data_6ZPB
# 
_entry.id   6ZPB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6ZPB         pdb_00006zpb 10.2210/pdb6zpb/pdb 
WWPDB D_1292109056 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2021-03-03 
2 'Structure model' 1 1 2021-05-05 
3 'Structure model' 1 2 2024-05-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Data collection'     
3 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
3 3 'Structure model' chem_comp_atom  
4 3 'Structure model' chem_comp_bond  
5 3 'Structure model' database_2      
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'            
2 2 'Structure model' '_citation.page_first'                
3 2 'Structure model' '_citation.page_last'                 
4 2 'Structure model' '_citation.pdbx_database_id_DOI'      
5 2 'Structure model' '_citation.pdbx_database_id_PubMed'   
6 2 'Structure model' '_citation.title'                     
7 2 'Structure model' '_citation_author.identifier_ORCID'   
8 3 'Structure model' '_database_2.pdbx_DOI'                
9 3 'Structure model' '_database_2.pdbx_database_accession' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6ZPB 
_pdbx_database_status.recvd_initial_deposition_date   2020-07-08 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Czernecki, D.' 1 0000-0002-3438-4722 
'Legrand, P.'   2 ?                   
'Delarue, M.'   3 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            12 
_citation.language                  ? 
_citation.page_first                2420 
_citation.page_last                 2420 
_citation.title                     
'How cyanophage S-2L rejects adenine and incorporates 2-aminoadenine to saturate hydrogen bonding in its DNA.' 
_citation.year                      2021 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-021-22626-x 
_citation.pdbx_database_id_PubMed   33893297 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Czernecki, D.'  1 0000-0002-3438-4722 
primary 'Legrand, P.'    2 0000-0003-2431-2255 
primary 'Tekpinar, M.'   3 0000-0002-0207-0446 
primary 'Rosario, S.'    4 ?                   
primary 'Kaminski, P.A.' 5 ?                   
primary 'Delarue, M.'    6 ?                   
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man DatZ                                                                          20612.609 1   ? ? ? ? 
2 non-polymer syn '(2R,3S,5R)-5-(6-amino-9H-purin-9-yl)-tetrahydro-2-(hydroxymethyl)furan-3-ol' 251.242   1   ? ? ? ? 
3 non-polymer syn 'COBALT (II) ION'                                                             58.933    3   ? ? ? ? 
4 water       nat water                                                                         18.015    260 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GTGDGSMTLQITETYERLRASHISRWGIVQTTYPQNIAEHMWRVWLLCRDWGAAAGMPQHTVRQACEFALVHDLAEIRTG
DAPTPHKTPELKELLAGIEAQIVPEVAELEATMAPEARELWKFCDTAEAVLFLKVNGLGAHAYDVQHLLMEQMKRRLMDS
VLDVEVQDELMFQFERTIKKT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GTGDGSMTLQITETYERLRASHISRWGIVQTTYPQNIAEHMWRVWLLCRDWGAAAGMPQHTVRQACEFALVHDLAEIRTG
DAPTPHKTPELKELLAGIEAQIVPEVAELEATMAPEARELWKFCDTAEAVLFLKVNGLGAHAYDVQHLLMEQMKRRLMDS
VLDVEVQDELMFQFERTIKKT
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '(2R,3S,5R)-5-(6-amino-9H-purin-9-yl)-tetrahydro-2-(hydroxymethyl)furan-3-ol' 3D1 
3 'COBALT (II) ION'                                                             CO  
4 water                                                                         HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   THR n 
1 3   GLY n 
1 4   ASP n 
1 5   GLY n 
1 6   SER n 
1 7   MET n 
1 8   THR n 
1 9   LEU n 
1 10  GLN n 
1 11  ILE n 
1 12  THR n 
1 13  GLU n 
1 14  THR n 
1 15  TYR n 
1 16  GLU n 
1 17  ARG n 
1 18  LEU n 
1 19  ARG n 
1 20  ALA n 
1 21  SER n 
1 22  HIS n 
1 23  ILE n 
1 24  SER n 
1 25  ARG n 
1 26  TRP n 
1 27  GLY n 
1 28  ILE n 
1 29  VAL n 
1 30  GLN n 
1 31  THR n 
1 32  THR n 
1 33  TYR n 
1 34  PRO n 
1 35  GLN n 
1 36  ASN n 
1 37  ILE n 
1 38  ALA n 
1 39  GLU n 
1 40  HIS n 
1 41  MET n 
1 42  TRP n 
1 43  ARG n 
1 44  VAL n 
1 45  TRP n 
1 46  LEU n 
1 47  LEU n 
1 48  CYS n 
1 49  ARG n 
1 50  ASP n 
1 51  TRP n 
1 52  GLY n 
1 53  ALA n 
1 54  ALA n 
1 55  ALA n 
1 56  GLY n 
1 57  MET n 
1 58  PRO n 
1 59  GLN n 
1 60  HIS n 
1 61  THR n 
1 62  VAL n 
1 63  ARG n 
1 64  GLN n 
1 65  ALA n 
1 66  CYS n 
1 67  GLU n 
1 68  PHE n 
1 69  ALA n 
1 70  LEU n 
1 71  VAL n 
1 72  HIS n 
1 73  ASP n 
1 74  LEU n 
1 75  ALA n 
1 76  GLU n 
1 77  ILE n 
1 78  ARG n 
1 79  THR n 
1 80  GLY n 
1 81  ASP n 
1 82  ALA n 
1 83  PRO n 
1 84  THR n 
1 85  PRO n 
1 86  HIS n 
1 87  LYS n 
1 88  THR n 
1 89  PRO n 
1 90  GLU n 
1 91  LEU n 
1 92  LYS n 
1 93  GLU n 
1 94  LEU n 
1 95  LEU n 
1 96  ALA n 
1 97  GLY n 
1 98  ILE n 
1 99  GLU n 
1 100 ALA n 
1 101 GLN n 
1 102 ILE n 
1 103 VAL n 
1 104 PRO n 
1 105 GLU n 
1 106 VAL n 
1 107 ALA n 
1 108 GLU n 
1 109 LEU n 
1 110 GLU n 
1 111 ALA n 
1 112 THR n 
1 113 MET n 
1 114 ALA n 
1 115 PRO n 
1 116 GLU n 
1 117 ALA n 
1 118 ARG n 
1 119 GLU n 
1 120 LEU n 
1 121 TRP n 
1 122 LYS n 
1 123 PHE n 
1 124 CYS n 
1 125 ASP n 
1 126 THR n 
1 127 ALA n 
1 128 GLU n 
1 129 ALA n 
1 130 VAL n 
1 131 LEU n 
1 132 PHE n 
1 133 LEU n 
1 134 LYS n 
1 135 VAL n 
1 136 ASN n 
1 137 GLY n 
1 138 LEU n 
1 139 GLY n 
1 140 ALA n 
1 141 HIS n 
1 142 ALA n 
1 143 TYR n 
1 144 ASP n 
1 145 VAL n 
1 146 GLN n 
1 147 HIS n 
1 148 LEU n 
1 149 LEU n 
1 150 MET n 
1 151 GLU n 
1 152 GLN n 
1 153 MET n 
1 154 LYS n 
1 155 ARG n 
1 156 ARG n 
1 157 LEU n 
1 158 MET n 
1 159 ASP n 
1 160 SER n 
1 161 VAL n 
1 162 LEU n 
1 163 ASP n 
1 164 VAL n 
1 165 GLU n 
1 166 VAL n 
1 167 GLN n 
1 168 ASP n 
1 169 GLU n 
1 170 LEU n 
1 171 MET n 
1 172 PHE n 
1 173 GLN n 
1 174 PHE n 
1 175 GLU n 
1 176 ARG n 
1 177 THR n 
1 178 ILE n 
1 179 LYS n 
1 180 LYS n 
1 181 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   181 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Cyanophage S-2L' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     260586 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3D1 non-polymer         . '(2R,3S,5R)-5-(6-amino-9H-purin-9-yl)-tetrahydro-2-(hydroxymethyl)furan-3-ol' "2'-DEOXYADENOSINE" 
'C10 H13 N5 O3'  251.242 
ALA 'L-peptide linking' y ALANINE                                                                       ?                   
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                                      ?                   
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                    ?                   
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                               ?                   
'C4 H7 N O4'     133.103 
CO  non-polymer         . 'COBALT (II) ION'                                                             ?                   'Co 2' 
58.933  
CYS 'L-peptide linking' y CYSTEINE                                                                      ?                   
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                     ?                   
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                               ?                   
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                       ?                   
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                     ?                   
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                         ?                   'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                    ?                   
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                       ?                   
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                        ?                   
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                    ?                   
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                 ?                   
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                       ?                   
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                        ?                   
'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                                     ?                   
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                    ?                   
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                      ?                   
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                        ?                   
'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -5  ?   ?   ?   A . n 
A 1 2   THR 2   -4  ?   ?   ?   A . n 
A 1 3   GLY 3   -3  ?   ?   ?   A . n 
A 1 4   ASP 4   -2  ?   ?   ?   A . n 
A 1 5   GLY 5   -1  ?   ?   ?   A . n 
A 1 6   SER 6   0   ?   ?   ?   A . n 
A 1 7   MET 7   1   ?   ?   ?   A . n 
A 1 8   THR 8   2   ?   ?   ?   A . n 
A 1 9   LEU 9   3   3   LEU LEU A . n 
A 1 10  GLN 10  4   4   GLN GLN A . n 
A 1 11  ILE 11  5   5   ILE ILE A . n 
A 1 12  THR 12  6   6   THR THR A . n 
A 1 13  GLU 13  7   7   GLU GLU A . n 
A 1 14  THR 14  8   8   THR THR A . n 
A 1 15  TYR 15  9   9   TYR TYR A . n 
A 1 16  GLU 16  10  10  GLU GLU A . n 
A 1 17  ARG 17  11  11  ARG ARG A . n 
A 1 18  LEU 18  12  12  LEU LEU A . n 
A 1 19  ARG 19  13  13  ARG ARG A . n 
A 1 20  ALA 20  14  14  ALA ALA A . n 
A 1 21  SER 21  15  15  SER SER A . n 
A 1 22  HIS 22  16  16  HIS HIS A . n 
A 1 23  ILE 23  17  17  ILE ILE A . n 
A 1 24  SER 24  18  18  SER SER A . n 
A 1 25  ARG 25  19  19  ARG ARG A . n 
A 1 26  TRP 26  20  20  TRP TRP A . n 
A 1 27  GLY 27  21  21  GLY GLY A . n 
A 1 28  ILE 28  22  22  ILE ILE A . n 
A 1 29  VAL 29  23  23  VAL VAL A . n 
A 1 30  GLN 30  24  24  GLN GLN A . n 
A 1 31  THR 31  25  25  THR THR A . n 
A 1 32  THR 32  26  26  THR THR A . n 
A 1 33  TYR 33  27  27  TYR TYR A . n 
A 1 34  PRO 34  28  28  PRO PRO A . n 
A 1 35  GLN 35  29  29  GLN GLN A . n 
A 1 36  ASN 36  30  30  ASN ASN A . n 
A 1 37  ILE 37  31  31  ILE ILE A . n 
A 1 38  ALA 38  32  32  ALA ALA A . n 
A 1 39  GLU 39  33  33  GLU GLU A . n 
A 1 40  HIS 40  34  34  HIS HIS A . n 
A 1 41  MET 41  35  35  MET MET A . n 
A 1 42  TRP 42  36  36  TRP TRP A . n 
A 1 43  ARG 43  37  37  ARG ARG A . n 
A 1 44  VAL 44  38  38  VAL VAL A . n 
A 1 45  TRP 45  39  39  TRP TRP A . n 
A 1 46  LEU 46  40  40  LEU LEU A . n 
A 1 47  LEU 47  41  41  LEU LEU A . n 
A 1 48  CYS 48  42  42  CYS CYS A . n 
A 1 49  ARG 49  43  43  ARG ARG A . n 
A 1 50  ASP 50  44  44  ASP ASP A . n 
A 1 51  TRP 51  45  45  TRP TRP A . n 
A 1 52  GLY 52  46  46  GLY GLY A . n 
A 1 53  ALA 53  47  47  ALA ALA A . n 
A 1 54  ALA 54  48  48  ALA ALA A . n 
A 1 55  ALA 55  49  49  ALA ALA A . n 
A 1 56  GLY 56  50  50  GLY GLY A . n 
A 1 57  MET 57  51  51  MET MET A . n 
A 1 58  PRO 58  52  52  PRO PRO A . n 
A 1 59  GLN 59  53  53  GLN GLN A . n 
A 1 60  HIS 60  54  54  HIS HIS A . n 
A 1 61  THR 61  55  55  THR THR A . n 
A 1 62  VAL 62  56  56  VAL VAL A . n 
A 1 63  ARG 63  57  57  ARG ARG A . n 
A 1 64  GLN 64  58  58  GLN GLN A . n 
A 1 65  ALA 65  59  59  ALA ALA A . n 
A 1 66  CYS 66  60  60  CYS CYS A . n 
A 1 67  GLU 67  61  61  GLU GLU A . n 
A 1 68  PHE 68  62  62  PHE PHE A . n 
A 1 69  ALA 69  63  63  ALA ALA A . n 
A 1 70  LEU 70  64  64  LEU LEU A . n 
A 1 71  VAL 71  65  65  VAL VAL A . n 
A 1 72  HIS 72  66  66  HIS HIS A . n 
A 1 73  ASP 73  67  67  ASP ASP A . n 
A 1 74  LEU 74  68  68  LEU LEU A . n 
A 1 75  ALA 75  69  69  ALA ALA A . n 
A 1 76  GLU 76  70  70  GLU GLU A . n 
A 1 77  ILE 77  71  71  ILE ILE A . n 
A 1 78  ARG 78  72  72  ARG ARG A . n 
A 1 79  THR 79  73  73  THR THR A . n 
A 1 80  GLY 80  74  74  GLY GLY A . n 
A 1 81  ASP 81  75  75  ASP ASP A . n 
A 1 82  ALA 82  76  76  ALA ALA A . n 
A 1 83  PRO 83  77  77  PRO PRO A . n 
A 1 84  THR 84  78  78  THR THR A . n 
A 1 85  PRO 85  79  79  PRO PRO A . n 
A 1 86  HIS 86  80  80  HIS HIS A . n 
A 1 87  LYS 87  81  81  LYS LYS A . n 
A 1 88  THR 88  82  82  THR THR A . n 
A 1 89  PRO 89  83  83  PRO PRO A . n 
A 1 90  GLU 90  84  84  GLU GLU A . n 
A 1 91  LEU 91  85  85  LEU LEU A . n 
A 1 92  LYS 92  86  86  LYS LYS A . n 
A 1 93  GLU 93  87  87  GLU GLU A . n 
A 1 94  LEU 94  88  88  LEU LEU A . n 
A 1 95  LEU 95  89  89  LEU LEU A . n 
A 1 96  ALA 96  90  90  ALA ALA A . n 
A 1 97  GLY 97  91  91  GLY GLY A . n 
A 1 98  ILE 98  92  92  ILE ILE A . n 
A 1 99  GLU 99  93  93  GLU GLU A . n 
A 1 100 ALA 100 94  94  ALA ALA A . n 
A 1 101 GLN 101 95  95  GLN GLN A . n 
A 1 102 ILE 102 96  96  ILE ILE A . n 
A 1 103 VAL 103 97  97  VAL VAL A . n 
A 1 104 PRO 104 98  98  PRO PRO A . n 
A 1 105 GLU 105 99  99  GLU GLU A . n 
A 1 106 VAL 106 100 100 VAL VAL A . n 
A 1 107 ALA 107 101 101 ALA ALA A . n 
A 1 108 GLU 108 102 102 GLU GLU A . n 
A 1 109 LEU 109 103 103 LEU LEU A . n 
A 1 110 GLU 110 104 104 GLU GLU A . n 
A 1 111 ALA 111 105 105 ALA ALA A . n 
A 1 112 THR 112 106 106 THR THR A . n 
A 1 113 MET 113 107 107 MET MET A . n 
A 1 114 ALA 114 108 108 ALA ALA A . n 
A 1 115 PRO 115 109 109 PRO PRO A . n 
A 1 116 GLU 116 110 110 GLU GLU A . n 
A 1 117 ALA 117 111 111 ALA ALA A . n 
A 1 118 ARG 118 112 112 ARG ARG A . n 
A 1 119 GLU 119 113 113 GLU GLU A . n 
A 1 120 LEU 120 114 114 LEU LEU A . n 
A 1 121 TRP 121 115 115 TRP TRP A . n 
A 1 122 LYS 122 116 116 LYS LYS A . n 
A 1 123 PHE 123 117 117 PHE PHE A . n 
A 1 124 CYS 124 118 118 CYS CYS A . n 
A 1 125 ASP 125 119 119 ASP ASP A . n 
A 1 126 THR 126 120 120 THR THR A . n 
A 1 127 ALA 127 121 121 ALA ALA A . n 
A 1 128 GLU 128 122 122 GLU GLU A . n 
A 1 129 ALA 129 123 123 ALA ALA A . n 
A 1 130 VAL 130 124 124 VAL VAL A . n 
A 1 131 LEU 131 125 125 LEU LEU A . n 
A 1 132 PHE 132 126 126 PHE PHE A . n 
A 1 133 LEU 133 127 127 LEU LEU A . n 
A 1 134 LYS 134 128 128 LYS LYS A . n 
A 1 135 VAL 135 129 129 VAL VAL A . n 
A 1 136 ASN 136 130 130 ASN ASN A . n 
A 1 137 GLY 137 131 131 GLY GLY A . n 
A 1 138 LEU 138 132 132 LEU LEU A . n 
A 1 139 GLY 139 133 133 GLY GLY A . n 
A 1 140 ALA 140 134 134 ALA ALA A . n 
A 1 141 HIS 141 135 135 HIS HIS A . n 
A 1 142 ALA 142 136 136 ALA ALA A . n 
A 1 143 TYR 143 137 137 TYR TYR A . n 
A 1 144 ASP 144 138 138 ASP ASP A . n 
A 1 145 VAL 145 139 139 VAL VAL A . n 
A 1 146 GLN 146 140 140 GLN GLN A . n 
A 1 147 HIS 147 141 141 HIS HIS A . n 
A 1 148 LEU 148 142 142 LEU LEU A . n 
A 1 149 LEU 149 143 143 LEU LEU A . n 
A 1 150 MET 150 144 144 MET MET A . n 
A 1 151 GLU 151 145 145 GLU GLU A . n 
A 1 152 GLN 152 146 146 GLN GLN A . n 
A 1 153 MET 153 147 147 MET MET A . n 
A 1 154 LYS 154 148 148 LYS LYS A . n 
A 1 155 ARG 155 149 149 ARG ARG A . n 
A 1 156 ARG 156 150 150 ARG ARG A . n 
A 1 157 LEU 157 151 151 LEU LEU A . n 
A 1 158 MET 158 152 152 MET MET A . n 
A 1 159 ASP 159 153 153 ASP ASP A . n 
A 1 160 SER 160 154 154 SER SER A . n 
A 1 161 VAL 161 155 155 VAL VAL A . n 
A 1 162 LEU 162 156 156 LEU LEU A . n 
A 1 163 ASP 163 157 157 ASP ASP A . n 
A 1 164 VAL 164 158 158 VAL VAL A . n 
A 1 165 GLU 165 159 159 GLU GLU A . n 
A 1 166 VAL 166 160 160 VAL VAL A . n 
A 1 167 GLN 167 161 161 GLN GLN A . n 
A 1 168 ASP 168 162 162 ASP ASP A . n 
A 1 169 GLU 169 163 163 GLU GLU A . n 
A 1 170 LEU 170 164 164 LEU LEU A . n 
A 1 171 MET 171 165 165 MET MET A . n 
A 1 172 PHE 172 166 166 PHE PHE A . n 
A 1 173 GLN 173 167 167 GLN GLN A . n 
A 1 174 PHE 174 168 168 PHE PHE A . n 
A 1 175 GLU 175 169 169 GLU GLU A . n 
A 1 176 ARG 176 170 170 ARG ARG A . n 
A 1 177 THR 177 171 171 THR THR A . n 
A 1 178 ILE 178 172 172 ILE ILE A . n 
A 1 179 LYS 179 173 173 LYS LYS A . n 
A 1 180 LYS 180 174 174 LYS LYS A . n 
A 1 181 THR 181 175 175 THR THR A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 3D1 1   201 1   3D1 3D1 A . 
C 3 CO  1   202 1   CO  CO  A . 
D 3 CO  1   203 2   CO  CO  A . 
E 3 CO  1   204 3   CO  CO  A . 
F 4 HOH 1   301 255 HOH HOH A . 
F 4 HOH 2   302 87  HOH HOH A . 
F 4 HOH 3   303 91  HOH HOH A . 
F 4 HOH 4   304 196 HOH HOH A . 
F 4 HOH 5   305 210 HOH HOH A . 
F 4 HOH 6   306 142 HOH HOH A . 
F 4 HOH 7   307 49  HOH HOH A . 
F 4 HOH 8   308 46  HOH HOH A . 
F 4 HOH 9   309 99  HOH HOH A . 
F 4 HOH 10  310 220 HOH HOH A . 
F 4 HOH 11  311 31  HOH HOH A . 
F 4 HOH 12  312 6   HOH HOH A . 
F 4 HOH 13  313 120 HOH HOH A . 
F 4 HOH 14  314 114 HOH HOH A . 
F 4 HOH 15  315 26  HOH HOH A . 
F 4 HOH 16  316 205 HOH HOH A . 
F 4 HOH 17  317 141 HOH HOH A . 
F 4 HOH 18  318 39  HOH HOH A . 
F 4 HOH 19  319 143 HOH HOH A . 
F 4 HOH 20  320 161 HOH HOH A . 
F 4 HOH 21  321 206 HOH HOH A . 
F 4 HOH 22  322 188 HOH HOH A . 
F 4 HOH 23  323 197 HOH HOH A . 
F 4 HOH 24  324 219 HOH HOH A . 
F 4 HOH 25  325 44  HOH HOH A . 
F 4 HOH 26  326 4   HOH HOH A . 
F 4 HOH 27  327 178 HOH HOH A . 
F 4 HOH 28  328 74  HOH HOH A . 
F 4 HOH 29  329 117 HOH HOH A . 
F 4 HOH 30  330 5   HOH HOH A . 
F 4 HOH 31  331 77  HOH HOH A . 
F 4 HOH 32  332 164 HOH HOH A . 
F 4 HOH 33  333 19  HOH HOH A . 
F 4 HOH 34  334 123 HOH HOH A . 
F 4 HOH 35  335 53  HOH HOH A . 
F 4 HOH 36  336 105 HOH HOH A . 
F 4 HOH 37  337 156 HOH HOH A . 
F 4 HOH 38  338 221 HOH HOH A . 
F 4 HOH 39  339 12  HOH HOH A . 
F 4 HOH 40  340 69  HOH HOH A . 
F 4 HOH 41  341 86  HOH HOH A . 
F 4 HOH 42  342 81  HOH HOH A . 
F 4 HOH 43  343 187 HOH HOH A . 
F 4 HOH 44  344 208 HOH HOH A . 
F 4 HOH 45  345 158 HOH HOH A . 
F 4 HOH 46  346 245 HOH HOH A . 
F 4 HOH 47  347 10  HOH HOH A . 
F 4 HOH 48  348 7   HOH HOH A . 
F 4 HOH 49  349 67  HOH HOH A . 
F 4 HOH 50  350 100 HOH HOH A . 
F 4 HOH 51  351 191 HOH HOH A . 
F 4 HOH 52  352 113 HOH HOH A . 
F 4 HOH 53  353 14  HOH HOH A . 
F 4 HOH 54  354 186 HOH HOH A . 
F 4 HOH 55  355 45  HOH HOH A . 
F 4 HOH 56  356 180 HOH HOH A . 
F 4 HOH 57  357 109 HOH HOH A . 
F 4 HOH 58  358 2   HOH HOH A . 
F 4 HOH 59  359 125 HOH HOH A . 
F 4 HOH 60  360 24  HOH HOH A . 
F 4 HOH 61  361 56  HOH HOH A . 
F 4 HOH 62  362 47  HOH HOH A . 
F 4 HOH 63  363 64  HOH HOH A . 
F 4 HOH 64  364 21  HOH HOH A . 
F 4 HOH 65  365 76  HOH HOH A . 
F 4 HOH 66  366 75  HOH HOH A . 
F 4 HOH 67  367 62  HOH HOH A . 
F 4 HOH 68  368 54  HOH HOH A . 
F 4 HOH 69  369 1   HOH HOH A . 
F 4 HOH 70  370 28  HOH HOH A . 
F 4 HOH 71  371 90  HOH HOH A . 
F 4 HOH 72  372 59  HOH HOH A . 
F 4 HOH 73  373 48  HOH HOH A . 
F 4 HOH 74  374 18  HOH HOH A . 
F 4 HOH 75  375 50  HOH HOH A . 
F 4 HOH 76  376 253 HOH HOH A . 
F 4 HOH 77  377 133 HOH HOH A . 
F 4 HOH 78  378 170 HOH HOH A . 
F 4 HOH 79  379 149 HOH HOH A . 
F 4 HOH 80  380 35  HOH HOH A . 
F 4 HOH 81  381 60  HOH HOH A . 
F 4 HOH 82  382 38  HOH HOH A . 
F 4 HOH 83  383 36  HOH HOH A . 
F 4 HOH 84  384 110 HOH HOH A . 
F 4 HOH 85  385 63  HOH HOH A . 
F 4 HOH 86  386 13  HOH HOH A . 
F 4 HOH 87  387 8   HOH HOH A . 
F 4 HOH 88  388 52  HOH HOH A . 
F 4 HOH 89  389 251 HOH HOH A . 
F 4 HOH 90  390 16  HOH HOH A . 
F 4 HOH 91  391 3   HOH HOH A . 
F 4 HOH 92  392 27  HOH HOH A . 
F 4 HOH 93  393 228 HOH HOH A . 
F 4 HOH 94  394 239 HOH HOH A . 
F 4 HOH 95  395 82  HOH HOH A . 
F 4 HOH 96  396 223 HOH HOH A . 
F 4 HOH 97  397 116 HOH HOH A . 
F 4 HOH 98  398 122 HOH HOH A . 
F 4 HOH 99  399 9   HOH HOH A . 
F 4 HOH 100 400 233 HOH HOH A . 
F 4 HOH 101 401 40  HOH HOH A . 
F 4 HOH 102 402 144 HOH HOH A . 
F 4 HOH 103 403 139 HOH HOH A . 
F 4 HOH 104 404 20  HOH HOH A . 
F 4 HOH 105 405 23  HOH HOH A . 
F 4 HOH 106 406 107 HOH HOH A . 
F 4 HOH 107 407 70  HOH HOH A . 
F 4 HOH 108 408 183 HOH HOH A . 
F 4 HOH 109 409 65  HOH HOH A . 
F 4 HOH 110 410 85  HOH HOH A . 
F 4 HOH 111 411 181 HOH HOH A . 
F 4 HOH 112 412 128 HOH HOH A . 
F 4 HOH 113 413 78  HOH HOH A . 
F 4 HOH 114 414 102 HOH HOH A . 
F 4 HOH 115 415 108 HOH HOH A . 
F 4 HOH 116 416 138 HOH HOH A . 
F 4 HOH 117 417 96  HOH HOH A . 
F 4 HOH 118 418 71  HOH HOH A . 
F 4 HOH 119 419 118 HOH HOH A . 
F 4 HOH 120 420 229 HOH HOH A . 
F 4 HOH 121 421 129 HOH HOH A . 
F 4 HOH 122 422 95  HOH HOH A . 
F 4 HOH 123 423 15  HOH HOH A . 
F 4 HOH 124 424 42  HOH HOH A . 
F 4 HOH 125 425 140 HOH HOH A . 
F 4 HOH 126 426 176 HOH HOH A . 
F 4 HOH 127 427 17  HOH HOH A . 
F 4 HOH 128 428 195 HOH HOH A . 
F 4 HOH 129 429 121 HOH HOH A . 
F 4 HOH 130 430 98  HOH HOH A . 
F 4 HOH 131 431 104 HOH HOH A . 
F 4 HOH 132 432 43  HOH HOH A . 
F 4 HOH 133 433 112 HOH HOH A . 
F 4 HOH 134 434 155 HOH HOH A . 
F 4 HOH 135 435 25  HOH HOH A . 
F 4 HOH 136 436 97  HOH HOH A . 
F 4 HOH 137 437 252 HOH HOH A . 
F 4 HOH 138 438 119 HOH HOH A . 
F 4 HOH 139 439 171 HOH HOH A . 
F 4 HOH 140 440 111 HOH HOH A . 
F 4 HOH 141 441 115 HOH HOH A . 
F 4 HOH 142 442 166 HOH HOH A . 
F 4 HOH 143 443 192 HOH HOH A . 
F 4 HOH 144 444 209 HOH HOH A . 
F 4 HOH 145 445 184 HOH HOH A . 
F 4 HOH 146 446 34  HOH HOH A . 
F 4 HOH 147 447 207 HOH HOH A . 
F 4 HOH 148 448 146 HOH HOH A . 
F 4 HOH 149 449 11  HOH HOH A . 
F 4 HOH 150 450 22  HOH HOH A . 
F 4 HOH 151 451 88  HOH HOH A . 
F 4 HOH 152 452 33  HOH HOH A . 
F 4 HOH 153 453 106 HOH HOH A . 
F 4 HOH 154 454 172 HOH HOH A . 
F 4 HOH 155 455 29  HOH HOH A . 
F 4 HOH 156 456 80  HOH HOH A . 
F 4 HOH 157 457 41  HOH HOH A . 
F 4 HOH 158 458 58  HOH HOH A . 
F 4 HOH 159 459 72  HOH HOH A . 
F 4 HOH 160 460 216 HOH HOH A . 
F 4 HOH 161 461 190 HOH HOH A . 
F 4 HOH 162 462 160 HOH HOH A . 
F 4 HOH 163 463 92  HOH HOH A . 
F 4 HOH 164 464 124 HOH HOH A . 
F 4 HOH 165 465 256 HOH HOH A . 
F 4 HOH 166 466 68  HOH HOH A . 
F 4 HOH 167 467 169 HOH HOH A . 
F 4 HOH 168 468 55  HOH HOH A . 
F 4 HOH 169 469 214 HOH HOH A . 
F 4 HOH 170 470 179 HOH HOH A . 
F 4 HOH 171 471 103 HOH HOH A . 
F 4 HOH 172 472 32  HOH HOH A . 
F 4 HOH 173 473 193 HOH HOH A . 
F 4 HOH 174 474 257 HOH HOH A . 
F 4 HOH 175 475 93  HOH HOH A . 
F 4 HOH 176 476 243 HOH HOH A . 
F 4 HOH 177 477 203 HOH HOH A . 
F 4 HOH 178 478 231 HOH HOH A . 
F 4 HOH 179 479 89  HOH HOH A . 
F 4 HOH 180 480 248 HOH HOH A . 
F 4 HOH 181 481 204 HOH HOH A . 
F 4 HOH 182 482 173 HOH HOH A . 
F 4 HOH 183 483 136 HOH HOH A . 
F 4 HOH 184 484 238 HOH HOH A . 
F 4 HOH 185 485 127 HOH HOH A . 
F 4 HOH 186 486 198 HOH HOH A . 
F 4 HOH 187 487 37  HOH HOH A . 
F 4 HOH 188 488 189 HOH HOH A . 
F 4 HOH 189 489 194 HOH HOH A . 
F 4 HOH 190 490 165 HOH HOH A . 
F 4 HOH 191 491 177 HOH HOH A . 
F 4 HOH 192 492 131 HOH HOH A . 
F 4 HOH 193 493 202 HOH HOH A . 
F 4 HOH 194 494 162 HOH HOH A . 
F 4 HOH 195 495 246 HOH HOH A . 
F 4 HOH 196 496 61  HOH HOH A . 
F 4 HOH 197 497 235 HOH HOH A . 
F 4 HOH 198 498 237 HOH HOH A . 
F 4 HOH 199 499 151 HOH HOH A . 
F 4 HOH 200 500 130 HOH HOH A . 
F 4 HOH 201 501 51  HOH HOH A . 
F 4 HOH 202 502 241 HOH HOH A . 
F 4 HOH 203 503 185 HOH HOH A . 
F 4 HOH 204 504 154 HOH HOH A . 
F 4 HOH 205 505 260 HOH HOH A . 
F 4 HOH 206 506 159 HOH HOH A . 
F 4 HOH 207 507 84  HOH HOH A . 
F 4 HOH 208 508 244 HOH HOH A . 
F 4 HOH 209 509 83  HOH HOH A . 
F 4 HOH 210 510 132 HOH HOH A . 
F 4 HOH 211 511 236 HOH HOH A . 
F 4 HOH 212 512 226 HOH HOH A . 
F 4 HOH 213 513 145 HOH HOH A . 
F 4 HOH 214 514 212 HOH HOH A . 
F 4 HOH 215 515 230 HOH HOH A . 
F 4 HOH 216 516 152 HOH HOH A . 
F 4 HOH 217 517 150 HOH HOH A . 
F 4 HOH 218 518 242 HOH HOH A . 
F 4 HOH 219 519 94  HOH HOH A . 
F 4 HOH 220 520 200 HOH HOH A . 
F 4 HOH 221 521 135 HOH HOH A . 
F 4 HOH 222 522 211 HOH HOH A . 
F 4 HOH 223 523 73  HOH HOH A . 
F 4 HOH 224 524 258 HOH HOH A . 
F 4 HOH 225 525 240 HOH HOH A . 
F 4 HOH 226 526 232 HOH HOH A . 
F 4 HOH 227 527 126 HOH HOH A . 
F 4 HOH 228 528 147 HOH HOH A . 
F 4 HOH 229 529 153 HOH HOH A . 
F 4 HOH 230 530 101 HOH HOH A . 
F 4 HOH 231 531 30  HOH HOH A . 
F 4 HOH 232 532 224 HOH HOH A . 
F 4 HOH 233 533 225 HOH HOH A . 
F 4 HOH 234 534 66  HOH HOH A . 
F 4 HOH 235 535 174 HOH HOH A . 
F 4 HOH 236 536 148 HOH HOH A . 
F 4 HOH 237 537 249 HOH HOH A . 
F 4 HOH 238 538 222 HOH HOH A . 
F 4 HOH 239 539 218 HOH HOH A . 
F 4 HOH 240 540 134 HOH HOH A . 
F 4 HOH 241 541 168 HOH HOH A . 
F 4 HOH 242 542 259 HOH HOH A . 
F 4 HOH 243 543 234 HOH HOH A . 
F 4 HOH 244 544 199 HOH HOH A . 
F 4 HOH 245 545 137 HOH HOH A . 
F 4 HOH 246 546 175 HOH HOH A . 
F 4 HOH 247 547 157 HOH HOH A . 
F 4 HOH 248 548 227 HOH HOH A . 
F 4 HOH 249 549 79  HOH HOH A . 
F 4 HOH 250 550 247 HOH HOH A . 
F 4 HOH 251 551 57  HOH HOH A . 
F 4 HOH 252 552 201 HOH HOH A . 
F 4 HOH 253 553 254 HOH HOH A . 
F 4 HOH 254 554 213 HOH HOH A . 
F 4 HOH 255 555 182 HOH HOH A . 
F 4 HOH 256 556 163 HOH HOH A . 
F 4 HOH 257 557 217 HOH HOH A . 
F 4 HOH 258 558 167 HOH HOH A . 
F 4 HOH 259 559 250 HOH HOH A . 
F 4 HOH 260 560 215 HOH HOH A . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? 1.11.1_2575 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .           2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .           3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? SHELXCD ? ? ? .           4 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6ZPB 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     141.827 
_cell.length_a_esd                 ? 
_cell.length_b                     141.827 
_cell.length_b_esd                 ? 
_cell.length_c                     53.725 
_cell.length_c_esd                 ? 
_cell.volume                       935890.177 
_cell.volume_esd                   ? 
_cell.Z_PDB                        18 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6ZPB 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
_symmetry.space_group_name_Hall            
;R 3 2"
;
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6ZPB 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.53 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         51.29 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '1.5 M LiSO4; 100 mM HEPES; 10 mM CoCl2' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      'KB Mirrors' 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-12-07 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Si 111' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.033202 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SOLEIL BEAMLINE PROXIMA 1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.033202 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   'PROXIMA 1' 
_diffrn_source.pdbx_synchrotron_site       SOLEIL 
# 
_reflns.B_iso_Wilson_estimate            14.0930917762 
_reflns.entry_id                         6ZPB 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.72 
_reflns.d_resolution_low                 40.44 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       21613 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.4 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  14.2 
_reflns.pdbx_Rmerge_I_obs                0.083 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            25.0 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.086 
_reflns.pdbx_Rpim_I_all                  0.022 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.72 
_reflns_shell.d_res_low                   1.77 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         5.1 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1400 
_reflns_shell.percent_possible_all        88 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.307 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             5.7 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.338 
_reflns_shell.pdbx_Rpim_I_all             0.137 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.939 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               17.5063621561 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6ZPB 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.72097384171 
_refine.ls_d_res_low                             40.4358636633 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     21599 
_refine.ls_number_reflns_R_free                  1053 
_refine.ls_number_reflns_R_work                  20546 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.2934376991 
_refine.ls_percent_reflns_R_free                 4.87522570489 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.147191339442 
_refine.ls_R_factor_R_free                       0.170205185922 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.146001949293 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.45045910224 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       'GeoStd + Monomer Library + CDL v1.2' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 16.9899637983 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.165812802632 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.72097384171 
_refine_hist.d_res_low                        40.4358636633 
_refine_hist.number_atoms_solvent             260 
_refine_hist.number_atoms_total               1676 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        1395 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         21 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0110429934832  ? 1510 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.28193811578    ? 2065 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.101106111192   ? 234  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.00895704191404 ? 278  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 18.1671548412    ? 582  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.721  1.7993        . . 116 2312 89.4950239587 . . . 0.249740831719 . 0.186078132898 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7993 1.8942        . . 130 2536 96.8398111151 . . . 0.230112080881 . 0.162056853859 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8942 2.0128        . . 125 2582 99.9630723781 . . . 0.217576735014 . 0.151927867819 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0128 2.1682        . . 130 2610 99.9635169646 . . . 0.174754866908 . 0.137071381244 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1682 2.3864        . . 136 2589 99.9633162142 . . . 0.159486972059 . 0.142466976763 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3864 2.7317        . . 137 2600 100.0         . . . 0.149781455428 . 0.142566267306 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7317 3.4413        . . 138 2630 100.0         . . . 0.184963368192 . 0.141803948977 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4413 40.4358636633 . . 141 2687 100.0         . . . 0.139382248674 . 0.143302349993 . . . . . . . . . . . 
# 
_struct.entry_id                     6ZPB 
_struct.title                        'Cyanophage S-2L HD phosphohydrolase (DatZ) bound to dA and two catalytic Co2+ ions' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6ZPB 
_struct_keywords.text            'S-2L, HD phosphohydrolase, DatZ, VIRAL PROTEIN' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    6ZPB 
_struct_ref.pdbx_db_accession          6ZPB 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6ZPB 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 181 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             6ZPB 
_struct_ref_seq.db_align_beg                  -5 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  175 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       -5 
_struct_ref_seq.pdbx_auth_seq_align_end       175 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 22180 ? 
1 MORE         -234  ? 
1 'SSA (A^2)'  40160 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4,5,6 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_auth_evidence.id 
_pdbx_struct_assembly_auth_evidence.assembly_id 
_pdbx_struct_assembly_auth_evidence.experimental_support 
_pdbx_struct_assembly_auth_evidence.details 
1 1 'equilibrium centrifugation' ? 
2 1 'light scattering'           ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z      1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_555 -y,x-y,z   -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038  -0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
3 'crystal symmetry operation' 3_555 -x+y,-x,z  -0.5000000000 0.8660254038  0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
4 'crystal symmetry operation' 4_555 y,x,-z     -0.5000000000 0.8660254038  0.0000000000 0.0000000000 0.8660254038  0.5000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
5 'crystal symmetry operation' 5_555 x-y,-y,-z  1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
6 'crystal symmetry operation' 6_555 -x,-x+y,-z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLU A 13  ? LEU A 18  ? GLU A 7   LEU A 12  1 ? 6  
HELX_P HELX_P2  AA2 ARG A 19  ? ILE A 23  ? ARG A 13  ILE A 17  5 ? 5  
HELX_P HELX_P3  AA3 ASN A 36  ? ALA A 55  ? ASN A 30  ALA A 49  1 ? 20 
HELX_P HELX_P4  AA4 PRO A 58  ? LEU A 70  ? PRO A 52  LEU A 64  1 ? 13 
HELX_P HELX_P5  AA5 ALA A 75  ? GLY A 80  ? ALA A 69  GLY A 74  1 ? 6  
HELX_P HELX_P6  AA6 PRO A 83  ? LYS A 87  ? PRO A 77  LYS A 81  5 ? 5  
HELX_P HELX_P7  AA7 THR A 88  ? VAL A 103 ? THR A 82  VAL A 97  1 ? 16 
HELX_P HELX_P8  AA8 VAL A 103 ? MET A 113 ? VAL A 97  MET A 107 1 ? 11 
HELX_P HELX_P9  AA9 ALA A 114 ? GLY A 137 ? ALA A 108 GLY A 131 1 ? 24 
HELX_P HELX_P10 AB1 GLY A 139 ? ASP A 159 ? GLY A 133 ASP A 153 1 ? 21 
HELX_P HELX_P11 AB2 ASP A 163 ? LYS A 180 ? ASP A 157 LYS A 174 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A HIS 40  NE2   ? ? ? 1_555 C CO  . CO ? ? A HIS 34  A CO  202 1_555 ? ? ? ? ? ? ? 2.120 ? ? 
metalc2  metalc ? ? A HIS 72  NE2   ? ? ? 1_555 C CO  . CO ? ? A HIS 66  A CO  202 1_555 ? ? ? ? ? ? ? 2.122 ? ? 
metalc3  metalc ? ? A ASP 73  OD2   ? ? ? 1_555 C CO  . CO ? ? A ASP 67  A CO  202 1_555 ? ? ? ? ? ? ? 2.138 ? ? 
metalc4  metalc ? ? A GLU 76  OE2   ? ? ? 1_555 D CO  . CO ? ? A GLU 70  A CO  203 1_555 ? ? ? ? ? ? ? 2.099 ? ? 
metalc5  metalc ? ? A ASP 81  OD1   ? ? ? 1_555 D CO  . CO ? ? A ASP 75  A CO  203 1_555 ? ? ? ? ? ? ? 2.015 ? ? 
metalc6  metalc ? ? A ASP 125 OD1   ? ? ? 1_555 C CO  . CO ? ? A ASP 119 A CO  202 1_555 ? ? ? ? ? ? ? 2.159 ? ? 
metalc7  metalc ? ? A GLU 169 OE1   ? ? ? 1_555 E CO  . CO ? ? A GLU 163 A CO  204 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc8  metalc ? ? B 3D1 .   "O5'" ? ? ? 1_555 D CO  . CO ? ? A 3D1 201 A CO  203 1_555 ? ? ? ? ? ? ? 2.168 ? ? 
metalc9  metalc ? ? C CO  .   CO    ? ? ? 1_555 F HOH . O  ? ? A CO  202 A HOH 322 1_555 ? ? ? ? ? ? ? 2.185 ? ? 
metalc10 metalc ? ? C CO  .   CO    ? ? ? 1_555 F HOH . O  ? ? A CO  202 A HOH 447 1_555 ? ? ? ? ? ? ? 2.291 ? ? 
metalc11 metalc ? ? D CO  .   CO    ? ? ? 1_555 F HOH . O  ? ? A CO  203 A HOH 303 1_555 ? ? ? ? ? ? ? 2.125 ? ? 
metalc12 metalc ? ? D CO  .   CO    ? ? ? 1_555 F HOH . O  ? ? A CO  203 A HOH 316 1_555 ? ? ? ? ? ? ? 2.160 ? ? 
metalc13 metalc ? ? D CO  .   CO    ? ? ? 1_555 F HOH . O  ? ? A CO  203 A HOH 321 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
metalc14 metalc ? ? E CO  .   CO    ? ? ? 1_555 F HOH . O  ? ? A CO  204 A HOH 319 1_555 ? ? ? ? ? ? ? 2.639 ? ? 
metalc15 metalc ? ? E CO  .   CO    ? ? ? 1_555 F HOH . O  ? ? A CO  204 A HOH 433 4_554 ? ? ? ? ? ? ? 2.617 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2   ? A HIS 40  ? A HIS 34  ? 1_555 CO ? C CO . ? A CO 202 ? 1_555 NE2   ? A HIS 72  ? A HIS 66  ? 1_555 102.0 ? 
2  NE2   ? A HIS 40  ? A HIS 34  ? 1_555 CO ? C CO . ? A CO 202 ? 1_555 OD2   ? A ASP 73  ? A ASP 67  ? 1_555 89.5  ? 
3  NE2   ? A HIS 72  ? A HIS 66  ? 1_555 CO ? C CO . ? A CO 202 ? 1_555 OD2   ? A ASP 73  ? A ASP 67  ? 1_555 83.0  ? 
4  NE2   ? A HIS 40  ? A HIS 34  ? 1_555 CO ? C CO . ? A CO 202 ? 1_555 OD1   ? A ASP 125 ? A ASP 119 ? 1_555 88.5  ? 
5  NE2   ? A HIS 72  ? A HIS 66  ? 1_555 CO ? C CO . ? A CO 202 ? 1_555 OD1   ? A ASP 125 ? A ASP 119 ? 1_555 92.4  ? 
6  OD2   ? A ASP 73  ? A ASP 67  ? 1_555 CO ? C CO . ? A CO 202 ? 1_555 OD1   ? A ASP 125 ? A ASP 119 ? 1_555 174.5 ? 
7  NE2   ? A HIS 40  ? A HIS 34  ? 1_555 CO ? C CO . ? A CO 202 ? 1_555 O     ? F HOH .   ? A HOH 322 ? 1_555 168.8 ? 
8  NE2   ? A HIS 72  ? A HIS 66  ? 1_555 CO ? C CO . ? A CO 202 ? 1_555 O     ? F HOH .   ? A HOH 322 ? 1_555 88.6  ? 
9  OD2   ? A ASP 73  ? A ASP 67  ? 1_555 CO ? C CO . ? A CO 202 ? 1_555 O     ? F HOH .   ? A HOH 322 ? 1_555 95.6  ? 
10 OD1   ? A ASP 125 ? A ASP 119 ? 1_555 CO ? C CO . ? A CO 202 ? 1_555 O     ? F HOH .   ? A HOH 322 ? 1_555 87.3  ? 
11 NE2   ? A HIS 40  ? A HIS 34  ? 1_555 CO ? C CO . ? A CO 202 ? 1_555 O     ? F HOH .   ? A HOH 447 ? 1_555 87.5  ? 
12 NE2   ? A HIS 72  ? A HIS 66  ? 1_555 CO ? C CO . ? A CO 202 ? 1_555 O     ? F HOH .   ? A HOH 447 ? 1_555 170.3 ? 
13 OD2   ? A ASP 73  ? A ASP 67  ? 1_555 CO ? C CO . ? A CO 202 ? 1_555 O     ? F HOH .   ? A HOH 447 ? 1_555 99.0  ? 
14 OD1   ? A ASP 125 ? A ASP 119 ? 1_555 CO ? C CO . ? A CO 202 ? 1_555 O     ? F HOH .   ? A HOH 447 ? 1_555 86.0  ? 
15 O     ? F HOH .   ? A HOH 322 ? 1_555 CO ? C CO . ? A CO 202 ? 1_555 O     ? F HOH .   ? A HOH 447 ? 1_555 81.8  ? 
16 OE2   ? A GLU 76  ? A GLU 70  ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 OD1   ? A ASP 81  ? A ASP 75  ? 1_555 91.4  ? 
17 OE2   ? A GLU 76  ? A GLU 70  ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 "O5'" ? B 3D1 .   ? A 3D1 201 ? 1_555 169.6 ? 
18 OD1   ? A ASP 81  ? A ASP 75  ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 "O5'" ? B 3D1 .   ? A 3D1 201 ? 1_555 97.1  ? 
19 OE2   ? A GLU 76  ? A GLU 70  ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O     ? F HOH .   ? A HOH 303 ? 1_555 86.4  ? 
20 OD1   ? A ASP 81  ? A ASP 75  ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O     ? F HOH .   ? A HOH 303 ? 1_555 93.3  ? 
21 "O5'" ? B 3D1 .   ? A 3D1 201 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O     ? F HOH .   ? A HOH 303 ? 1_555 99.0  ? 
22 OE2   ? A GLU 76  ? A GLU 70  ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O     ? F HOH .   ? A HOH 316 ? 1_555 92.8  ? 
23 OD1   ? A ASP 81  ? A ASP 75  ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O     ? F HOH .   ? A HOH 316 ? 1_555 85.7  ? 
24 "O5'" ? B 3D1 .   ? A 3D1 201 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O     ? F HOH .   ? A HOH 316 ? 1_555 82.0  ? 
25 O     ? F HOH .   ? A HOH 303 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O     ? F HOH .   ? A HOH 316 ? 1_555 178.6 ? 
26 OE2   ? A GLU 76  ? A GLU 70  ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O     ? F HOH .   ? A HOH 321 ? 1_555 93.4  ? 
27 OD1   ? A ASP 81  ? A ASP 75  ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O     ? F HOH .   ? A HOH 321 ? 1_555 174.8 ? 
28 "O5'" ? B 3D1 .   ? A 3D1 201 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O     ? F HOH .   ? A HOH 321 ? 1_555 78.3  ? 
29 O     ? F HOH .   ? A HOH 303 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O     ? F HOH .   ? A HOH 321 ? 1_555 85.2  ? 
30 O     ? F HOH .   ? A HOH 316 ? 1_555 CO ? D CO . ? A CO 203 ? 1_555 O     ? F HOH .   ? A HOH 321 ? 1_555 96.0  ? 
31 OE1   ? A GLU 169 ? A GLU 163 ? 1_555 CO ? E CO . ? A CO 204 ? 1_555 O     ? F HOH .   ? A HOH 319 ? 1_555 64.0  ? 
32 OE1   ? A GLU 169 ? A GLU 163 ? 1_555 CO ? E CO . ? A CO 204 ? 1_555 O     ? F HOH .   ? A HOH 433 ? 4_554 134.2 ? 
33 O     ? F HOH .   ? A HOH 319 ? 1_555 CO ? E CO . ? A CO 204 ? 1_555 O     ? F HOH .   ? A HOH 433 ? 4_554 109.6 ? 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     506 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     506 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_554 
_pdbx_validate_symm_contact.dist              0.96 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ARG 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     13 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -69.92 
_pdbx_validate_torsion.psi             4.99 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 382 ? F HOH . 
2 1 A HOH 445 ? F HOH . 
3 1 A HOH 491 ? F HOH . 
4 1 A HOH 497 ? F HOH . 
5 1 A HOH 508 ? F HOH . 
6 1 A HOH 511 ? F HOH . 
7 1 A HOH 523 ? F HOH . 
8 1 A HOH 555 ? F HOH . 
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1  x,y,z                  
2  -y,x-y,z               
3  -x+y,-x,z              
4  x-y,-y,-z              
5  -x,-x+y,-z             
6  y,x,-z                 
7  x+1/3,y+2/3,z+2/3      
8  -y+1/3,x-y+2/3,z+2/3   
9  -x+y+1/3,-x+2/3,z+2/3  
10 x-y+1/3,-y+2/3,-z+2/3  
11 -x+1/3,-x+y+2/3,-z+2/3 
12 y+1/3,x+2/3,-z+2/3     
13 x+2/3,y+1/3,z+1/3      
14 -y+2/3,x-y+1/3,z+1/3   
15 -x+y+2/3,-x+1/3,z+1/3  
16 x-y+2/3,-y+1/3,-z+1/3  
17 -x+2/3,-x+y+1/3,-z+1/3 
18 y+2/3,x+1/3,-z+1/3     
# 
_pdbx_entry_details.entry_id                 6ZPB 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.has_ligand_of_interest   Y 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       560 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   5.99 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY -5 ? A GLY 1 
2 1 Y 1 A THR -4 ? A THR 2 
3 1 Y 1 A GLY -3 ? A GLY 3 
4 1 Y 1 A ASP -2 ? A ASP 4 
5 1 Y 1 A GLY -1 ? A GLY 5 
6 1 Y 1 A SER 0  ? A SER 6 
7 1 Y 1 A MET 1  ? A MET 7 
8 1 Y 1 A THR 2  ? A THR 8 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
3D1 "O5'"  O  N N 1   
3D1 "C5'"  C  N N 2   
3D1 "C4'"  C  N R 3   
3D1 "O4'"  O  N N 4   
3D1 "C1'"  C  N R 5   
3D1 N9     N  Y N 6   
3D1 C4     C  Y N 7   
3D1 N3     N  Y N 8   
3D1 C2     C  Y N 9   
3D1 N1     N  Y N 10  
3D1 C6     C  Y N 11  
3D1 N6     N  N N 12  
3D1 C5     C  Y N 13  
3D1 N7     N  Y N 14  
3D1 C8     C  Y N 15  
3D1 "C2'"  C  N N 16  
3D1 "C3'"  C  N S 17  
3D1 "O3'"  O  N N 18  
3D1 "H5'"  H  N N 19  
3D1 "H5'1" H  N N 20  
3D1 "H5'2" H  N N 21  
3D1 "H4'"  H  N N 22  
3D1 "H1'"  H  N N 23  
3D1 H2     H  N N 24  
3D1 HN61   H  N N 25  
3D1 HN62   H  N N 26  
3D1 H8     H  N N 27  
3D1 "H2'1" H  N N 28  
3D1 "H2'2" H  N N 29  
3D1 "H3'"  H  N N 30  
3D1 H1     H  N N 31  
ALA N      N  N N 32  
ALA CA     C  N S 33  
ALA C      C  N N 34  
ALA O      O  N N 35  
ALA CB     C  N N 36  
ALA OXT    O  N N 37  
ALA H      H  N N 38  
ALA H2     H  N N 39  
ALA HA     H  N N 40  
ALA HB1    H  N N 41  
ALA HB2    H  N N 42  
ALA HB3    H  N N 43  
ALA HXT    H  N N 44  
ARG N      N  N N 45  
ARG CA     C  N S 46  
ARG C      C  N N 47  
ARG O      O  N N 48  
ARG CB     C  N N 49  
ARG CG     C  N N 50  
ARG CD     C  N N 51  
ARG NE     N  N N 52  
ARG CZ     C  N N 53  
ARG NH1    N  N N 54  
ARG NH2    N  N N 55  
ARG OXT    O  N N 56  
ARG H      H  N N 57  
ARG H2     H  N N 58  
ARG HA     H  N N 59  
ARG HB2    H  N N 60  
ARG HB3    H  N N 61  
ARG HG2    H  N N 62  
ARG HG3    H  N N 63  
ARG HD2    H  N N 64  
ARG HD3    H  N N 65  
ARG HE     H  N N 66  
ARG HH11   H  N N 67  
ARG HH12   H  N N 68  
ARG HH21   H  N N 69  
ARG HH22   H  N N 70  
ARG HXT    H  N N 71  
ASN N      N  N N 72  
ASN CA     C  N S 73  
ASN C      C  N N 74  
ASN O      O  N N 75  
ASN CB     C  N N 76  
ASN CG     C  N N 77  
ASN OD1    O  N N 78  
ASN ND2    N  N N 79  
ASN OXT    O  N N 80  
ASN H      H  N N 81  
ASN H2     H  N N 82  
ASN HA     H  N N 83  
ASN HB2    H  N N 84  
ASN HB3    H  N N 85  
ASN HD21   H  N N 86  
ASN HD22   H  N N 87  
ASN HXT    H  N N 88  
ASP N      N  N N 89  
ASP CA     C  N S 90  
ASP C      C  N N 91  
ASP O      O  N N 92  
ASP CB     C  N N 93  
ASP CG     C  N N 94  
ASP OD1    O  N N 95  
ASP OD2    O  N N 96  
ASP OXT    O  N N 97  
ASP H      H  N N 98  
ASP H2     H  N N 99  
ASP HA     H  N N 100 
ASP HB2    H  N N 101 
ASP HB3    H  N N 102 
ASP HD2    H  N N 103 
ASP HXT    H  N N 104 
CO  CO     CO N N 105 
CYS N      N  N N 106 
CYS CA     C  N R 107 
CYS C      C  N N 108 
CYS O      O  N N 109 
CYS CB     C  N N 110 
CYS SG     S  N N 111 
CYS OXT    O  N N 112 
CYS H      H  N N 113 
CYS H2     H  N N 114 
CYS HA     H  N N 115 
CYS HB2    H  N N 116 
CYS HB3    H  N N 117 
CYS HG     H  N N 118 
CYS HXT    H  N N 119 
GLN N      N  N N 120 
GLN CA     C  N S 121 
GLN C      C  N N 122 
GLN O      O  N N 123 
GLN CB     C  N N 124 
GLN CG     C  N N 125 
GLN CD     C  N N 126 
GLN OE1    O  N N 127 
GLN NE2    N  N N 128 
GLN OXT    O  N N 129 
GLN H      H  N N 130 
GLN H2     H  N N 131 
GLN HA     H  N N 132 
GLN HB2    H  N N 133 
GLN HB3    H  N N 134 
GLN HG2    H  N N 135 
GLN HG3    H  N N 136 
GLN HE21   H  N N 137 
GLN HE22   H  N N 138 
GLN HXT    H  N N 139 
GLU N      N  N N 140 
GLU CA     C  N S 141 
GLU C      C  N N 142 
GLU O      O  N N 143 
GLU CB     C  N N 144 
GLU CG     C  N N 145 
GLU CD     C  N N 146 
GLU OE1    O  N N 147 
GLU OE2    O  N N 148 
GLU OXT    O  N N 149 
GLU H      H  N N 150 
GLU H2     H  N N 151 
GLU HA     H  N N 152 
GLU HB2    H  N N 153 
GLU HB3    H  N N 154 
GLU HG2    H  N N 155 
GLU HG3    H  N N 156 
GLU HE2    H  N N 157 
GLU HXT    H  N N 158 
GLY N      N  N N 159 
GLY CA     C  N N 160 
GLY C      C  N N 161 
GLY O      O  N N 162 
GLY OXT    O  N N 163 
GLY H      H  N N 164 
GLY H2     H  N N 165 
GLY HA2    H  N N 166 
GLY HA3    H  N N 167 
GLY HXT    H  N N 168 
HIS N      N  N N 169 
HIS CA     C  N S 170 
HIS C      C  N N 171 
HIS O      O  N N 172 
HIS CB     C  N N 173 
HIS CG     C  Y N 174 
HIS ND1    N  Y N 175 
HIS CD2    C  Y N 176 
HIS CE1    C  Y N 177 
HIS NE2    N  Y N 178 
HIS OXT    O  N N 179 
HIS H      H  N N 180 
HIS H2     H  N N 181 
HIS HA     H  N N 182 
HIS HB2    H  N N 183 
HIS HB3    H  N N 184 
HIS HD1    H  N N 185 
HIS HD2    H  N N 186 
HIS HE1    H  N N 187 
HIS HE2    H  N N 188 
HIS HXT    H  N N 189 
HOH O      O  N N 190 
HOH H1     H  N N 191 
HOH H2     H  N N 192 
ILE N      N  N N 193 
ILE CA     C  N S 194 
ILE C      C  N N 195 
ILE O      O  N N 196 
ILE CB     C  N S 197 
ILE CG1    C  N N 198 
ILE CG2    C  N N 199 
ILE CD1    C  N N 200 
ILE OXT    O  N N 201 
ILE H      H  N N 202 
ILE H2     H  N N 203 
ILE HA     H  N N 204 
ILE HB     H  N N 205 
ILE HG12   H  N N 206 
ILE HG13   H  N N 207 
ILE HG21   H  N N 208 
ILE HG22   H  N N 209 
ILE HG23   H  N N 210 
ILE HD11   H  N N 211 
ILE HD12   H  N N 212 
ILE HD13   H  N N 213 
ILE HXT    H  N N 214 
LEU N      N  N N 215 
LEU CA     C  N S 216 
LEU C      C  N N 217 
LEU O      O  N N 218 
LEU CB     C  N N 219 
LEU CG     C  N N 220 
LEU CD1    C  N N 221 
LEU CD2    C  N N 222 
LEU OXT    O  N N 223 
LEU H      H  N N 224 
LEU H2     H  N N 225 
LEU HA     H  N N 226 
LEU HB2    H  N N 227 
LEU HB3    H  N N 228 
LEU HG     H  N N 229 
LEU HD11   H  N N 230 
LEU HD12   H  N N 231 
LEU HD13   H  N N 232 
LEU HD21   H  N N 233 
LEU HD22   H  N N 234 
LEU HD23   H  N N 235 
LEU HXT    H  N N 236 
LYS N      N  N N 237 
LYS CA     C  N S 238 
LYS C      C  N N 239 
LYS O      O  N N 240 
LYS CB     C  N N 241 
LYS CG     C  N N 242 
LYS CD     C  N N 243 
LYS CE     C  N N 244 
LYS NZ     N  N N 245 
LYS OXT    O  N N 246 
LYS H      H  N N 247 
LYS H2     H  N N 248 
LYS HA     H  N N 249 
LYS HB2    H  N N 250 
LYS HB3    H  N N 251 
LYS HG2    H  N N 252 
LYS HG3    H  N N 253 
LYS HD2    H  N N 254 
LYS HD3    H  N N 255 
LYS HE2    H  N N 256 
LYS HE3    H  N N 257 
LYS HZ1    H  N N 258 
LYS HZ2    H  N N 259 
LYS HZ3    H  N N 260 
LYS HXT    H  N N 261 
MET N      N  N N 262 
MET CA     C  N S 263 
MET C      C  N N 264 
MET O      O  N N 265 
MET CB     C  N N 266 
MET CG     C  N N 267 
MET SD     S  N N 268 
MET CE     C  N N 269 
MET OXT    O  N N 270 
MET H      H  N N 271 
MET H2     H  N N 272 
MET HA     H  N N 273 
MET HB2    H  N N 274 
MET HB3    H  N N 275 
MET HG2    H  N N 276 
MET HG3    H  N N 277 
MET HE1    H  N N 278 
MET HE2    H  N N 279 
MET HE3    H  N N 280 
MET HXT    H  N N 281 
PHE N      N  N N 282 
PHE CA     C  N S 283 
PHE C      C  N N 284 
PHE O      O  N N 285 
PHE CB     C  N N 286 
PHE CG     C  Y N 287 
PHE CD1    C  Y N 288 
PHE CD2    C  Y N 289 
PHE CE1    C  Y N 290 
PHE CE2    C  Y N 291 
PHE CZ     C  Y N 292 
PHE OXT    O  N N 293 
PHE H      H  N N 294 
PHE H2     H  N N 295 
PHE HA     H  N N 296 
PHE HB2    H  N N 297 
PHE HB3    H  N N 298 
PHE HD1    H  N N 299 
PHE HD2    H  N N 300 
PHE HE1    H  N N 301 
PHE HE2    H  N N 302 
PHE HZ     H  N N 303 
PHE HXT    H  N N 304 
PRO N      N  N N 305 
PRO CA     C  N S 306 
PRO C      C  N N 307 
PRO O      O  N N 308 
PRO CB     C  N N 309 
PRO CG     C  N N 310 
PRO CD     C  N N 311 
PRO OXT    O  N N 312 
PRO H      H  N N 313 
PRO HA     H  N N 314 
PRO HB2    H  N N 315 
PRO HB3    H  N N 316 
PRO HG2    H  N N 317 
PRO HG3    H  N N 318 
PRO HD2    H  N N 319 
PRO HD3    H  N N 320 
PRO HXT    H  N N 321 
SER N      N  N N 322 
SER CA     C  N S 323 
SER C      C  N N 324 
SER O      O  N N 325 
SER CB     C  N N 326 
SER OG     O  N N 327 
SER OXT    O  N N 328 
SER H      H  N N 329 
SER H2     H  N N 330 
SER HA     H  N N 331 
SER HB2    H  N N 332 
SER HB3    H  N N 333 
SER HG     H  N N 334 
SER HXT    H  N N 335 
THR N      N  N N 336 
THR CA     C  N S 337 
THR C      C  N N 338 
THR O      O  N N 339 
THR CB     C  N R 340 
THR OG1    O  N N 341 
THR CG2    C  N N 342 
THR OXT    O  N N 343 
THR H      H  N N 344 
THR H2     H  N N 345 
THR HA     H  N N 346 
THR HB     H  N N 347 
THR HG1    H  N N 348 
THR HG21   H  N N 349 
THR HG22   H  N N 350 
THR HG23   H  N N 351 
THR HXT    H  N N 352 
TRP N      N  N N 353 
TRP CA     C  N S 354 
TRP C      C  N N 355 
TRP O      O  N N 356 
TRP CB     C  N N 357 
TRP CG     C  Y N 358 
TRP CD1    C  Y N 359 
TRP CD2    C  Y N 360 
TRP NE1    N  Y N 361 
TRP CE2    C  Y N 362 
TRP CE3    C  Y N 363 
TRP CZ2    C  Y N 364 
TRP CZ3    C  Y N 365 
TRP CH2    C  Y N 366 
TRP OXT    O  N N 367 
TRP H      H  N N 368 
TRP H2     H  N N 369 
TRP HA     H  N N 370 
TRP HB2    H  N N 371 
TRP HB3    H  N N 372 
TRP HD1    H  N N 373 
TRP HE1    H  N N 374 
TRP HE3    H  N N 375 
TRP HZ2    H  N N 376 
TRP HZ3    H  N N 377 
TRP HH2    H  N N 378 
TRP HXT    H  N N 379 
TYR N      N  N N 380 
TYR CA     C  N S 381 
TYR C      C  N N 382 
TYR O      O  N N 383 
TYR CB     C  N N 384 
TYR CG     C  Y N 385 
TYR CD1    C  Y N 386 
TYR CD2    C  Y N 387 
TYR CE1    C  Y N 388 
TYR CE2    C  Y N 389 
TYR CZ     C  Y N 390 
TYR OH     O  N N 391 
TYR OXT    O  N N 392 
TYR H      H  N N 393 
TYR H2     H  N N 394 
TYR HA     H  N N 395 
TYR HB2    H  N N 396 
TYR HB3    H  N N 397 
TYR HD1    H  N N 398 
TYR HD2    H  N N 399 
TYR HE1    H  N N 400 
TYR HE2    H  N N 401 
TYR HH     H  N N 402 
TYR HXT    H  N N 403 
VAL N      N  N N 404 
VAL CA     C  N S 405 
VAL C      C  N N 406 
VAL O      O  N N 407 
VAL CB     C  N N 408 
VAL CG1    C  N N 409 
VAL CG2    C  N N 410 
VAL OXT    O  N N 411 
VAL H      H  N N 412 
VAL H2     H  N N 413 
VAL HA     H  N N 414 
VAL HB     H  N N 415 
VAL HG11   H  N N 416 
VAL HG12   H  N N 417 
VAL HG13   H  N N 418 
VAL HG21   H  N N 419 
VAL HG22   H  N N 420 
VAL HG23   H  N N 421 
VAL HXT    H  N N 422 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
3D1 "O5'" "C5'"  sing N N 1   
3D1 "O5'" "H5'"  sing N N 2   
3D1 "C5'" "C4'"  sing N N 3   
3D1 "C5'" "H5'1" sing N N 4   
3D1 "C5'" "H5'2" sing N N 5   
3D1 "C4'" "O4'"  sing N N 6   
3D1 "C4'" "C3'"  sing N N 7   
3D1 "C4'" "H4'"  sing N N 8   
3D1 "O4'" "C1'"  sing N N 9   
3D1 "C1'" N9     sing N N 10  
3D1 "C1'" "C2'"  sing N N 11  
3D1 "C1'" "H1'"  sing N N 12  
3D1 N9    C4     sing Y N 13  
3D1 N9    C8     sing Y N 14  
3D1 C4    N3     doub Y N 15  
3D1 C4    C5     sing Y N 16  
3D1 N3    C2     sing Y N 17  
3D1 C2    N1     doub Y N 18  
3D1 C2    H2     sing N N 19  
3D1 N1    C6     sing Y N 20  
3D1 C6    N6     sing N N 21  
3D1 C6    C5     doub Y N 22  
3D1 N6    HN61   sing N N 23  
3D1 N6    HN62   sing N N 24  
3D1 C5    N7     sing Y N 25  
3D1 N7    C8     doub Y N 26  
3D1 C8    H8     sing N N 27  
3D1 "C2'" "C3'"  sing N N 28  
3D1 "C2'" "H2'1" sing N N 29  
3D1 "C2'" "H2'2" sing N N 30  
3D1 "C3'" "O3'"  sing N N 31  
3D1 "C3'" "H3'"  sing N N 32  
3D1 "O3'" H1     sing N N 33  
ALA N     CA     sing N N 34  
ALA N     H      sing N N 35  
ALA N     H2     sing N N 36  
ALA CA    C      sing N N 37  
ALA CA    CB     sing N N 38  
ALA CA    HA     sing N N 39  
ALA C     O      doub N N 40  
ALA C     OXT    sing N N 41  
ALA CB    HB1    sing N N 42  
ALA CB    HB2    sing N N 43  
ALA CB    HB3    sing N N 44  
ALA OXT   HXT    sing N N 45  
ARG N     CA     sing N N 46  
ARG N     H      sing N N 47  
ARG N     H2     sing N N 48  
ARG CA    C      sing N N 49  
ARG CA    CB     sing N N 50  
ARG CA    HA     sing N N 51  
ARG C     O      doub N N 52  
ARG C     OXT    sing N N 53  
ARG CB    CG     sing N N 54  
ARG CB    HB2    sing N N 55  
ARG CB    HB3    sing N N 56  
ARG CG    CD     sing N N 57  
ARG CG    HG2    sing N N 58  
ARG CG    HG3    sing N N 59  
ARG CD    NE     sing N N 60  
ARG CD    HD2    sing N N 61  
ARG CD    HD3    sing N N 62  
ARG NE    CZ     sing N N 63  
ARG NE    HE     sing N N 64  
ARG CZ    NH1    sing N N 65  
ARG CZ    NH2    doub N N 66  
ARG NH1   HH11   sing N N 67  
ARG NH1   HH12   sing N N 68  
ARG NH2   HH21   sing N N 69  
ARG NH2   HH22   sing N N 70  
ARG OXT   HXT    sing N N 71  
ASN N     CA     sing N N 72  
ASN N     H      sing N N 73  
ASN N     H2     sing N N 74  
ASN CA    C      sing N N 75  
ASN CA    CB     sing N N 76  
ASN CA    HA     sing N N 77  
ASN C     O      doub N N 78  
ASN C     OXT    sing N N 79  
ASN CB    CG     sing N N 80  
ASN CB    HB2    sing N N 81  
ASN CB    HB3    sing N N 82  
ASN CG    OD1    doub N N 83  
ASN CG    ND2    sing N N 84  
ASN ND2   HD21   sing N N 85  
ASN ND2   HD22   sing N N 86  
ASN OXT   HXT    sing N N 87  
ASP N     CA     sing N N 88  
ASP N     H      sing N N 89  
ASP N     H2     sing N N 90  
ASP CA    C      sing N N 91  
ASP CA    CB     sing N N 92  
ASP CA    HA     sing N N 93  
ASP C     O      doub N N 94  
ASP C     OXT    sing N N 95  
ASP CB    CG     sing N N 96  
ASP CB    HB2    sing N N 97  
ASP CB    HB3    sing N N 98  
ASP CG    OD1    doub N N 99  
ASP CG    OD2    sing N N 100 
ASP OD2   HD2    sing N N 101 
ASP OXT   HXT    sing N N 102 
CYS N     CA     sing N N 103 
CYS N     H      sing N N 104 
CYS N     H2     sing N N 105 
CYS CA    C      sing N N 106 
CYS CA    CB     sing N N 107 
CYS CA    HA     sing N N 108 
CYS C     O      doub N N 109 
CYS C     OXT    sing N N 110 
CYS CB    SG     sing N N 111 
CYS CB    HB2    sing N N 112 
CYS CB    HB3    sing N N 113 
CYS SG    HG     sing N N 114 
CYS OXT   HXT    sing N N 115 
GLN N     CA     sing N N 116 
GLN N     H      sing N N 117 
GLN N     H2     sing N N 118 
GLN CA    C      sing N N 119 
GLN CA    CB     sing N N 120 
GLN CA    HA     sing N N 121 
GLN C     O      doub N N 122 
GLN C     OXT    sing N N 123 
GLN CB    CG     sing N N 124 
GLN CB    HB2    sing N N 125 
GLN CB    HB3    sing N N 126 
GLN CG    CD     sing N N 127 
GLN CG    HG2    sing N N 128 
GLN CG    HG3    sing N N 129 
GLN CD    OE1    doub N N 130 
GLN CD    NE2    sing N N 131 
GLN NE2   HE21   sing N N 132 
GLN NE2   HE22   sing N N 133 
GLN OXT   HXT    sing N N 134 
GLU N     CA     sing N N 135 
GLU N     H      sing N N 136 
GLU N     H2     sing N N 137 
GLU CA    C      sing N N 138 
GLU CA    CB     sing N N 139 
GLU CA    HA     sing N N 140 
GLU C     O      doub N N 141 
GLU C     OXT    sing N N 142 
GLU CB    CG     sing N N 143 
GLU CB    HB2    sing N N 144 
GLU CB    HB3    sing N N 145 
GLU CG    CD     sing N N 146 
GLU CG    HG2    sing N N 147 
GLU CG    HG3    sing N N 148 
GLU CD    OE1    doub N N 149 
GLU CD    OE2    sing N N 150 
GLU OE2   HE2    sing N N 151 
GLU OXT   HXT    sing N N 152 
GLY N     CA     sing N N 153 
GLY N     H      sing N N 154 
GLY N     H2     sing N N 155 
GLY CA    C      sing N N 156 
GLY CA    HA2    sing N N 157 
GLY CA    HA3    sing N N 158 
GLY C     O      doub N N 159 
GLY C     OXT    sing N N 160 
GLY OXT   HXT    sing N N 161 
HIS N     CA     sing N N 162 
HIS N     H      sing N N 163 
HIS N     H2     sing N N 164 
HIS CA    C      sing N N 165 
HIS CA    CB     sing N N 166 
HIS CA    HA     sing N N 167 
HIS C     O      doub N N 168 
HIS C     OXT    sing N N 169 
HIS CB    CG     sing N N 170 
HIS CB    HB2    sing N N 171 
HIS CB    HB3    sing N N 172 
HIS CG    ND1    sing Y N 173 
HIS CG    CD2    doub Y N 174 
HIS ND1   CE1    doub Y N 175 
HIS ND1   HD1    sing N N 176 
HIS CD2   NE2    sing Y N 177 
HIS CD2   HD2    sing N N 178 
HIS CE1   NE2    sing Y N 179 
HIS CE1   HE1    sing N N 180 
HIS NE2   HE2    sing N N 181 
HIS OXT   HXT    sing N N 182 
HOH O     H1     sing N N 183 
HOH O     H2     sing N N 184 
ILE N     CA     sing N N 185 
ILE N     H      sing N N 186 
ILE N     H2     sing N N 187 
ILE CA    C      sing N N 188 
ILE CA    CB     sing N N 189 
ILE CA    HA     sing N N 190 
ILE C     O      doub N N 191 
ILE C     OXT    sing N N 192 
ILE CB    CG1    sing N N 193 
ILE CB    CG2    sing N N 194 
ILE CB    HB     sing N N 195 
ILE CG1   CD1    sing N N 196 
ILE CG1   HG12   sing N N 197 
ILE CG1   HG13   sing N N 198 
ILE CG2   HG21   sing N N 199 
ILE CG2   HG22   sing N N 200 
ILE CG2   HG23   sing N N 201 
ILE CD1   HD11   sing N N 202 
ILE CD1   HD12   sing N N 203 
ILE CD1   HD13   sing N N 204 
ILE OXT   HXT    sing N N 205 
LEU N     CA     sing N N 206 
LEU N     H      sing N N 207 
LEU N     H2     sing N N 208 
LEU CA    C      sing N N 209 
LEU CA    CB     sing N N 210 
LEU CA    HA     sing N N 211 
LEU C     O      doub N N 212 
LEU C     OXT    sing N N 213 
LEU CB    CG     sing N N 214 
LEU CB    HB2    sing N N 215 
LEU CB    HB3    sing N N 216 
LEU CG    CD1    sing N N 217 
LEU CG    CD2    sing N N 218 
LEU CG    HG     sing N N 219 
LEU CD1   HD11   sing N N 220 
LEU CD1   HD12   sing N N 221 
LEU CD1   HD13   sing N N 222 
LEU CD2   HD21   sing N N 223 
LEU CD2   HD22   sing N N 224 
LEU CD2   HD23   sing N N 225 
LEU OXT   HXT    sing N N 226 
LYS N     CA     sing N N 227 
LYS N     H      sing N N 228 
LYS N     H2     sing N N 229 
LYS CA    C      sing N N 230 
LYS CA    CB     sing N N 231 
LYS CA    HA     sing N N 232 
LYS C     O      doub N N 233 
LYS C     OXT    sing N N 234 
LYS CB    CG     sing N N 235 
LYS CB    HB2    sing N N 236 
LYS CB    HB3    sing N N 237 
LYS CG    CD     sing N N 238 
LYS CG    HG2    sing N N 239 
LYS CG    HG3    sing N N 240 
LYS CD    CE     sing N N 241 
LYS CD    HD2    sing N N 242 
LYS CD    HD3    sing N N 243 
LYS CE    NZ     sing N N 244 
LYS CE    HE2    sing N N 245 
LYS CE    HE3    sing N N 246 
LYS NZ    HZ1    sing N N 247 
LYS NZ    HZ2    sing N N 248 
LYS NZ    HZ3    sing N N 249 
LYS OXT   HXT    sing N N 250 
MET N     CA     sing N N 251 
MET N     H      sing N N 252 
MET N     H2     sing N N 253 
MET CA    C      sing N N 254 
MET CA    CB     sing N N 255 
MET CA    HA     sing N N 256 
MET C     O      doub N N 257 
MET C     OXT    sing N N 258 
MET CB    CG     sing N N 259 
MET CB    HB2    sing N N 260 
MET CB    HB3    sing N N 261 
MET CG    SD     sing N N 262 
MET CG    HG2    sing N N 263 
MET CG    HG3    sing N N 264 
MET SD    CE     sing N N 265 
MET CE    HE1    sing N N 266 
MET CE    HE2    sing N N 267 
MET CE    HE3    sing N N 268 
MET OXT   HXT    sing N N 269 
PHE N     CA     sing N N 270 
PHE N     H      sing N N 271 
PHE N     H2     sing N N 272 
PHE CA    C      sing N N 273 
PHE CA    CB     sing N N 274 
PHE CA    HA     sing N N 275 
PHE C     O      doub N N 276 
PHE C     OXT    sing N N 277 
PHE CB    CG     sing N N 278 
PHE CB    HB2    sing N N 279 
PHE CB    HB3    sing N N 280 
PHE CG    CD1    doub Y N 281 
PHE CG    CD2    sing Y N 282 
PHE CD1   CE1    sing Y N 283 
PHE CD1   HD1    sing N N 284 
PHE CD2   CE2    doub Y N 285 
PHE CD2   HD2    sing N N 286 
PHE CE1   CZ     doub Y N 287 
PHE CE1   HE1    sing N N 288 
PHE CE2   CZ     sing Y N 289 
PHE CE2   HE2    sing N N 290 
PHE CZ    HZ     sing N N 291 
PHE OXT   HXT    sing N N 292 
PRO N     CA     sing N N 293 
PRO N     CD     sing N N 294 
PRO N     H      sing N N 295 
PRO CA    C      sing N N 296 
PRO CA    CB     sing N N 297 
PRO CA    HA     sing N N 298 
PRO C     O      doub N N 299 
PRO C     OXT    sing N N 300 
PRO CB    CG     sing N N 301 
PRO CB    HB2    sing N N 302 
PRO CB    HB3    sing N N 303 
PRO CG    CD     sing N N 304 
PRO CG    HG2    sing N N 305 
PRO CG    HG3    sing N N 306 
PRO CD    HD2    sing N N 307 
PRO CD    HD3    sing N N 308 
PRO OXT   HXT    sing N N 309 
SER N     CA     sing N N 310 
SER N     H      sing N N 311 
SER N     H2     sing N N 312 
SER CA    C      sing N N 313 
SER CA    CB     sing N N 314 
SER CA    HA     sing N N 315 
SER C     O      doub N N 316 
SER C     OXT    sing N N 317 
SER CB    OG     sing N N 318 
SER CB    HB2    sing N N 319 
SER CB    HB3    sing N N 320 
SER OG    HG     sing N N 321 
SER OXT   HXT    sing N N 322 
THR N     CA     sing N N 323 
THR N     H      sing N N 324 
THR N     H2     sing N N 325 
THR CA    C      sing N N 326 
THR CA    CB     sing N N 327 
THR CA    HA     sing N N 328 
THR C     O      doub N N 329 
THR C     OXT    sing N N 330 
THR CB    OG1    sing N N 331 
THR CB    CG2    sing N N 332 
THR CB    HB     sing N N 333 
THR OG1   HG1    sing N N 334 
THR CG2   HG21   sing N N 335 
THR CG2   HG22   sing N N 336 
THR CG2   HG23   sing N N 337 
THR OXT   HXT    sing N N 338 
TRP N     CA     sing N N 339 
TRP N     H      sing N N 340 
TRP N     H2     sing N N 341 
TRP CA    C      sing N N 342 
TRP CA    CB     sing N N 343 
TRP CA    HA     sing N N 344 
TRP C     O      doub N N 345 
TRP C     OXT    sing N N 346 
TRP CB    CG     sing N N 347 
TRP CB    HB2    sing N N 348 
TRP CB    HB3    sing N N 349 
TRP CG    CD1    doub Y N 350 
TRP CG    CD2    sing Y N 351 
TRP CD1   NE1    sing Y N 352 
TRP CD1   HD1    sing N N 353 
TRP CD2   CE2    doub Y N 354 
TRP CD2   CE3    sing Y N 355 
TRP NE1   CE2    sing Y N 356 
TRP NE1   HE1    sing N N 357 
TRP CE2   CZ2    sing Y N 358 
TRP CE3   CZ3    doub Y N 359 
TRP CE3   HE3    sing N N 360 
TRP CZ2   CH2    doub Y N 361 
TRP CZ2   HZ2    sing N N 362 
TRP CZ3   CH2    sing Y N 363 
TRP CZ3   HZ3    sing N N 364 
TRP CH2   HH2    sing N N 365 
TRP OXT   HXT    sing N N 366 
TYR N     CA     sing N N 367 
TYR N     H      sing N N 368 
TYR N     H2     sing N N 369 
TYR CA    C      sing N N 370 
TYR CA    CB     sing N N 371 
TYR CA    HA     sing N N 372 
TYR C     O      doub N N 373 
TYR C     OXT    sing N N 374 
TYR CB    CG     sing N N 375 
TYR CB    HB2    sing N N 376 
TYR CB    HB3    sing N N 377 
TYR CG    CD1    doub Y N 378 
TYR CG    CD2    sing Y N 379 
TYR CD1   CE1    sing Y N 380 
TYR CD1   HD1    sing N N 381 
TYR CD2   CE2    doub Y N 382 
TYR CD2   HD2    sing N N 383 
TYR CE1   CZ     doub Y N 384 
TYR CE1   HE1    sing N N 385 
TYR CE2   CZ     sing Y N 386 
TYR CE2   HE2    sing N N 387 
TYR CZ    OH     sing N N 388 
TYR OH    HH     sing N N 389 
TYR OXT   HXT    sing N N 390 
VAL N     CA     sing N N 391 
VAL N     H      sing N N 392 
VAL N     H2     sing N N 393 
VAL CA    C      sing N N 394 
VAL CA    CB     sing N N 395 
VAL CA    HA     sing N N 396 
VAL C     O      doub N N 397 
VAL C     OXT    sing N N 398 
VAL CB    CG1    sing N N 399 
VAL CB    CG2    sing N N 400 
VAL CB    HB     sing N N 401 
VAL CG1   HG11   sing N N 402 
VAL CG1   HG12   sing N N 403 
VAL CG1   HG13   sing N N 404 
VAL CG2   HG21   sing N N 405 
VAL CG2   HG22   sing N N 406 
VAL CG2   HG23   sing N N 407 
VAL OXT   HXT    sing N N 408 
# 
loop_
_pdbx_entity_instance_feature.ordinal 
_pdbx_entity_instance_feature.comp_id 
_pdbx_entity_instance_feature.asym_id 
_pdbx_entity_instance_feature.seq_num 
_pdbx_entity_instance_feature.auth_comp_id 
_pdbx_entity_instance_feature.auth_asym_id 
_pdbx_entity_instance_feature.auth_seq_num 
_pdbx_entity_instance_feature.feature_type 
_pdbx_entity_instance_feature.details 
1 3D1 ? ? 3D1 ? ? 'SUBJECT OF INVESTIGATION' ? 
2 CO  ? ? CO  ? ? 'SUBJECT OF INVESTIGATION' ? 
# 
_space_group.name_H-M_alt     'R 3 2 :H' 
_space_group.name_Hall        
;R 3 2"
;
_space_group.IT_number        155 
_space_group.crystal_system   trigonal 
_space_group.id               1 
# 
_atom_sites.entry_id                    6ZPB 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.007051 
_atom_sites.fract_transf_matrix[1][2]   0.004071 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008142 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018613 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C    ? ? 3.54356  2.42580 25.62398 1.50364  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
CO   ? ? ?        ?       ?        ?        ?   ? ? 
CO2+ ? ? 24.87655 ?       3.89890  ?        0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N    ? ? 4.01032  2.96436 19.97189 1.75589  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O    ? ? 4.49882  3.47563 15.80542 1.70748  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O1-  ? ? 5.12366  3.84317 3.49406  27.47979 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S    ? ? 9.55732  6.39887 1.23737  29.19336 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_