data_6ZTD # _entry.id 6ZTD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 6ZTD pdb_00006ztd 10.2210/pdb6ztd/pdb WWPDB D_1292110142 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-05-26 2 'Structure model' 1 1 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 6ZTD _pdbx_database_status.recvd_initial_deposition_date 2020-07-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Carriles, A.A.' 1 0000-0003-0481-2551 'Minici, C.' 2 0000-0002-8350-484X 'Degano, M.' 3 0000-0002-0787-1883 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary Blood ? ? 1528-0020 ? ? 137 ? 1895 1904 'Higher-order immunoglobulin repertoire restrictions in CLL: the illustrative case of stereotyped subsets 2 and 169.' 2021 ? 10.1182/blood.2020005216 33036024 ? ? ? ? ? ? ? ? UK ? ? 1 'Nat Commun' ? ? 2041-1723 ? ? 8 ? 15746 ? 'Distinct homotypic B-cell receptor interactions shape the outcome of chronic lymphocytic leukaemia.' 2017 ? 10.1038/ncomms15746 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gemenetzi, K.' 1 ? primary 'Psomopoulos, F.' 2 ? primary 'Carriles, A.A.' 3 ? primary 'Gounari, M.' 4 ? primary 'Minici, C.' 5 ? primary 'Plevova, K.' 6 ? primary 'Sutton, L.A.' 7 ? primary 'Tsagiopoulou, M.' 8 ? primary 'Baliakas, P.' 9 ? primary 'Pasentsis, K.' 10 ? primary 'Anagnostopoulos, A.' 11 ? primary 'Sandaltzopoulos, R.' 12 ? primary 'Rosenquist, R.' 13 ? primary 'Davi, F.' 14 ? primary 'Pospisilova, S.' 15 ? primary 'Ghia, P.' 16 ? primary 'Stamatopoulos, K.' 17 ? primary 'Degano, M.' 18 ? primary 'Chatzidimitriou, A.' 19 ? 1 'Minici, C.' 20 0000-0002-8350-484X 1 'Gounari, M.' 21 ? 1 'Ubelhart, R.' 22 ? 1 'Scarfo, L.' 23 ? 1 'Duhren-von Minden, M.' 24 ? 1 'Schneider, D.' 25 ? 1 'Tasdogan, A.' 26 ? 1 'Alkhatib, A.' 27 ? 1 'Agathangelidis, A.' 28 ? 1 'Ntoufa, S.' 29 ? 1 'Chiorazzi, N.' 30 ? 1 'Jumaa, H.' 31 ? 1 'Stamatopoulos, K.' 32 ? 1 'Ghia, P.' 33 0000-0003-3750-7342 1 'Degano, M.' 34 0000-0002-0787-1883 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Heavy chain of the Fab fragment from BCR derived from the P6540 CLL clone' 23748.479 1 ? ? ? ? 2 polymer man 'Light chain of the Fab fragment from BCR derived from the P6540 CLL clone' 23020.488 1 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYNMNWVRQAPGKGLQWVSYISDSASTIYYADSVKGRFTISRDNAKNSLY LQMNSLRDEDTAMYYCARDGVGAPLWGQGTTVTVSSGSASAPTLFPLVSCENSPSDTSSVLVGCLAQDFLPDSITFSWKY KNNSDISSTRGFPSVLRGGKYAATSQVLLPSKDVMQGTDEHVVCKVQHPNGNKEKNVPLPV ; ;EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYNMNWVRQAPGKGLQWVSYISDSASTIYYADSVKGRFTISRDNAKNSLY LQMNSLRDEDTAMYYCARDGVGAPLWGQGTTVTVSSGSASAPTLFPLVSCENSPSDTSSVLVGCLAQDFLPDSITFSWKY KNNSDISSTRGFPSVLRGGKYAATSQVLLPSKDVMQGTDEHVVCKVQHPNGNKEKNVPLPV ; H ? 2 'polypeptide(L)' no no ;SYVLTQPPSVSVAPGKTARISCGGNNIGSKSVHWYQQKPGQAPVLVIYYDTDRPSGIPERFSGSNSGNTATLTISRVEAG DEAGYYCQVWDSSSDHPWVFGGGTKLTVLRQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKA GVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS ; ;SYVLTQPPSVSVAPGKTARISCGGNNIGSKSVHWYQQKPGQAPVLVIYYDTDRPSGIPERFSGSNSGNTATLTISRVEAG DEAGYYCQVWDSSSDHPWVFGGGTKLTVLRQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKA GVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS ; L ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 VAL n 1 3 GLN n 1 4 LEU n 1 5 VAL n 1 6 GLU n 1 7 SER n 1 8 GLY n 1 9 GLY n 1 10 GLY n 1 11 LEU n 1 12 VAL n 1 13 GLN n 1 14 PRO n 1 15 GLY n 1 16 GLY n 1 17 SER n 1 18 LEU n 1 19 ARG n 1 20 LEU n 1 21 SER n 1 22 CYS n 1 23 ALA n 1 24 ALA n 1 25 SER n 1 26 GLY n 1 27 PHE n 1 28 THR n 1 29 PHE n 1 30 SER n 1 31 ASP n 1 32 TYR n 1 33 ASN n 1 34 MET n 1 35 ASN n 1 36 TRP n 1 37 VAL n 1 38 ARG n 1 39 GLN n 1 40 ALA n 1 41 PRO n 1 42 GLY n 1 43 LYS n 1 44 GLY n 1 45 LEU n 1 46 GLN n 1 47 TRP n 1 48 VAL n 1 49 SER n 1 50 TYR n 1 51 ILE n 1 52 SER n 1 53 ASP n 1 54 SER n 1 55 ALA n 1 56 SER n 1 57 THR n 1 58 ILE n 1 59 TYR n 1 60 TYR n 1 61 ALA n 1 62 ASP n 1 63 SER n 1 64 VAL n 1 65 LYS n 1 66 GLY n 1 67 ARG n 1 68 PHE n 1 69 THR n 1 70 ILE n 1 71 SER n 1 72 ARG n 1 73 ASP n 1 74 ASN n 1 75 ALA n 1 76 LYS n 1 77 ASN n 1 78 SER n 1 79 LEU n 1 80 TYR n 1 81 LEU n 1 82 GLN n 1 83 MET n 1 84 ASN n 1 85 SER n 1 86 LEU n 1 87 ARG n 1 88 ASP n 1 89 GLU n 1 90 ASP n 1 91 THR n 1 92 ALA n 1 93 MET n 1 94 TYR n 1 95 TYR n 1 96 CYS n 1 97 ALA n 1 98 ARG n 1 99 ASP n 1 100 GLY n 1 101 VAL n 1 102 GLY n 1 103 ALA n 1 104 PRO n 1 105 LEU n 1 106 TRP n 1 107 GLY n 1 108 GLN n 1 109 GLY n 1 110 THR n 1 111 THR n 1 112 VAL n 1 113 THR n 1 114 VAL n 1 115 SER n 1 116 SER n 1 117 GLY n 1 118 SER n 1 119 ALA n 1 120 SER n 1 121 ALA n 1 122 PRO n 1 123 THR n 1 124 LEU n 1 125 PHE n 1 126 PRO n 1 127 LEU n 1 128 VAL n 1 129 SER n 1 130 CYS n 1 131 GLU n 1 132 ASN n 1 133 SER n 1 134 PRO n 1 135 SER n 1 136 ASP n 1 137 THR n 1 138 SER n 1 139 SER n 1 140 VAL n 1 141 LEU n 1 142 VAL n 1 143 GLY n 1 144 CYS n 1 145 LEU n 1 146 ALA n 1 147 GLN n 1 148 ASP n 1 149 PHE n 1 150 LEU n 1 151 PRO n 1 152 ASP n 1 153 SER n 1 154 ILE n 1 155 THR n 1 156 PHE n 1 157 SER n 1 158 TRP n 1 159 LYS n 1 160 TYR n 1 161 LYS n 1 162 ASN n 1 163 ASN n 1 164 SER n 1 165 ASP n 1 166 ILE n 1 167 SER n 1 168 SER n 1 169 THR n 1 170 ARG n 1 171 GLY n 1 172 PHE n 1 173 PRO n 1 174 SER n 1 175 VAL n 1 176 LEU n 1 177 ARG n 1 178 GLY n 1 179 GLY n 1 180 LYS n 1 181 TYR n 1 182 ALA n 1 183 ALA n 1 184 THR n 1 185 SER n 1 186 GLN n 1 187 VAL n 1 188 LEU n 1 189 LEU n 1 190 PRO n 1 191 SER n 1 192 LYS n 1 193 ASP n 1 194 VAL n 1 195 MET n 1 196 GLN n 1 197 GLY n 1 198 THR n 1 199 ASP n 1 200 GLU n 1 201 HIS n 1 202 VAL n 1 203 VAL n 1 204 CYS n 1 205 LYS n 1 206 VAL n 1 207 GLN n 1 208 HIS n 1 209 PRO n 1 210 ASN n 1 211 GLY n 1 212 ASN n 1 213 LYS n 1 214 GLU n 1 215 LYS n 1 216 ASN n 1 217 VAL n 1 218 PRO n 1 219 LEU n 1 220 PRO n 1 221 VAL n 2 1 SER n 2 2 TYR n 2 3 VAL n 2 4 LEU n 2 5 THR n 2 6 GLN n 2 7 PRO n 2 8 PRO n 2 9 SER n 2 10 VAL n 2 11 SER n 2 12 VAL n 2 13 ALA n 2 14 PRO n 2 15 GLY n 2 16 LYS n 2 17 THR n 2 18 ALA n 2 19 ARG n 2 20 ILE n 2 21 SER n 2 22 CYS n 2 23 GLY n 2 24 GLY n 2 25 ASN n 2 26 ASN n 2 27 ILE n 2 28 GLY n 2 29 SER n 2 30 LYS n 2 31 SER n 2 32 VAL n 2 33 HIS n 2 34 TRP n 2 35 TYR n 2 36 GLN n 2 37 GLN n 2 38 LYS n 2 39 PRO n 2 40 GLY n 2 41 GLN n 2 42 ALA n 2 43 PRO n 2 44 VAL n 2 45 LEU n 2 46 VAL n 2 47 ILE n 2 48 TYR n 2 49 TYR n 2 50 ASP n 2 51 THR n 2 52 ASP n 2 53 ARG n 2 54 PRO n 2 55 SER n 2 56 GLY n 2 57 ILE n 2 58 PRO n 2 59 GLU n 2 60 ARG n 2 61 PHE n 2 62 SER n 2 63 GLY n 2 64 SER n 2 65 ASN n 2 66 SER n 2 67 GLY n 2 68 ASN n 2 69 THR n 2 70 ALA n 2 71 THR n 2 72 LEU n 2 73 THR n 2 74 ILE n 2 75 SER n 2 76 ARG n 2 77 VAL n 2 78 GLU n 2 79 ALA n 2 80 GLY n 2 81 ASP n 2 82 GLU n 2 83 ALA n 2 84 GLY n 2 85 TYR n 2 86 TYR n 2 87 CYS n 2 88 GLN n 2 89 VAL n 2 90 TRP n 2 91 ASP n 2 92 SER n 2 93 SER n 2 94 SER n 2 95 ASP n 2 96 HIS n 2 97 PRO n 2 98 TRP n 2 99 VAL n 2 100 PHE n 2 101 GLY n 2 102 GLY n 2 103 GLY n 2 104 THR n 2 105 LYS n 2 106 LEU n 2 107 THR n 2 108 VAL n 2 109 LEU n 2 110 ARG n 2 111 GLN n 2 112 PRO n 2 113 LYS n 2 114 ALA n 2 115 ALA n 2 116 PRO n 2 117 SER n 2 118 VAL n 2 119 THR n 2 120 LEU n 2 121 PHE n 2 122 PRO n 2 123 PRO n 2 124 SER n 2 125 SER n 2 126 GLU n 2 127 GLU n 2 128 LEU n 2 129 GLN n 2 130 ALA n 2 131 ASN n 2 132 LYS n 2 133 ALA n 2 134 THR n 2 135 LEU n 2 136 VAL n 2 137 CYS n 2 138 LEU n 2 139 ILE n 2 140 SER n 2 141 ASP n 2 142 PHE n 2 143 TYR n 2 144 PRO n 2 145 GLY n 2 146 ALA n 2 147 VAL n 2 148 THR n 2 149 VAL n 2 150 ALA n 2 151 TRP n 2 152 LYS n 2 153 ALA n 2 154 ASP n 2 155 SER n 2 156 SER n 2 157 PRO n 2 158 VAL n 2 159 LYS n 2 160 ALA n 2 161 GLY n 2 162 VAL n 2 163 GLU n 2 164 THR n 2 165 THR n 2 166 THR n 2 167 PRO n 2 168 SER n 2 169 LYS n 2 170 GLN n 2 171 SER n 2 172 ASN n 2 173 ASN n 2 174 LYS n 2 175 TYR n 2 176 ALA n 2 177 ALA n 2 178 SER n 2 179 SER n 2 180 TYR n 2 181 LEU n 2 182 SER n 2 183 LEU n 2 184 THR n 2 185 PRO n 2 186 GLU n 2 187 GLN n 2 188 TRP n 2 189 LYS n 2 190 SER n 2 191 HIS n 2 192 ARG n 2 193 SER n 2 194 TYR n 2 195 SER n 2 196 CYS n 2 197 GLN n 2 198 VAL n 2 199 THR n 2 200 HIS n 2 201 GLU n 2 202 GLY n 2 203 SER n 2 204 THR n 2 205 VAL n 2 206 GLU n 2 207 LYS n 2 208 THR n 2 209 VAL n 2 210 ALA n 2 211 PRO n 2 212 THR n 2 213 GLU n 2 214 CYS n 2 215 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 221 Human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 215 Human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 ? ? ? H . n A 1 2 VAL 2 2 2 VAL VAL H . n A 1 3 GLN 3 3 3 GLN GLN H . n A 1 4 LEU 4 4 4 LEU LEU H . n A 1 5 VAL 5 5 5 VAL VAL H . n A 1 6 GLU 6 6 6 GLU GLU H . n A 1 7 SER 7 7 7 SER SER H . n A 1 8 GLY 8 8 8 GLY GLY H . n A 1 9 GLY 9 9 9 GLY GLY H . n A 1 10 GLY 10 10 10 GLY GLY H . n A 1 11 LEU 11 11 11 LEU LEU H . n A 1 12 VAL 12 12 12 VAL VAL H . n A 1 13 GLN 13 13 13 GLN GLN H . n A 1 14 PRO 14 14 14 PRO PRO H . n A 1 15 GLY 15 15 15 GLY GLY H . n A 1 16 GLY 16 16 16 GLY GLY H . n A 1 17 SER 17 17 17 SER SER H . n A 1 18 LEU 18 18 18 LEU LEU H . n A 1 19 ARG 19 19 19 ARG ARG H . n A 1 20 LEU 20 20 20 LEU LEU H . n A 1 21 SER 21 21 21 SER SER H . n A 1 22 CYS 22 22 22 CYS CYS H . n A 1 23 ALA 23 23 23 ALA ALA H . n A 1 24 ALA 24 24 24 ALA ALA H . n A 1 25 SER 25 25 25 SER SER H . n A 1 26 GLY 26 26 26 GLY GLY H . n A 1 27 PHE 27 27 27 PHE PHE H . n A 1 28 THR 28 28 28 THR THR H . n A 1 29 PHE 29 29 29 PHE PHE H . n A 1 30 SER 30 30 30 SER SER H . n A 1 31 ASP 31 31 31 ASP ASP H . n A 1 32 TYR 32 32 32 TYR TYR H . n A 1 33 ASN 33 33 33 ASN ASN H . n A 1 34 MET 34 34 34 MET MET H . n A 1 35 ASN 35 35 35 ASN ASN H . n A 1 36 TRP 36 36 36 TRP TRP H . n A 1 37 VAL 37 37 37 VAL VAL H . n A 1 38 ARG 38 38 38 ARG ARG H . n A 1 39 GLN 39 39 39 GLN GLN H . n A 1 40 ALA 40 40 40 ALA ALA H . n A 1 41 PRO 41 41 41 PRO PRO H . n A 1 42 GLY 42 42 42 GLY GLY H . n A 1 43 LYS 43 43 43 LYS LYS H . n A 1 44 GLY 44 44 44 GLY GLY H . n A 1 45 LEU 45 45 45 LEU LEU H . n A 1 46 GLN 46 46 46 GLN GLN H . n A 1 47 TRP 47 47 47 TRP TRP H . n A 1 48 VAL 48 48 48 VAL VAL H . n A 1 49 SER 49 49 49 SER SER H . n A 1 50 TYR 50 50 50 TYR TYR H . n A 1 51 ILE 51 51 51 ILE ILE H . n A 1 52 SER 52 52 52 SER SER H . n A 1 53 ASP 53 53 53 ASP ASP H . n A 1 54 SER 54 54 54 SER SER H . n A 1 55 ALA 55 55 55 ALA ALA H . n A 1 56 SER 56 56 56 SER SER H . n A 1 57 THR 57 57 57 THR THR H . n A 1 58 ILE 58 58 58 ILE ILE H . n A 1 59 TYR 59 59 59 TYR TYR H . n A 1 60 TYR 60 60 60 TYR TYR H . n A 1 61 ALA 61 61 61 ALA ALA H . n A 1 62 ASP 62 62 62 ASP ASP H . n A 1 63 SER 63 63 63 SER SER H . n A 1 64 VAL 64 64 64 VAL VAL H . n A 1 65 LYS 65 65 65 LYS LYS H . n A 1 66 GLY 66 66 66 GLY GLY H . n A 1 67 ARG 67 67 67 ARG ARG H . n A 1 68 PHE 68 68 68 PHE PHE H . n A 1 69 THR 69 69 69 THR THR H . n A 1 70 ILE 70 70 70 ILE ILE H . n A 1 71 SER 71 71 71 SER SER H . n A 1 72 ARG 72 72 72 ARG ARG H . n A 1 73 ASP 73 73 73 ASP ASP H . n A 1 74 ASN 74 74 74 ASN ASN H . n A 1 75 ALA 75 75 75 ALA ALA H . n A 1 76 LYS 76 76 76 LYS LYS H . n A 1 77 ASN 77 77 77 ASN ASN H . n A 1 78 SER 78 78 78 SER SER H . n A 1 79 LEU 79 79 79 LEU LEU H . n A 1 80 TYR 80 80 80 TYR TYR H . n A 1 81 LEU 81 81 81 LEU LEU H . n A 1 82 GLN 82 82 82 GLN GLN H . n A 1 83 MET 83 83 83 MET MET H . n A 1 84 ASN 84 84 84 ASN ASN H . n A 1 85 SER 85 85 85 SER SER H . n A 1 86 LEU 86 86 86 LEU LEU H . n A 1 87 ARG 87 87 87 ARG ARG H . n A 1 88 ASP 88 88 88 ASP ASP H . n A 1 89 GLU 89 89 89 GLU GLU H . n A 1 90 ASP 90 90 90 ASP ASP H . n A 1 91 THR 91 91 91 THR THR H . n A 1 92 ALA 92 92 92 ALA ALA H . n A 1 93 MET 93 93 93 MET MET H . n A 1 94 TYR 94 94 94 TYR TYR H . n A 1 95 TYR 95 95 95 TYR TYR H . n A 1 96 CYS 96 96 96 CYS CYS H . n A 1 97 ALA 97 97 97 ALA ALA H . n A 1 98 ARG 98 98 98 ARG ARG H . n A 1 99 ASP 99 99 99 ASP ASP H . n A 1 100 GLY 100 100 100 GLY GLY H . n A 1 101 VAL 101 101 101 VAL VAL H . n A 1 102 GLY 102 102 102 GLY GLY H . n A 1 103 ALA 103 103 103 ALA ALA H . n A 1 104 PRO 104 104 104 PRO PRO H . n A 1 105 LEU 105 105 105 LEU LEU H . n A 1 106 TRP 106 106 106 TRP TRP H . n A 1 107 GLY 107 107 107 GLY GLY H . n A 1 108 GLN 108 108 108 GLN GLN H . n A 1 109 GLY 109 109 109 GLY GLY H . n A 1 110 THR 110 110 110 THR THR H . n A 1 111 THR 111 111 111 THR THR H . n A 1 112 VAL 112 112 112 VAL VAL H . n A 1 113 THR 113 113 113 THR THR H . n A 1 114 VAL 114 114 114 VAL VAL H . n A 1 115 SER 115 115 115 SER SER H . n A 1 116 SER 116 116 116 SER SER H . n A 1 117 GLY 117 117 117 GLY GLY H . n A 1 118 SER 118 118 118 SER SER H . n A 1 119 ALA 119 119 119 ALA ALA H . n A 1 120 SER 120 120 120 SER SER H . n A 1 121 ALA 121 121 121 ALA ALA H . n A 1 122 PRO 122 122 122 PRO PRO H . n A 1 123 THR 123 123 123 THR THR H . n A 1 124 LEU 124 124 124 LEU LEU H . n A 1 125 PHE 125 125 125 PHE PHE H . n A 1 126 PRO 126 126 126 PRO PRO H . n A 1 127 LEU 127 127 127 LEU LEU H . n A 1 128 VAL 128 128 128 VAL VAL H . n A 1 129 SER 129 129 129 SER SER H . n A 1 130 CYS 130 130 ? ? ? H . n A 1 131 GLU 131 131 ? ? ? H . n A 1 132 ASN 132 132 ? ? ? H . n A 1 133 SER 133 133 ? ? ? H . n A 1 134 PRO 134 134 ? ? ? H . n A 1 135 SER 135 135 ? ? ? H . n A 1 136 ASP 136 136 ? ? ? H . n A 1 137 THR 137 137 ? ? ? H . n A 1 138 SER 138 138 ? ? ? H . n A 1 139 SER 139 139 ? ? ? H . n A 1 140 VAL 140 140 ? ? ? H . n A 1 141 LEU 141 141 141 LEU LEU H . n A 1 142 VAL 142 142 142 VAL VAL H . n A 1 143 GLY 143 143 143 GLY GLY H . n A 1 144 CYS 144 144 144 CYS CYS H . n A 1 145 LEU 145 145 145 LEU LEU H . n A 1 146 ALA 146 146 146 ALA ALA H . n A 1 147 GLN 147 147 147 GLN GLN H . n A 1 148 ASP 148 148 148 ASP ASP H . n A 1 149 PHE 149 149 149 PHE PHE H . n A 1 150 LEU 150 150 150 LEU LEU H . n A 1 151 PRO 151 151 151 PRO PRO H . n A 1 152 ASP 152 152 152 ASP ASP H . n A 1 153 SER 153 153 153 SER SER H . n A 1 154 ILE 154 154 154 ILE ILE H . n A 1 155 THR 155 155 155 THR THR H . n A 1 156 PHE 156 156 156 PHE PHE H . n A 1 157 SER 157 157 157 SER SER H . n A 1 158 TRP 158 158 158 TRP TRP H . n A 1 159 LYS 159 159 159 LYS LYS H . n A 1 160 TYR 160 160 160 TYR TYR H . n A 1 161 LYS 161 161 161 LYS LYS H . n A 1 162 ASN 162 162 162 ASN ASN H . n A 1 163 ASN 163 163 ? ? ? H . n A 1 164 SER 164 164 ? ? ? H . n A 1 165 ASP 165 165 ? ? ? H . n A 1 166 ILE 166 166 ? ? ? H . n A 1 167 SER 167 167 ? ? ? H . n A 1 168 SER 168 168 ? ? ? H . n A 1 169 THR 169 169 169 THR THR H . n A 1 170 ARG 170 170 170 ARG ARG H . n A 1 171 GLY 171 171 171 GLY GLY H . n A 1 172 PHE 172 172 172 PHE PHE H . n A 1 173 PRO 173 173 173 PRO PRO H . n A 1 174 SER 174 174 174 SER SER H . n A 1 175 VAL 175 175 175 VAL VAL H . n A 1 176 LEU 176 176 176 LEU LEU H . n A 1 177 ARG 177 177 177 ARG ARG H . n A 1 178 GLY 178 178 178 GLY GLY H . n A 1 179 GLY 179 179 179 GLY GLY H . n A 1 180 LYS 180 180 180 LYS LYS H . n A 1 181 TYR 181 181 181 TYR TYR H . n A 1 182 ALA 182 182 182 ALA ALA H . n A 1 183 ALA 183 183 183 ALA ALA H . n A 1 184 THR 184 184 184 THR THR H . n A 1 185 SER 185 185 185 SER SER H . n A 1 186 GLN 186 186 186 GLN GLN H . n A 1 187 VAL 187 187 187 VAL VAL H . n A 1 188 LEU 188 188 188 LEU LEU H . n A 1 189 LEU 189 189 189 LEU LEU H . n A 1 190 PRO 190 190 ? ? ? H . n A 1 191 SER 191 191 ? ? ? H . n A 1 192 LYS 192 192 ? ? ? H . n A 1 193 ASP 193 193 ? ? ? H . n A 1 194 VAL 194 194 ? ? ? H . n A 1 195 MET 195 195 ? ? ? H . n A 1 196 GLN 196 196 ? ? ? H . n A 1 197 GLY 197 197 ? ? ? H . n A 1 198 THR 198 198 ? ? ? H . n A 1 199 ASP 199 199 ? ? ? H . n A 1 200 GLU 200 200 ? ? ? H . n A 1 201 HIS 201 201 ? ? ? H . n A 1 202 VAL 202 202 ? ? ? H . n A 1 203 VAL 203 203 203 VAL VAL H . n A 1 204 CYS 204 204 204 CYS CYS H . n A 1 205 LYS 205 205 205 LYS LYS H . n A 1 206 VAL 206 206 206 VAL VAL H . n A 1 207 GLN 207 207 207 GLN GLN H . n A 1 208 HIS 208 208 208 HIS HIS H . n A 1 209 PRO 209 209 209 PRO PRO H . n A 1 210 ASN 210 210 210 ASN ASN H . n A 1 211 GLY 211 211 211 GLY GLY H . n A 1 212 ASN 212 212 212 ASN ASN H . n A 1 213 LYS 213 213 213 LYS LYS H . n A 1 214 GLU 214 214 214 GLU GLU H . n A 1 215 LYS 215 215 215 LYS LYS H . n A 1 216 ASN 216 216 216 ASN ASN H . n A 1 217 VAL 217 217 217 VAL VAL H . n A 1 218 PRO 218 218 218 PRO PRO H . n A 1 219 LEU 219 219 ? ? ? H . n A 1 220 PRO 220 220 ? ? ? H . n A 1 221 VAL 221 221 ? ? ? H . n B 2 1 SER 1 1 ? ? ? L . n B 2 2 TYR 2 2 2 TYR TYR L . n B 2 3 VAL 3 3 3 VAL VAL L . n B 2 4 LEU 4 4 4 LEU LEU L . n B 2 5 THR 5 5 5 THR THR L . n B 2 6 GLN 6 6 6 GLN GLN L . n B 2 7 PRO 7 7 7 PRO PRO L . n B 2 8 PRO 8 8 8 PRO PRO L . n B 2 9 SER 9 9 9 SER SER L . n B 2 10 VAL 10 10 10 VAL VAL L . n B 2 11 SER 11 11 11 SER SER L . n B 2 12 VAL 12 12 12 VAL VAL L . n B 2 13 ALA 13 13 13 ALA ALA L . n B 2 14 PRO 14 14 14 PRO PRO L . n B 2 15 GLY 15 15 15 GLY GLY L . n B 2 16 LYS 16 16 16 LYS LYS L . n B 2 17 THR 17 17 17 THR THR L . n B 2 18 ALA 18 18 18 ALA ALA L . n B 2 19 ARG 19 19 19 ARG ARG L . n B 2 20 ILE 20 20 20 ILE ILE L . n B 2 21 SER 21 21 21 SER SER L . n B 2 22 CYS 22 22 22 CYS CYS L . n B 2 23 GLY 23 23 23 GLY GLY L . n B 2 24 GLY 24 24 24 GLY GLY L . n B 2 25 ASN 25 25 25 ASN ASN L . n B 2 26 ASN 26 26 26 ASN ASN L . n B 2 27 ILE 27 27 27 ILE ILE L . n B 2 28 GLY 28 28 28 GLY GLY L . n B 2 29 SER 29 29 29 SER SER L . n B 2 30 LYS 30 30 30 LYS LYS L . n B 2 31 SER 31 31 31 SER SER L . n B 2 32 VAL 32 32 32 VAL VAL L . n B 2 33 HIS 33 33 33 HIS HIS L . n B 2 34 TRP 34 34 34 TRP TRP L . n B 2 35 TYR 35 35 35 TYR TYR L . n B 2 36 GLN 36 36 36 GLN GLN L . n B 2 37 GLN 37 37 37 GLN GLN L . n B 2 38 LYS 38 38 38 LYS LYS L . n B 2 39 PRO 39 39 39 PRO PRO L . n B 2 40 GLY 40 40 40 GLY GLY L . n B 2 41 GLN 41 41 41 GLN GLN L . n B 2 42 ALA 42 42 42 ALA ALA L . n B 2 43 PRO 43 43 43 PRO PRO L . n B 2 44 VAL 44 44 44 VAL VAL L . n B 2 45 LEU 45 45 45 LEU LEU L . n B 2 46 VAL 46 46 46 VAL VAL L . n B 2 47 ILE 47 47 47 ILE ILE L . n B 2 48 TYR 48 48 48 TYR TYR L . n B 2 49 TYR 49 49 49 TYR TYR L . n B 2 50 ASP 50 50 50 ASP ASP L . n B 2 51 THR 51 51 51 THR THR L . n B 2 52 ASP 52 52 52 ASP ASP L . n B 2 53 ARG 53 53 53 ARG ARG L . n B 2 54 PRO 54 54 54 PRO PRO L . n B 2 55 SER 55 55 55 SER SER L . n B 2 56 GLY 56 56 56 GLY GLY L . n B 2 57 ILE 57 57 57 ILE ILE L . n B 2 58 PRO 58 58 58 PRO PRO L . n B 2 59 GLU 59 59 59 GLU GLU L . n B 2 60 ARG 60 60 60 ARG ARG L . n B 2 61 PHE 61 61 61 PHE PHE L . n B 2 62 SER 62 62 62 SER SER L . n B 2 63 GLY 63 63 63 GLY GLY L . n B 2 64 SER 64 64 64 SER SER L . n B 2 65 ASN 65 65 65 ASN ASN L . n B 2 66 SER 66 66 66 SER SER L . n B 2 67 GLY 67 67 67 GLY GLY L . n B 2 68 ASN 68 68 68 ASN ASN L . n B 2 69 THR 69 69 69 THR THR L . n B 2 70 ALA 70 70 70 ALA ALA L . n B 2 71 THR 71 71 71 THR THR L . n B 2 72 LEU 72 72 72 LEU LEU L . n B 2 73 THR 73 73 73 THR THR L . n B 2 74 ILE 74 74 74 ILE ILE L . n B 2 75 SER 75 75 75 SER SER L . n B 2 76 ARG 76 76 76 ARG ARG L . n B 2 77 VAL 77 77 77 VAL VAL L . n B 2 78 GLU 78 78 78 GLU GLU L . n B 2 79 ALA 79 79 79 ALA ALA L . n B 2 80 GLY 80 80 80 GLY GLY L . n B 2 81 ASP 81 81 81 ASP ASP L . n B 2 82 GLU 82 82 82 GLU GLU L . n B 2 83 ALA 83 83 83 ALA ALA L . n B 2 84 GLY 84 84 84 GLY GLY L . n B 2 85 TYR 85 85 85 TYR TYR L . n B 2 86 TYR 86 86 86 TYR TYR L . n B 2 87 CYS 87 87 87 CYS CYS L . n B 2 88 GLN 88 88 88 GLN GLN L . n B 2 89 VAL 89 89 89 VAL VAL L . n B 2 90 TRP 90 90 90 TRP TRP L . n B 2 91 ASP 91 91 91 ASP ASP L . n B 2 92 SER 92 92 92 SER SER L . n B 2 93 SER 93 93 93 SER SER L . n B 2 94 SER 94 94 94 SER SER L . n B 2 95 ASP 95 95 95 ASP ASP L . n B 2 96 HIS 96 96 96 HIS HIS L . n B 2 97 PRO 97 97 97 PRO PRO L . n B 2 98 TRP 98 98 98 TRP TRP L . n B 2 99 VAL 99 99 99 VAL VAL L . n B 2 100 PHE 100 100 100 PHE PHE L . n B 2 101 GLY 101 101 101 GLY GLY L . n B 2 102 GLY 102 102 102 GLY GLY L . n B 2 103 GLY 103 103 103 GLY GLY L . n B 2 104 THR 104 104 104 THR THR L . n B 2 105 LYS 105 105 105 LYS LYS L . n B 2 106 LEU 106 106 106 LEU LEU L . n B 2 107 THR 107 107 107 THR THR L . n B 2 108 VAL 108 108 108 VAL VAL L . n B 2 109 LEU 109 109 109 LEU LEU L . n B 2 110 ARG 110 110 110 ARG ARG L . n B 2 111 GLN 111 111 111 GLN GLN L . n B 2 112 PRO 112 112 112 PRO PRO L . n B 2 113 LYS 113 113 113 LYS LYS L . n B 2 114 ALA 114 114 114 ALA ALA L . n B 2 115 ALA 115 115 115 ALA ALA L . n B 2 116 PRO 116 116 116 PRO PRO L . n B 2 117 SER 117 117 117 SER SER L . n B 2 118 VAL 118 118 118 VAL VAL L . n B 2 119 THR 119 119 119 THR THR L . n B 2 120 LEU 120 120 120 LEU LEU L . n B 2 121 PHE 121 121 121 PHE PHE L . n B 2 122 PRO 122 122 122 PRO PRO L . n B 2 123 PRO 123 123 123 PRO PRO L . n B 2 124 SER 124 124 124 SER SER L . n B 2 125 SER 125 125 125 SER SER L . n B 2 126 GLU 126 126 126 GLU GLU L . n B 2 127 GLU 127 127 127 GLU GLU L . n B 2 128 LEU 128 128 128 LEU LEU L . n B 2 129 GLN 129 129 129 GLN GLN L . n B 2 130 ALA 130 130 130 ALA ALA L . n B 2 131 ASN 131 131 131 ASN ASN L . n B 2 132 LYS 132 132 132 LYS LYS L . n B 2 133 ALA 133 133 133 ALA ALA L . n B 2 134 THR 134 134 134 THR THR L . n B 2 135 LEU 135 135 135 LEU LEU L . n B 2 136 VAL 136 136 136 VAL VAL L . n B 2 137 CYS 137 137 137 CYS CYS L . n B 2 138 LEU 138 138 138 LEU LEU L . n B 2 139 ILE 139 139 139 ILE ILE L . n B 2 140 SER 140 140 140 SER SER L . n B 2 141 ASP 141 141 141 ASP ASP L . n B 2 142 PHE 142 142 142 PHE PHE L . n B 2 143 TYR 143 143 143 TYR TYR L . n B 2 144 PRO 144 144 144 PRO PRO L . n B 2 145 GLY 145 145 145 GLY GLY L . n B 2 146 ALA 146 146 146 ALA ALA L . n B 2 147 VAL 147 147 147 VAL VAL L . n B 2 148 THR 148 148 148 THR THR L . n B 2 149 VAL 149 149 149 VAL VAL L . n B 2 150 ALA 150 150 150 ALA ALA L . n B 2 151 TRP 151 151 151 TRP TRP L . n B 2 152 LYS 152 152 152 LYS LYS L . n B 2 153 ALA 153 153 153 ALA ALA L . n B 2 154 ASP 154 154 154 ASP ASP L . n B 2 155 SER 155 155 155 SER SER L . n B 2 156 SER 156 156 156 SER SER L . n B 2 157 PRO 157 157 157 PRO PRO L . n B 2 158 VAL 158 158 158 VAL VAL L . n B 2 159 LYS 159 159 159 LYS LYS L . n B 2 160 ALA 160 160 160 ALA ALA L . n B 2 161 GLY 161 161 161 GLY GLY L . n B 2 162 VAL 162 162 162 VAL VAL L . n B 2 163 GLU 163 163 163 GLU GLU L . n B 2 164 THR 164 164 164 THR THR L . n B 2 165 THR 165 165 165 THR THR L . n B 2 166 THR 166 166 166 THR THR L . n B 2 167 PRO 167 167 167 PRO PRO L . n B 2 168 SER 168 168 168 SER SER L . n B 2 169 LYS 169 169 169 LYS LYS L . n B 2 170 GLN 170 170 170 GLN GLN L . n B 2 171 SER 171 171 171 SER SER L . n B 2 172 ASN 172 172 172 ASN ASN L . n B 2 173 ASN 173 173 173 ASN ASN L . n B 2 174 LYS 174 174 174 LYS LYS L . n B 2 175 TYR 175 175 175 TYR TYR L . n B 2 176 ALA 176 176 176 ALA ALA L . n B 2 177 ALA 177 177 177 ALA ALA L . n B 2 178 SER 178 178 178 SER SER L . n B 2 179 SER 179 179 179 SER SER L . n B 2 180 TYR 180 180 180 TYR TYR L . n B 2 181 LEU 181 181 181 LEU LEU L . n B 2 182 SER 182 182 182 SER SER L . n B 2 183 LEU 183 183 183 LEU LEU L . n B 2 184 THR 184 184 184 THR THR L . n B 2 185 PRO 185 185 185 PRO PRO L . n B 2 186 GLU 186 186 186 GLU GLU L . n B 2 187 GLN 187 187 187 GLN GLN L . n B 2 188 TRP 188 188 188 TRP TRP L . n B 2 189 LYS 189 189 189 LYS LYS L . n B 2 190 SER 190 190 190 SER SER L . n B 2 191 HIS 191 191 191 HIS HIS L . n B 2 192 ARG 192 192 192 ARG ARG L . n B 2 193 SER 193 193 193 SER SER L . n B 2 194 TYR 194 194 194 TYR TYR L . n B 2 195 SER 195 195 195 SER SER L . n B 2 196 CYS 196 196 196 CYS CYS L . n B 2 197 GLN 197 197 197 GLN GLN L . n B 2 198 VAL 198 198 198 VAL VAL L . n B 2 199 THR 199 199 199 THR THR L . n B 2 200 HIS 200 200 200 HIS HIS L . n B 2 201 GLU 201 201 201 GLU GLU L . n B 2 202 GLY 202 202 202 GLY GLY L . n B 2 203 SER 203 203 203 SER SER L . n B 2 204 THR 204 204 204 THR THR L . n B 2 205 VAL 205 205 205 VAL VAL L . n B 2 206 GLU 206 206 206 GLU GLU L . n B 2 207 LYS 207 207 207 LYS LYS L . n B 2 208 THR 208 208 208 THR THR L . n B 2 209 VAL 209 209 209 VAL VAL L . n B 2 210 ALA 210 210 210 ALA ALA L . n B 2 211 PRO 211 211 211 PRO PRO L . n B 2 212 THR 212 212 212 THR THR L . n B 2 213 GLU 213 213 213 GLU GLU L . n B 2 214 CYS 214 214 ? ? ? L . n B 2 215 SER 215 215 ? ? ? L . n # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 6ZTD _cell.details ? _cell.formula_units_Z ? _cell.length_a 70.536 _cell.length_a_esd ? _cell.length_b 70.536 _cell.length_b_esd ? _cell.length_c 106.472 _cell.length_c_esd ? _cell.volume 529733.048 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 6ZTD _symmetry.cell_setting ? _symmetry.Int_Tables_number 76 _symmetry.space_group_name_Hall 'P 4w' _symmetry.space_group_name_H-M 'P 41' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 6ZTD _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.09 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.14 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M Na Malate pH 7 26 % PEG 4000 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-05-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.966 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.966 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 113.5 _reflns.entry_id 6ZTD _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.43 _reflns.d_resolution_low 49.88 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6990 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.029 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.43 _reflns_shell.d_res_low 3.71 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1435 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.240 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.879 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 174.43 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 6ZTD _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.43 _refine.ls_d_res_low 49.88 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6985 _refine.ls_number_reflns_R_free 691 _refine.ls_number_reflns_R_work 6294 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.32 _refine.ls_percent_reflns_R_free 9.89 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2212 _refine.ls_R_factor_R_free 0.2632 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2168 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5IFH _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.8937 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3222 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.43 _refine_hist.d_res_low 49.88 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 3021 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 3021 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0022 ? 3095 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5271 ? 4216 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0408 ? 467 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0042 ? 543 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 9.8861 ? 428 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.43 3.69 . . 137 1249 99.93 . . . 0.3090 . 0.2729 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.70 4.07 . . 137 1254 99.71 . . . 0.2696 . 0.2609 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.07 4.65 . . 143 1254 99.36 . . . 0.2386 . 0.2096 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.66 5.86 . . 138 1273 99.23 . . . 0.2628 . 0.2040 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.87 49.88 . . 136 1264 98.45 . . . 0.2648 . 0.2082 . . . . . . . . . . . # _struct.entry_id 6ZTD _struct.title 'Crystal structure of the BCR Fab fragment from subset #169 case P6540' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 6ZTD _struct_keywords.text 'antibody, Fab, B-cell receptor, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 PDB 6ZTD 6ZTD ? 1 ? 1 2 PDB 6ZTD 6ZTD ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 6ZTD H 1 ? 221 ? 6ZTD 1 ? 221 ? 1 221 2 2 6ZTD L 1 ? 215 ? 6ZTD 1 ? 215 ? 1 215 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3480 ? 1 MORE -21 ? 1 'SSA (A^2)' 18860 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 28 ? TYR A 32 ? THR H 28 TYR H 32 5 ? 5 HELX_P HELX_P2 AA2 ARG A 87 ? THR A 91 ? ARG H 87 THR H 91 5 ? 5 HELX_P HELX_P3 AA3 ASN B 26 ? LYS B 30 ? ASN L 26 LYS L 30 5 ? 5 HELX_P HELX_P4 AA4 GLU B 78 ? GLU B 82 ? GLU L 78 GLU L 82 5 ? 5 HELX_P HELX_P5 AA5 SER B 124 ? GLN B 129 ? SER L 124 GLN L 129 1 ? 6 HELX_P HELX_P6 AA6 THR B 184 ? LYS B 189 ? THR L 184 LYS L 189 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 96 SG ? ? H CYS 22 H CYS 96 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf2 disulf ? ? A CYS 144 SG ? ? ? 1_555 A CYS 204 SG ? ? H CYS 144 H CYS 204 1_555 ? ? ? ? ? ? ? 2.036 ? ? disulf3 disulf ? ? B CYS 22 SG ? ? ? 1_555 B CYS 87 SG ? ? L CYS 22 L CYS 87 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf4 disulf ? ? B CYS 137 SG ? ? ? 1_555 B CYS 196 SG ? ? L CYS 137 L CYS 196 1_555 ? ? ? ? ? ? ? 2.031 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LEU 150 A . ? LEU 150 H PRO 151 A ? PRO 151 H 1 0.27 2 TYR 143 B . ? TYR 143 L PRO 144 B ? PRO 144 L 1 -1.22 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 6 ? AA3 ? 4 ? AA4 ? 4 ? AA5 ? 3 ? AA6 ? 5 ? AA7 ? 4 ? AA8 ? 3 ? AA9 ? 4 ? AB1 ? 4 ? AB2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA6 1 2 ? parallel AA6 2 3 ? anti-parallel AA6 3 4 ? anti-parallel AA6 4 5 ? anti-parallel AA7 1 2 ? parallel AA7 2 3 ? anti-parallel AA7 3 4 ? anti-parallel AA8 1 2 ? anti-parallel AA8 2 3 ? anti-parallel AA9 1 2 ? anti-parallel AA9 2 3 ? anti-parallel AA9 3 4 ? anti-parallel AB1 1 2 ? anti-parallel AB1 2 3 ? anti-parallel AB1 3 4 ? anti-parallel AB2 1 2 ? anti-parallel AB2 2 3 ? anti-parallel AB2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 3 ? SER A 7 ? GLN H 3 SER H 7 AA1 2 LEU A 18 ? SER A 25 ? LEU H 18 SER H 25 AA1 3 SER A 78 ? MET A 83 ? SER H 78 MET H 83 AA1 4 THR A 69 ? ASP A 73 ? THR H 69 ASP H 73 AA2 1 LEU A 11 ? VAL A 12 ? LEU H 11 VAL H 12 AA2 2 THR A 110 ? VAL A 114 ? THR H 110 VAL H 114 AA2 3 ALA A 92 ? ASP A 99 ? ALA H 92 ASP H 99 AA2 4 ASN A 33 ? GLN A 39 ? ASN H 33 GLN H 39 AA2 5 LEU A 45 ? ILE A 51 ? LEU H 45 ILE H 51 AA2 6 ILE A 58 ? TYR A 60 ? ILE H 58 TYR H 60 AA3 1 LEU A 11 ? VAL A 12 ? LEU H 11 VAL H 12 AA3 2 THR A 110 ? VAL A 114 ? THR H 110 VAL H 114 AA3 3 ALA A 92 ? ASP A 99 ? ALA H 92 ASP H 99 AA3 4 LEU A 105 ? TRP A 106 ? LEU H 105 TRP H 106 AA4 1 THR A 123 ? LEU A 127 ? THR H 123 LEU H 127 AA4 2 GLY A 143 ? PHE A 149 ? GLY H 143 PHE H 149 AA4 3 LYS A 180 ? GLN A 186 ? LYS H 180 GLN H 186 AA4 4 VAL A 175 ? ARG A 177 ? VAL H 175 ARG H 177 AA5 1 PHE A 156 ? SER A 157 ? PHE H 156 SER H 157 AA5 2 CYS A 204 ? VAL A 206 ? CYS H 204 VAL H 206 AA5 3 LYS A 213 ? LYS A 215 ? LYS H 213 LYS H 215 AA6 1 SER B 9 ? VAL B 12 ? SER L 9 VAL L 12 AA6 2 THR B 104 ? VAL B 108 ? THR L 104 VAL L 108 AA6 3 ALA B 83 ? TRP B 90 ? ALA L 83 TRP L 90 AA6 4 SER B 31 ? GLN B 37 ? SER L 31 GLN L 37 AA6 5 VAL B 44 ? ILE B 47 ? VAL L 44 ILE L 47 AA7 1 SER B 9 ? VAL B 12 ? SER L 9 VAL L 12 AA7 2 THR B 104 ? VAL B 108 ? THR L 104 VAL L 108 AA7 3 ALA B 83 ? TRP B 90 ? ALA L 83 TRP L 90 AA7 4 TRP B 98 ? PHE B 100 ? TRP L 98 PHE L 100 AA8 1 ALA B 18 ? GLY B 23 ? ALA L 18 GLY L 23 AA8 2 THR B 69 ? ILE B 74 ? THR L 69 ILE L 74 AA8 3 PHE B 61 ? SER B 66 ? PHE L 61 SER L 66 AA9 1 SER B 117 ? PHE B 121 ? SER L 117 PHE L 121 AA9 2 THR B 134 ? PHE B 142 ? THR L 134 PHE L 142 AA9 3 TYR B 175 ? SER B 182 ? TYR L 175 SER L 182 AA9 4 VAL B 162 ? THR B 164 ? VAL L 162 THR L 164 AB1 1 SER B 117 ? PHE B 121 ? SER L 117 PHE L 121 AB1 2 THR B 134 ? PHE B 142 ? THR L 134 PHE L 142 AB1 3 TYR B 175 ? SER B 182 ? TYR L 175 SER L 182 AB1 4 SER B 168 ? LYS B 169 ? SER L 168 LYS L 169 AB2 1 SER B 156 ? PRO B 157 ? SER L 156 PRO L 157 AB2 2 VAL B 147 ? ALA B 153 ? VAL L 147 ALA L 153 AB2 3 TYR B 194 ? HIS B 200 ? TYR L 194 HIS L 200 AB2 4 THR B 208 ? VAL B 209 ? THR L 208 VAL L 209 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 5 ? N VAL H 5 O ALA A 23 ? O ALA H 23 AA1 2 3 N LEU A 18 ? N LEU H 18 O MET A 83 ? O MET H 83 AA1 3 4 O GLN A 82 ? O GLN H 82 N THR A 69 ? N THR H 69 AA2 1 2 N VAL A 12 ? N VAL H 12 O THR A 113 ? O THR H 113 AA2 2 3 O VAL A 112 ? O VAL H 112 N ALA A 92 ? N ALA H 92 AA2 3 4 O TYR A 95 ? O TYR H 95 N VAL A 37 ? N VAL H 37 AA2 4 5 N TRP A 36 ? N TRP H 36 O VAL A 48 ? O VAL H 48 AA2 5 6 N TYR A 50 ? N TYR H 50 O TYR A 59 ? O TYR H 59 AA3 1 2 N VAL A 12 ? N VAL H 12 O THR A 113 ? O THR H 113 AA3 2 3 O VAL A 112 ? O VAL H 112 N ALA A 92 ? N ALA H 92 AA3 3 4 N ARG A 98 ? N ARG H 98 O LEU A 105 ? O LEU H 105 AA4 1 2 N THR A 123 ? N THR H 123 O GLN A 147 ? O GLN H 147 AA4 2 3 N ALA A 146 ? N ALA H 146 O ALA A 183 ? O ALA H 183 AA4 3 4 O LYS A 180 ? O LYS H 180 N ARG A 177 ? N ARG H 177 AA5 1 2 N SER A 157 ? N SER H 157 O LYS A 205 ? O LYS H 205 AA5 2 3 N CYS A 204 ? N CYS H 204 O LYS A 215 ? O LYS H 215 AA6 1 2 N VAL B 10 ? N VAL L 10 O THR B 107 ? O THR L 107 AA6 2 3 O LEU B 106 ? O LEU L 106 N ALA B 83 ? N ALA L 83 AA6 3 4 O GLY B 84 ? O GLY L 84 N GLN B 37 ? N GLN L 37 AA6 4 5 N GLN B 36 ? N GLN L 36 O VAL B 44 ? O VAL L 44 AA7 1 2 N VAL B 10 ? N VAL L 10 O THR B 107 ? O THR L 107 AA7 2 3 O LEU B 106 ? O LEU L 106 N ALA B 83 ? N ALA L 83 AA7 3 4 N VAL B 89 ? N VAL L 89 O VAL B 99 ? O VAL L 99 AA8 1 2 N ALA B 18 ? N ALA L 18 O ILE B 74 ? O ILE L 74 AA8 2 3 O THR B 71 ? O THR L 71 N SER B 64 ? N SER L 64 AA9 1 2 N PHE B 121 ? N PHE L 121 O VAL B 136 ? O VAL L 136 AA9 2 3 N LEU B 135 ? N LEU L 135 O LEU B 181 ? O LEU L 181 AA9 3 4 O TYR B 180 ? O TYR L 180 N GLU B 163 ? N GLU L 163 AB1 1 2 N PHE B 121 ? N PHE L 121 O VAL B 136 ? O VAL L 136 AB1 2 3 N LEU B 135 ? N LEU L 135 O LEU B 181 ? O LEU L 181 AB1 3 4 O ALA B 176 ? O ALA L 176 N SER B 168 ? N SER L 168 AB2 1 2 O SER B 156 ? O SER L 156 N ALA B 153 ? N ALA L 153 AB2 2 3 N ALA B 150 ? N ALA L 150 O GLN B 197 ? O GLN L 197 AB2 3 4 N TYR B 194 ? N TYR L 194 O VAL B 209 ? O VAL L 209 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN H 39 ? ? -160.07 112.45 2 1 ASP H 53 ? ? 59.41 -165.90 3 1 ALA H 55 ? ? -78.97 -163.91 4 1 ARG H 67 ? ? -130.45 -66.96 5 1 LEU H 150 ? ? -170.67 127.29 6 1 ASN L 25 ? ? -51.72 106.22 7 1 ASP L 50 ? ? 70.97 -66.28 8 1 PRO L 54 ? ? -72.01 -166.78 9 1 SER L 92 ? ? -79.24 32.87 10 1 ALA L 133 ? ? -161.44 106.23 11 1 ALA L 146 ? ? -152.12 78.45 12 1 ASP L 154 ? ? 57.22 -120.25 13 1 GLN L 170 ? ? -106.62 -164.72 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x,z+1/4 3 y,-x,z+3/4 4 -x,-y,z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 20.26621587 11.4647186975 -14.1933200517 2.32077704551 ? 0.164626495636 ? -0.397636206546 ? 1.34109297115 ? -0.116719103806 ? 0.96656327723 ? 8.29220595389 ? 2.69745584717 ? 2.76236843808 ? 7.17025089817 ? 3.16204318646 ? 8.2133924286 ? 0.447191502559 ? 0.915750490195 ? 0.0515352140154 ? -1.11599632466 ? -0.319370984152 ? 0.948272658454 ? 3.67659964038 ? -0.521602314166 ? 0.0439074683043 ? 2 'X-RAY DIFFRACTION' ? refined 21.913608686 -12.3046578927 4.32131958418 3.09797403203 ? -0.259861446766 ? -0.827763254521 ? 1.43034058037 ? -0.0219714393281 ? 2.37173335119 ? 3.99689354169 ? -0.0225803052466 ? 0.510687304927 ? 2.85538624036 ? -0.778926051101 ? 4.43598896852 ? -0.776800091108 ? 0.357939747412 ? 0.530145218616 ? -3.91957780843 ? -0.773539059354 ? 3.22744058948 ? -0.136405671266 ? -1.6075797279 ? 1.23285709063 ? 3 'X-RAY DIFFRACTION' ? refined 28.0278348745 23.3349886478 2.82644171181 0.559718683599 ? -0.007340472801 ? -0.0691856923976 ? 0.566012217023 ? 0.061342150042 ? 0.75550302208 ? 7.07214593073 ? -0.735815715914 ? 3.24605972054 ? 6.17849846156 ? -1.49475959287 ? 12.2384670935 ? -0.0243240671435 ? 0.503569739386 ? 0.507330627846 ? 0.521145112864 ? -0.250519248256 ? -0.170147883249 ? 0.365104563902 ? 0.874282424954 ? 0.27448983248 ? 4 'X-RAY DIFFRACTION' ? refined 35.3167878672 -13.6159590916 13.9771870622 2.29727913931 ? 0.139609587548 ? -0.318195523752 ? 1.25151528841 ? 0.13972036568 ? 1.48067578646 ? 7.23664900781 ? 0.925184869087 ? 0.0769608072091 ? 5.47857354171 ? 2.97556442265 ? 6.50578037001 ? -0.094559891816 ? 0.00342021023892 ? -1.20613621094 ? -1.62398382574 ? 0.150774965493 ? 1.11912621893 ? 0.325343294901 ? 0.725940752004 ? 0.0318784567383 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'H' and (resid 2 through 114 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'H' and (resid 118 through 218 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'L' and (resid 2 through 108 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'L' and (resid 111 through 213 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 H GLU 1 ? A GLU 1 2 1 Y 1 H CYS 130 ? A CYS 130 3 1 Y 1 H GLU 131 ? A GLU 131 4 1 Y 1 H ASN 132 ? A ASN 132 5 1 Y 1 H SER 133 ? A SER 133 6 1 Y 1 H PRO 134 ? A PRO 134 7 1 Y 1 H SER 135 ? A SER 135 8 1 Y 1 H ASP 136 ? A ASP 136 9 1 Y 1 H THR 137 ? A THR 137 10 1 Y 1 H SER 138 ? A SER 138 11 1 Y 1 H SER 139 ? A SER 139 12 1 Y 1 H VAL 140 ? A VAL 140 13 1 Y 1 H ASN 163 ? A ASN 163 14 1 Y 1 H SER 164 ? A SER 164 15 1 Y 1 H ASP 165 ? A ASP 165 16 1 Y 1 H ILE 166 ? A ILE 166 17 1 Y 1 H SER 167 ? A SER 167 18 1 Y 1 H SER 168 ? A SER 168 19 1 Y 1 H PRO 190 ? A PRO 190 20 1 Y 1 H SER 191 ? A SER 191 21 1 Y 1 H LYS 192 ? A LYS 192 22 1 Y 1 H ASP 193 ? A ASP 193 23 1 Y 1 H VAL 194 ? A VAL 194 24 1 Y 1 H MET 195 ? A MET 195 25 1 Y 1 H GLN 196 ? A GLN 196 26 1 Y 1 H GLY 197 ? A GLY 197 27 1 Y 1 H THR 198 ? A THR 198 28 1 Y 1 H ASP 199 ? A ASP 199 29 1 Y 1 H GLU 200 ? A GLU 200 30 1 Y 1 H HIS 201 ? A HIS 201 31 1 Y 1 H VAL 202 ? A VAL 202 32 1 Y 1 H LEU 219 ? A LEU 219 33 1 Y 1 H PRO 220 ? A PRO 220 34 1 Y 1 H VAL 221 ? A VAL 221 35 1 Y 1 L SER 1 ? B SER 1 36 1 Y 1 L CYS 214 ? B CYS 214 37 1 Y 1 L SER 215 ? B SER 215 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Italian Association for Cancer Research' Italy 'IG 17032' 1 'Worldwide Cancer Research' ? 19-0096 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5IFH _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 41' _space_group.name_Hall 'P 4w' _space_group.IT_number 76 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 6ZTD _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014177 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014177 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009392 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 5.96793 ? ? ? 14.89577 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 15.91112 ? ? ? 10.84690 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_