ? ? ? A P n A 1 57 SER 57 107 ? ? ? A Q n A 1 58 LYS 58 107 ? ? ? A R n A 1 59 GLU 59 107 ? ? ? A S n A 1 60 VAL 60 107 ? ? ? A T n A 1 61 LYS 61 107 ? ? ? A U n A 1 62 GLY 62 128 128 GLY GLY A . n A 1 63 LYS 63 129 129 LYS LYS A . n A 1 64 THR 64 130 130 THR THR A . n A 1 65 HIS 65 131 131 HIS HIS A . n A 1 66 THR 66 132 132 THR THR A . n A 1 67 TYR 67 133 133 TYR TYR A . n A 1 68 TYR 68 134 134 TYR TYR A . n A 1 69 GLN 69 135 135 GLN GLN A . n A 1 70 VAL 70 136 136 VAL VAL A . n A 1 71 LEU 71 137 137 LEU LEU A . n A 1 72 ILE 72 138 138 ILE ILE A . n A 1 73 ASP 73 139 139 ASP ASP A . n A 1 74 ALA 74 140 140 ALA ALA A . n A 1 75 ARG 75 141 141 ARG ARG A . n A 1 76 ASP 76 141 ? ? ? A A n A 1 77 CYS 77 141 ? ? ? A B n A 1 78 PRO 78 141 ? ? ? A C n A 1 79 HIS 79 141 ? ? ? A D n A 1 80 ILE 80 141 ? ? ? A E n A 1 81 SER 81 141 ? ? ? A F n A 1 82 GLN 82 141 ? ? ? A G n A 1 83 ARG 83 141 ? ? ? A H n A 1 84 SER 84 141 ? ? ? A I n A 1 85 GLN 85 141 ? ? ? A J n A 1 86 THR 86 141 ? ? ? A K n A 1 87 GLU 87 141 ? ? ? A L n A 1 88 ALA 88 141 ? ? ? A M n A 1 89 VAL 89 141 ? ? ? A N n A 1 90 THR 90 141 ? ? ? A O n A 1 91 PHE 91 141 ? ? ? A P n A 1 92 LEU 92 141 ? ? ? A Q n A 1 93 ALA 93 141 ? ? ? A R n A 1 94 ASN 94 141 ? ? ? A S n A 1 95 HIS 95 141 ? ? ? A T n A 1 96 ASP 96 141 ? ? ? A U n A 1 97 ASP 97 141 ? ? ? A V n A 1 98 SER 98 141 ? ? ? A W n A 1 99 ARG 99 141 ? ? ? A X n A 1 100 ALA 100 141 ? ? ? A Y n A 1 101 LEU 101 141 ? ? ? A Z n A 1 102 TYR 102 142 ? ? ? A A n A 1 103 ALA 103 142 ? ? ? A B n A 1 104 ILE 104 142 ? ? ? A C n A 1 105 PRO 105 142 ? ? ? A D n A 1 106 GLY 106 142 ? ? ? A E n A 1 107 LEU 107 142 ? ? ? A F n A 1 108 ASP 108 173 173 ASP ASP A . n A 1 109 TYR 109 174 174 TYR TYR A . n A 1 110 VAL 110 175 175 VAL VAL A . n A 1 111 SER 111 176 176 SER SER A . n A 1 112 HIS 112 177 177 HIS HIS A . n A 1 113 GLU 113 178 178 GLU GLU A . n A 1 114 ASP 114 179 179 ASP ASP A . n A 1 115 ILE 115 180 180 ILE ILE A . n A 1 116 LEU 116 181 181 LEU LEU A . n A 1 117 PRO 117 182 182 PRO PRO A . n A 1 118 TYR 118 183 183 TYR TYR A . n A 1 119 THR 119 184 184 THR THR A . n A 1 120 SER 120 185 185 SER SER A . n A 1 121 THR 121 186 186 THR THR A . n A 1 122 ASP 122 187 187 ASP ASP A . n A 1 123 GLN 123 188 188 GLN GLN A . n A 1 124 VAL 124 189 189 VAL VAL A . n A 1 125 PRO 125 190 190 PRO PRO A . n A 1 126 ILE 126 191 191 ILE ILE A . n A 1 127 GLN 127 192 192 GLN GLN A . n A 1 128 HIS 128 193 193 HIS HIS A . n A 1 129 GLU 129 194 194 GLU GLU A . n A 1 130 LEU 130 195 195 LEU LEU A . n A 1 131 PHE 131 196 196 PHE PHE A . n A 1 132 GLU 132 197 197 GLU GLU A . n A 1 133 ARG 133 198 198 ARG ARG A . n A 1 134 PHE 134 199 199 PHE PHE A . n A 1 135 LEU 135 200 200 LEU LEU A . n A 1 136 LEU 136 201 201 LEU LEU A . n A 1 137 TYR 137 202 202 TYR TYR A . n A 1 138 ASP 138 203 203 ASP ASP A . n A 1 139 GLN 139 204 204 GLN GLN A . n A 1 140 THR 140 205 205 THR THR A . n A 1 141 LYS 141 206 206 LYS LYS A . n A 1 142 ALA 142 207 207 ALA ALA A . n A 1 143 PRO 143 208 208 PRO PRO A . n A 1 144 PRO 144 209 209 PRO PRO A . n A 1 145 PHE 145 210 210 PHE PHE A . n A 1 146 VAL 146 211 211 VAL VAL A . n A 1 147 ALA 147 212 212 ALA ALA A . n A 1 148 ARG 148 213 213 ARG ARG A . n A 1 149 GLU 149 214 214 GLU GLU A . n A 1 150 THR 150 215 215 THR THR A . n A 1 151 LEU 151 216 216 LEU LEU A . n A 1 152 ARG 152 217 217 ARG ARG A . n A 1 153 ALA 153 218 218 ALA ALA A . n A 1 154 TRP 154 219 219 TRP TRP A . n A 1 155 GLN 155 220 220 GLN GLN A . n A 1 156 GLU 156 221 221 GLU GLU A . n A 1 157 LYS 157 222 222 LYS LYS A . n A 1 158 ASN 158 223 223 ASN ASN A . n A 1 159 HIS 159 224 224 HIS HIS A . n A 1 160 PRO 160 225 225 PRO PRO A . n A 1 161 TRP 161 226 226 TRP TRP A . n A 1 162 LEU 162 227 227 LEU LEU A . n A 1 163 GLU 163 228 228 GLU GLU A . n A 1 164 LEU 164 229 229 LEU LEU A . n A 1 165 SER 165 230 230 SER SER A . n A 1 166 ASP 166 231 231 ASP ASP A . n A 1 167 VAL 167 232 232 VAL VAL A . n A 1 168 HIS 168 233 233 HIS HIS A . n A 1 169 ARG 169 234 234 ARG ARG A . n A 1 170 GLU 170 235 235 GLU GLU A . n A 1 171 THR 171 236 236 THR THR A . n A 1 172 THR 172 237 237 THR THR A . n A 1 173 GLU 173 238 238 GLU GLU A . n A 1 174 ASN 174 239 239 ASN ASN A . n A 1 175 ILE 175 240 240 ILE ILE A . n A 1 176 ARG 176 241 241 ARG ARG A . n A 1 177 VAL 177 242 242 VAL VAL A . n A 1 178 THR 178 243 243 THR THR A . n A 1 179 VAL 179 244 244 VAL VAL A . n A 1 180 ILE 180 245 245 ILE ILE A . n A 1 181 PRO 181 246 246 PRO PRO A . n A 1 182 PHE 182 247 247 PHE PHE A . n A 1 183 TYR 183 248 248 TYR TYR A . n A 1 184 MET 184 249 249 MET MET A . n A 1 185 GLY 185 250 250 GLY GLY A . n A 1 186 MET 186 251 251 MET MET A . n A 1 187 ARG 187 252 252 ARG ARG A . n A 1 188 GLU 188 253 253 GLU GLU A . n A 1 189 ALA 189 254 254 ALA ALA A . n A 1 190 GLN 190 255 255 GLN GLN A . n A 1 191 ASN 191 256 256 ASN ASN A . n A 1 192 SER 192 257 257 SER SER A . n A 1 193 HIS 193 258 258 HIS HIS A . n A 1 194 VAL 194 259 259 VAL VAL A . n A 1 195 TYR 195 260 260 TYR TYR A . n A 1 196 TRP 196 261 261 TRP TRP A . n A 1 197 TRP 197 262 262 TRP TRP A . n A 1 198 ARG 198 263 263 ARG ARG A . n A 1 199 TYR 199 264 264 TYR TYR A . n A 1 200 CYS 200 265 265 CYS CYS A . n A 1 201 ILE 201 266 266 ILE ILE A . n A 1 202 ARG 202 267 267 ARG ARG A . n A 1 203 LEU 203 268 268 LEU LEU A . n A 1 204 GLU 204 269 269 GLU GLU A . n A 1 205 ASN 205 270 270 ASN ASN A . n A 1 206 LEU 206 271 271 LEU LEU A . n A 1 207 ASP 207 272 272 ASP ASP A . n A 1 208 SER 208 273 273 SER SER A . n A 1 209 ASP 209 274 274 ASP ASP A . n A 1 210 VAL 210 275 275 VAL VAL A . n A 1 211 VAL 211 276 276 VAL VAL A . n A 1 212 GLN 212 277 277 GLN GLN A . n A 1 213 LEU 213 278 278 LEU LEU A . n A 1 214 ARG 214 279 279 ARG ARG A . n A 1 215 GLU 215 280 280 GLU GLU A . n A 1 216 ARG 216 281 281 ARG ARG A . n A 1 217 HIS 217 282 282 HIS HIS A . n A 1 218 TRP 218 283 283 TRP TRP A . n A 1 219 ARG 219 284 284 ARG ARG A . n A 1 220 ILE 220 285 285 ILE ILE A . n A 1 221 PHE 221 286 286 PHE PHE A . n A 1 222 SER 222 287 287 SER SER A . n A 1 223 LEU 223 288 288 LEU LEU A . n A 1 224 SER 224 289 289 SER SER A . n A 1 225 GLY 225 290 290 GLY GLY A . n A 1 226 THR 226 291 291 THR THR A . n A 1 227 LEU 227 292 292 LEU LEU A . n A 1 228 GLU 228 293 293 GLU GLU A . n A 1 229 THR 229 294 294 THR THR A . n A 1 230 VAL 230 295 295 VAL VAL A . n A 1 231 ARG 231 296 296 ARG ARG A . n A 1 232 GLY 232 297 297 GLY GLY A . n A 1 233 ARG 233 298 298 ARG ARG A . n A 1 234 GLY 234 299 299 GLY GLY A . n A 1 235 VAL 235 300 300 VAL VAL A . n A 1 236 VAL 236 301 301 VAL VAL A . n A 1 237 GLY 237 302 302 GLY GLY A . n A 1 238 ARG 238 303 303 ARG ARG A . n A 1 239 GLU 239 304 304 GLU GLU A . n A 1 240 PRO 240 305 305 PRO PRO A . n A 1 241 VAL 241 306 306 VAL VAL A . n A 1 242 LEU 242 307 307 LEU LEU A . n A 1 243 SER 243 308 308 SER SER A . n A 1 244 LYS 244 309 309 LYS LYS A . n A 1 245 GLU 245 310 310 GLU GLU A . n A 1 246 GLN 246 311 311 GLN GLN A . n A 1 247 PRO 247 312 312 PRO PRO A . n A 1 248 ALA 248 313 313 ALA ALA A . n A 1 249 PHE 249 314 314 PHE PHE A . n A 1 250 GLN 250 315 315 GLN GLN A . n A 1 251 TYR 251 316 316 TYR TYR A . n A 1 252 SER 252 317 317 SER SER A . n A 1 253 SER 253 318 318 SER SER A . n A 1 254 HIS 254 319 319 HIS HIS A . n A 1 255 VAL 255 320 320 VAL VAL A . n A 1 256 SER 256 321 321 SER SER A . n A 1 257 LEU 257 322 322 LEU LEU A . n A 1 258 GLN 258 323 323 GLN GLN A . n A 1 259 ALA 259 324 324 ALA ALA A . n A 1 260 SER 260 325 325 SER SER A . n A 1 261 SER 261 326 326 SER SER A . n A 1 262 GLY 262 327 327 GLY GLY A . n A 1 263 HIS 263 328 328 HIS HIS A . n A 1 264 MET 264 329 329 MET MET A . n A 1 265 TRP 265 330 330 TRP TRP A . n A 1 266 GLY 266 331 331 GLY GLY A . n A 1 267 THR 267 332 332 THR THR A . n A 1 268 PHE 268 333 333 PHE PHE A . n A 1 269 ARG 269 334 334 ARG ARG A . n A 1 270 PHE 270 335 335 PHE PHE A . n A 1 271 GLU 271 336 336 GLU GLU A . n A 1 272 ARG 272 337 337 ARG ARG A . n A 1 273 PRO 273 338 338 PRO PRO A . n A 1 274 ASP 274 339 339 ASP ASP A . n A 1 275 GLY 275 340 340 GLY GLY A . n A 1 276 SER 276 341 341 SER SER A . n A 1 277 HIS 277 342 342 HIS HIS A . n A 1 278 PHE 278 343 343 PHE PHE A . n A 1 279 ASP 279 344 344 ASP ASP A . n A 1 280 VAL 280 345 345 VAL VAL A . n A 1 281 ARG 281 346 346 ARG ARG A . n A 1 282 ILE 282 347 347 ILE ILE A . n A 1 283 PRO 283 348 348 PRO PRO A . n A 1 284 PRO 284 349 349 PRO PRO A . n A 1 285 PHE 285 350 350 PHE PHE A . n A 1 286 SER 286 351 351 SER SER A . n A 1 287 LEU 287 352 352 LEU LEU A . n A 1 288 GLU 288 353 353 GLU GLU A . n A 1 289 SER 289 354 354 SER SER A . n A 1 290 ASN 290 355 355 ASN ASN A . n A 1 291 LYS 291 356 356 LYS LYS A . n A 1 292 ASP 292 357 357 ASP ASP A . n A 1 293 GLU 293 358 358 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PT 1 401 1 PT PT A . C 2 PT 1 402 2 PT PT A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 280 ? 1 MORE -46 ? 1 'SSA (A^2)' 13500 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2021-07-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -2.1894 -39.7686 -0.9605 0.8386 ? -0.1099 ? -0.1513 ? 1.4810 ? -0.0490 ? 1.4313 ? 4.5105 ? -0.1971 ? 5.4304 ? 9.6747 ? -0.0753 ? 6.6049 ? -0.2822 ? 0.0510 ? 0.3710 ? 1.0272 ? -0.5270 ? -0.3243 ? -1.6376 ? 0.5883 ? 1.2491 ? 2 'X-RAY DIFFRACTION' ? refined 1.6211 -45.7930 3.5031 0.9715 ? 0.0375 ? 0.0485 ? 1.4781 ? 0.0246 ? 2.1894 ? 6.8309 ? -1.8623 ? 6.5264 ? 4.8016 ? -1.9253 ? 6.3589 ? -0.4242 ? -0.8521 ? 2.1772 ? 0.2007 ? -1.9377 ? -0.4340 ? -0.7630 ? 2.3655 ? -0.1526 ? 3 'X-RAY DIFFRACTION' ? refined 1.8261 -37.9183 -0.7166 0.9778 ? -0.0244 ? -0.1437 ? 1.2262 ? -0.1105 ? 1.3607 ? 5.3280 ? 2.1848 ? -3.1792 ? 5.0513 ? 1.1691 ? 3.3526 ? -0.7749 ? 0.9621 ? -2.8540 ? -1.0103 ? -0.4758 ? -1.1840 ? -0.2551 ? -0.0967 ? 0.7938 ? 4 'X-RAY DIFFRACTION' ? refined 1.4192 -34.3902 -15.9030 1.3503 ? 1.4592 ? 0.7326 ? 3.0660 ? 0.9027 ? 2.1037 ? 8.5749 ? 0.8725 ? -2.5779 ? 2.2900 ? 0.1121 ? 0.8417 ? 1.7295 ? 2.9171 ? 1.6492 ? -3.2963 ? -2.2518 ? -2.1210 ? 1.2547 ? 2.6606 ? -3.0181 ? 5 'X-RAY DIFFRACTION' ? refined -7.1550 -39.3525 -17.5199 0.9664 ? 0.5323 ? -0.2717 ? 1.2731 ? 0.6812 ? 2.3971 ? 1.9979 ? -7.4404 ? 2.2607 ? 2.0013 ? 5.9348 ? 8.2465 ? 0.3352 ? 1.2202 ? 3.7198 ? -1.5404 ? -0.8670 ? -3.3127 ? -2.5431 ? -0.3135 ? 0.7162 ? 6 'X-RAY DIFFRACTION' ? refined 5.4414 -50.3596 -1.0943 0.9031 ? -0.2484 ? 0.0969 ? 0.4363 ? -0.0778 ? 1.4665 ? 7.6404 ? -1.1020 ? 2.7000 ? 1.8648 ? 0.8392 ? 8.3140 ? 0.1893 ? -1.2182 ? -2.1580 ? -0.1176 ? 0.6325 ? 0.4902 ? 0.8216 ? -0.6617 ? 0.1298 ? 7 'X-RAY DIFFRACTION' ? refined 17.5717 -54.2721 -0.3296 0.8310 ? -0.2110 ? 0.0108 ? 0.7602 ? 0.0717 ? 0.8376 ? 9.6939 ? -4.5266 ? -1.4765 ? 8.6092 ? -0.0629 ? 2.7354 ? -0.2599 ? 0.1680 ? -1.1425 ? -2.6978 ? 0.1727 ? 1.8490 ? -0.4551 ? 0.2255 ? -1.1085 ? 8 'X-RAY DIFFRACTION' ? refined 19.1811 -41.6961 10.5716 0.5651 ? -0.0543 ? 0.0418 ? 1.1381 ? -0.0594 ? 1.5460 ? 2.7590 ? -0.7069 ? -0.3060 ? 8.1979 ? 1.0747 ? 6.0620 ? 0.1599 ? -0.2529 ? 0.0408 ? -0.0522 ? -0.2901 ? -0.3861 ? -0.1933 ? -0.0407 ? 0.0933 ? 9 'X-RAY DIFFRACTION' ? refined 17.3864 -47.3170 11.3409 0.8292 ? 0.1166 ? 0.0986 ? 1.4478 ? -0.0798 ? 1.2441 ? 5.9092 ? -3.2015 ? -4.1653 ? 7.6002 ? 0.1974 ? 3.5632 ? -0.3866 ? -0.7199 ? -0.9501 ? 0.3509 ? -0.2217 ? 1.0879 ? -0.0590 ? 0.0482 ? 0.8862 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 68 through 105 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 106 through 138 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 139 through 182 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 183 through 199 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 200 through 213 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 214 through 239 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 240 through 258 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 259 through 312 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 313 through 358 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.14_3260: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHARP ? ? ? . 4 # _pdbx_entry_details.entry_id 6ZLX _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 75 ? ? -153.59 85.97 2 1 PHE A 89 ? ? 37.88 67.97 3 1 ILE A 191 ? ? -80.60 -158.47 4 1 TYR A 202 ? ? -64.73 -176.12 5 1 GLN A 204 ? ? -140.92 -145.23 6 1 ASN A 256 ? ? 69.42 -52.87 7 1 GLN A 311 ? ? 55.10 74.29 8 1 ALA A 324 ? ? 64.66 -8.18 9 1 ASN A 355 ? ? 58.92 71.41 10 1 LYS A 356 ? ? 51.85 74.61 # _pdbx_validate_polymer_linkage.id 1 _pdbx_validate_polymer_linkage.PDB_model_num 1 _pdbx_validate_polymer_linkage.auth_atom_id_1 C _pdbx_validate_polymer_linkage.auth_asym_id_1 A _pdbx_validate_polymer_linkage.auth_comp_id_1 PRO _pdbx_validate_polymer_linkage.auth_seq_id_1 208 _pdbx_validate_polymer_linkage.PDB_ins_code_1 ? _pdbx_validate_polymer_linkage.label_alt_id_1 ? _pdbx_validate_polymer_linkage.auth_atom_id_2 N _pdbx_validate_polymer_linkage.auth_asym_id_2 A _pdbx_validate_polymer_linkage.auth_comp_id_2 PRO _pdbx_validate_polymer_linkage.auth_seq_id_2 209 _pdbx_validate_polymer_linkage.PDB_ins_code_2 ? _pdbx_validate_polymer_linkage.label_alt_id_2 ? _pdbx_validate_polymer_linkage.dist 3.07 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 74 ? CG ? A GLN 7 CG 2 1 Y 1 A GLN 74 ? CD ? A GLN 7 CD 3 1 Y 1 A GLN 74 ? OE1 ? A GLN 7 OE1 4 1 Y 1 A GLN 74 ? NE2 ? A GLN 7 NE2 5 1 Y 1 A LYS 129 ? CG ? A LYS 63 CG 6 1 Y 1 A LYS 129 ? CD ? A LYS 63 CD 7 1 Y 1 A LYS 129 ? CE ? A LYS 63 CE 8 1 Y 1 A LYS 129 ? NZ ? A LYS 63 NZ 9 1 Y 1 A ARG 141 ? CG ? A ARG 75 CG 10 1 Y 1 A ARG 141 ? CD ? A ARG 75 CD 11 1 Y 1 A ARG 141 ? NE ? A ARG 75 NE 12 1 Y 1 A ARG 141 ? CZ ? A ARG 75 CZ 13 1 Y 1 A ARG 141 ? NH1 ? A ARG 75 NH1 14 1 Y 1 A ARG 141 ? NH2 ? A ARG 75 NH2 15 1 Y 1 A HIS 193 ? CG ? A HIS 128 CG 16 1 Y 1 A HIS 193 ? ND1 ? A HIS 128 ND1 17 1 Y 1 A HIS 193 ? CD2 ? A HIS 128 CD2 18 1 Y 1 A HIS 193 ? CE1 ? A HIS 128 CE1 19 1 Y 1 A HIS 193 ? NE2 ? A HIS 128 NE2 20 1 Y 1 A TYR 202 ? CG ? A TYR 137 CG 21 1 Y 1 A TYR 202 ? CD1 ? A TYR 137 CD1 22 1 Y 1 A TYR 202 ? CD2 ? A TYR 137 CD2 23 1 Y 1 A TYR 202 ? CE1 ? A TYR 137 CE1 24 1 Y 1 A TYR 202 ? CE2 ? A TYR 137 CE2 25 1 Y 1 A TYR 202 ? CZ ? A TYR 137 CZ 26 1 Y 1 A TYR 202 ? OH ? A TYR 137 OH 27 1 Y 1 A TYR 260 ? CG ? A TYR 195 CG 28 1 Y 1 A TYR 260 ? CD1 ? A TYR 195 CD1 29 1 Y 1 A TYR 260 ? CD2 ? A TYR 195 CD2 30 1 Y 1 A TYR 260 ? CE1 ? A TYR 195 CE1 31 1 Y 1 A TYR 260 ? CE2 ? A TYR 195 CE2 32 1 Y 1 A TYR 260 ? CZ ? A TYR 195 CZ 33 1 Y 1 A TYR 260 ? OH ? A TYR 195 OH 34 1 Y 1 A ARG 263 ? CG ? A ARG 198 CG 35 1 Y 1 A ARG 263 ? CD ? A ARG 198 CD 36 1 Y 1 A ARG 263 ? NE ? A ARG 198 NE 37 1 Y 1 A ARG 263 ? CZ ? A ARG 198 CZ 38 1 Y 1 A ARG 263 ? NH1 ? A ARG 198 NH1 39 1 Y 1 A ARG 263 ? NH2 ? A ARG 198 NH2 40 1 Y 1 A ARG 296 ? CG ? A ARG 231 CG 41 1 Y 1 A ARG 296 ? CD ? A ARG 231 CD 42 1 Y 1 A ARG 296 ? NE ? A ARG 231 NE 43 1 Y 1 A ARG 296 ? CZ ? A ARG 231 CZ 44 1 Y 1 A ARG 296 ? NH1 ? A ARG 231 NH1 45 1 Y 1 A ARG 296 ? NH2 ? A ARG 231 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 107 A A VAL 41 2 1 Y 1 A ALA 107 B A ALA 42 3 1 Y 1 A SER 107 C A SER 43 4 1 Y 1 A ALA 107 D A ALA 44 5 1 Y 1 A ALA 107 E A ALA 45 6 1 Y 1 A PRO 107 F A PRO 46 7 1 Y 1 A GLU 107 G A GLU 47 8 1 Y 1 A LYS 107 H A LYS 48 9 1 Y 1 A ALA 107 I A ALA 49 10 1 Y 1 A GLU 107 J A GLU 50 11 1 Y 1 A ASN 107 K A ASN 51 12 1 Y 1 A PRO 107 L A PRO 52 13 1 Y 1 A ALA 107 M A ALA 53 14 1 Y 1 A GLY 107 N A GLY 54 15 1 Y 1 A HIS 107 O A HIS 55 16 1 Y 1 A GLY 107 P A GLY 56 17 1 Y 1 A SER 107 Q A SER 57 18 1 Y 1 A LYS 107 R A LYS 58 19 1 Y 1 A GLU 107 S A GLU 59 20 1 Y 1 A VAL 107 T A VAL 60 21 1 Y 1 A LYS 107 U A LYS 61 22 1 Y 1 A ASP 141 A A ASP 76 23 1 Y 1 A CYS 141 B A CYS 77 24 1 Y 1 A PRO 141 C A PRO 78 25 1 Y 1 A HIS 141 D A HIS 79 26 1 Y 1 A ILE 141 E A ILE 80 27 1 Y 1 A SER 141 F A SER 81 28 1 Y 1 A GLN 141 G A GLN 82 29 1 Y 1 A ARG 141 H A ARG 83 30 1 Y 1 A SER 141 I A SER 84 31 1 Y 1 A GLN 141 J A GLN 85 32 1 Y 1 A THR 141 K A THR 86 33 1 Y 1 A GLU 141 L A GLU 87 34 1 Y 1 A ALA 141 M A ALA 88 35 1 Y 1 A VAL 141 N A VAL 89 36 1 Y 1 A THR 141 O A THR 90 37 1 Y 1 A PHE 141 P A PHE 91 38 1 Y 1 A LEU 141 Q A LEU 92 39 1 Y 1 A ALA 141 R A ALA 93 40 1 Y 1 A ASN 141 S A ASN 94 41 1 Y 1 A HIS 141 T A HIS 95 42 1 Y 1 A ASP 141 U A ASP 96 43 1 Y 1 A ASP 141 V A ASP 97 44 1 Y 1 A SER 141 W A SER 98 45 1 Y 1 A ARG 141 X A ARG 99 46 1 Y 1 A ALA 141 Y A ALA 100 47 1 Y 1 A LEU 141 Z A LEU 101 48 1 Y 1 A TYR 142 A A TYR 102 49 1 Y 1 A ALA 142 B A ALA 103 50 1 Y 1 A ILE 142 C A ILE 104 51 1 Y 1 A PRO 142 D A PRO 105 52 1 Y 1 A GLY 142 E A GLY 106 53 1 Y 1 A LEU 142 F A LEU 107 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'PLATINUM (II) ION' _pdbx_entity_nonpoly.comp_id PT # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support cross-linking _pdbx_struct_assembly_auth_evidence.details ? #