data_6ZXP
# 
_entry.id   6ZXP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.394 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6ZXP         pdb_00006zxp 10.2210/pdb6zxp/pdb 
WWPDB D_1292110366 ?            ?                   
BMRB  34544        ?            10.13018/BMR34544   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2021-05-19 
2 'Structure model' 1 1 2021-05-26 
3 'Structure model' 1 2 2023-06-14 
4 'Structure model' 1 3 2024-06-19 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
3 3 'Structure model' Other                 
4 4 'Structure model' 'Data collection'     
5 4 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation             
2 3 'Structure model' database_2           
3 3 'Structure model' pdbx_database_status 
4 4 'Structure model' chem_comp_atom       
5 4 'Structure model' chem_comp_bond       
6 4 'Structure model' database_2           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'                   
2 2 'Structure model' '_citation.title'                            
3 3 'Structure model' '_database_2.pdbx_DOI'                       
4 3 'Structure model' '_database_2.pdbx_database_accession'        
5 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 
6 4 'Structure model' '_database_2.pdbx_DOI'                       
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        6ZXP 
_pdbx_database_status.recvd_initial_deposition_date   2020-07-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.status_code_nmr_data            REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        
;Solution structure of the C-terminal domain of the vaccinia virus DNA polymerase processivity factor component A20 fused to a short peptide from the viral DNA polymerase E9.
;
_pdbx_database_related.db_id          34544 
_pdbx_database_related.content_type   unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bersch, B.'      1 0000-0003-1138-4911 
'Tarbouriech, N.' 2 0000-0002-0206-3959 
'Burmeister, W.'  3 0000-0003-0876-6118 
'Iseni, F.'       4 0000-0003-3909-9688 
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.unpublished_flag 
? ? ? ? ? ? ? UK ? ? primary J.Mol.Biol.             JMOBAK 0070 1089-8638 ? ? 433 ? 167009 167009 
;Solution Structure of the C-terminal Domain of A20, the Missing Brick for the Characterization of the Interface between Vaccinia Virus DNA Polymerase and its Processivity Factor.
;
2021 ? 10.1016/j.jmb.2021.167009 33901538 ? 
? ? ? ? ? ? ? UK ? ? 1       'Nature Communications' ?      ?    2041-1723 ? ? 8   ? 1455   ?      
'The vaccinia virus DNA polymerase structure provides insights into the mode of processivity factor binding.' 2017 ? ? 29129932 ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bersch, B.'       1  ?                   
primary 'Tarbouriech, N.'  2  ?                   
primary 'Burmeister, W.P.' 3  ?                   
primary 'Iseni, F.'        4  ?                   
1       'Tarbouriech, N.'  5  ?                   
1       'Ducournau, C.'    6  ?                   
1       'Hutin, S.'        7  ?                   
1       'Mas, P.J.'        8  ?                   
1       'Man, P.'          9  ?                   
1       'Forest, E.'       10 ?                   
1       'Hart, D.J.'       11 ?                   
1       'Peyrefitte, C.N.' 12 ?                   
1       'Burmeister, W.'   13 ?                   
1       'Iseni, F.'        14 0000-0003-3909-9688 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           
'DNA polymerase processivity factor component A20,DNA polymerase processivity factor component E9' 
_entity.formula_weight             16882.934 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              L147A 
_entity.pdbx_fragment              ? 
_entity.details                    
;This is a recombinant fusion protein: residues 2-124 correspond to A20_VACCC:304-426, residues 125-135 to a flexible linker and residues 136-150 to E9_VACCC:576-590. E9_VACCC:L587A mutation,This is a recombinant fusion protein: residues 2-124 correspond to A20_VACCC:304-426, residues 125-135 to a flexible linker and residues 136-150 to E9_VACCC:576-590. E9_VACCC:L587A mutation
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GNGKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENC
KVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFENASGNGSGGGSNRLEEEINNQLALQKS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GNGKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENC
KVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFENASGNGSGGGSNRLEEEINNQLALQKS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASN n 
1 3   GLY n 
1 4   LYS n 
1 5   TYR n 
1 6   PHE n 
1 7   SER n 
1 8   LYS n 
1 9   VAL n 
1 10  GLY n 
1 11  SER n 
1 12  ALA n 
1 13  GLY n 
1 14  LEU n 
1 15  LYS n 
1 16  GLN n 
1 17  LEU n 
1 18  THR n 
1 19  ASN n 
1 20  LYS n 
1 21  LEU n 
1 22  ASP n 
1 23  ILE n 
1 24  ASN n 
1 25  GLU n 
1 26  CYS n 
1 27  ALA n 
1 28  THR n 
1 29  VAL n 
1 30  ASP n 
1 31  GLU n 
1 32  LEU n 
1 33  VAL n 
1 34  ASP n 
1 35  GLU n 
1 36  ILE n 
1 37  ASN n 
1 38  LYS n 
1 39  SER n 
1 40  GLY n 
1 41  THR n 
1 42  VAL n 
1 43  LYS n 
1 44  ARG n 
1 45  LYS n 
1 46  ILE n 
1 47  LYS n 
1 48  ASN n 
1 49  GLN n 
1 50  SER n 
1 51  ALA n 
1 52  PHE n 
1 53  ASP n 
1 54  LEU n 
1 55  SER n 
1 56  ARG n 
1 57  GLU n 
1 58  CYS n 
1 59  LEU n 
1 60  GLY n 
1 61  TYR n 
1 62  PRO n 
1 63  GLU n 
1 64  ALA n 
1 65  ASP n 
1 66  PHE n 
1 67  ILE n 
1 68  THR n 
1 69  LEU n 
1 70  VAL n 
1 71  ASN n 
1 72  ASN n 
1 73  MET n 
1 74  ARG n 
1 75  PHE n 
1 76  LYS n 
1 77  ILE n 
1 78  GLU n 
1 79  ASN n 
1 80  CYS n 
1 81  LYS n 
1 82  VAL n 
1 83  VAL n 
1 84  ASN n 
1 85  PHE n 
1 86  ASN n 
1 87  ILE n 
1 88  GLU n 
1 89  ASN n 
1 90  THR n 
1 91  ASN n 
1 92  CYS n 
1 93  LEU n 
1 94  ASN n 
1 95  ASN n 
1 96  PRO n 
1 97  SER n 
1 98  ILE n 
1 99  GLU n 
1 100 THR n 
1 101 ILE n 
1 102 TYR n 
1 103 ARG n 
1 104 ASN n 
1 105 PHE n 
1 106 ASN n 
1 107 GLN n 
1 108 PHE n 
1 109 VAL n 
1 110 SER n 
1 111 ILE n 
1 112 PHE n 
1 113 ASN n 
1 114 VAL n 
1 115 VAL n 
1 116 THR n 
1 117 ASP n 
1 118 VAL n 
1 119 LYS n 
1 120 LYS n 
1 121 ARG n 
1 122 LEU n 
1 123 PHE n 
1 124 GLU n 
1 125 ASN n 
1 126 ALA n 
1 127 SER n 
1 128 GLY n 
1 129 ASN n 
1 130 GLY n 
1 131 SER n 
1 132 GLY n 
1 133 GLY n 
1 134 GLY n 
1 135 SER n 
1 136 ASN n 
1 137 ARG n 
1 138 LEU n 
1 139 GLU n 
1 140 GLU n 
1 141 GLU n 
1 142 ILE n 
1 143 ASN n 
1 144 ASN n 
1 145 GLN n 
1 146 LEU n 
1 147 ALA n 
1 148 LEU n 
1 149 GLN n 
1 150 LYS n 
1 151 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   135 ? ? A20R ? ? ? ? ? ? 'Vaccinia virus Copenhagen' 10249 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? -Star ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 136 151 ? ? ?    ? ? ? ? ? ? 'Vaccinia virus Copenhagen' 10249 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? -Star ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   1   GLY GLY A . n 
A 1 2   ASN 2   2   2   ASN ASN A . n 
A 1 3   GLY 3   3   3   GLY GLY A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   TYR 5   5   5   TYR TYR A . n 
A 1 6   PHE 6   6   6   PHE PHE A . n 
A 1 7   SER 7   7   7   SER SER A . n 
A 1 8   LYS 8   8   8   LYS LYS A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  LYS 15  15  15  LYS LYS A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ASN 19  19  19  ASN ASN A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  ASP 22  22  22  ASP ASP A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  CYS 26  26  26  CYS CYS A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  GLU 31  31  31  GLU GLU A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  ILE 36  36  36  ILE ILE A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  SER 39  39  39  SER SER A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  ILE 46  46  46  ILE ILE A . n 
A 1 47  LYS 47  47  47  LYS LYS A . n 
A 1 48  ASN 48  48  48  ASN ASN A . n 
A 1 49  GLN 49  49  49  GLN GLN A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  ALA 51  51  51  ALA ALA A . n 
A 1 52  PHE 52  52  52  PHE PHE A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  CYS 58  58  58  CYS CYS A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  GLY 60  60  60  GLY GLY A . n 
A 1 61  TYR 61  61  61  TYR TYR A . n 
A 1 62  PRO 62  62  62  PRO PRO A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  PHE 66  66  66  PHE PHE A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  MET 73  73  73  MET MET A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  ILE 77  77  77  ILE ILE A . n 
A 1 78  GLU 78  78  78  GLU GLU A . n 
A 1 79  ASN 79  79  79  ASN ASN A . n 
A 1 80  CYS 80  80  80  CYS CYS A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  VAL 83  83  83  VAL VAL A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  PHE 85  85  85  PHE PHE A . n 
A 1 86  ASN 86  86  86  ASN ASN A . n 
A 1 87  ILE 87  87  87  ILE ILE A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  ASN 91  91  91  ASN ASN A . n 
A 1 92  CYS 92  92  92  CYS CYS A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  ASN 94  94  94  ASN ASN A . n 
A 1 95  ASN 95  95  95  ASN ASN A . n 
A 1 96  PRO 96  96  96  PRO PRO A . n 
A 1 97  SER 97  97  97  SER SER A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  GLU 99  99  99  GLU GLU A . n 
A 1 100 THR 100 100 100 THR THR A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 TYR 102 102 102 TYR TYR A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 ASN 104 104 104 ASN ASN A . n 
A 1 105 PHE 105 105 105 PHE PHE A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 GLN 107 107 107 GLN GLN A . n 
A 1 108 PHE 108 108 108 PHE PHE A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 ILE 111 111 111 ILE ILE A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 ASP 117 117 117 ASP ASP A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 ARG 121 121 121 ARG ARG A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 GLU 124 124 124 GLU GLU A . n 
A 1 125 ASN 125 125 125 ASN ASN A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 SER 127 127 127 SER SER A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 ASN 129 129 129 ASN ASN A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 SER 131 131 131 SER SER A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 SER 135 135 135 SER SER A . n 
A 1 136 ASN 136 136 136 ASN ASN A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 ASN 143 143 143 ASN ASN A . n 
A 1 144 ASN 144 144 144 ASN ASN A . n 
A 1 145 GLN 145 145 145 GLN GLN A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 ALA 147 147 147 ALA ALA A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 GLN 149 149 149 GLN GLN A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 SER 151 151 151 SER SER A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6ZXP 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6ZXP 
_struct.title                        
;Solution structure of the C-terminal domain of the vaccinia virus DNA polymerase processivity factor component A20 fused to a short peptide from the viral DNA polymerase E9.
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6ZXP 
_struct_keywords.text            'Poxviridae, DNA polymerase holoenzyme, processivity factor binding, REPLICATION' 
_struct_keywords.pdbx_keywords   REPLICATION 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP A20_VACCC P20995 ? 1 
;NGKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCK
VVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE
;
304 
2 PDB 6ZXP      6ZXP   ? 1 ? 136 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6ZXP A 2   ? 124 ? P20995 304 ? 426 ? 2   124 
2 2 6ZXP A 136 ? 151 ? 6ZXP   136 ? 151 ? 136 151 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6ZXP GLY A 1   ? UNP P20995 ? ? 'expression tag' 1   1  
1 6ZXP ASN A 125 ? UNP P20995 ? ? linker           125 2  
1 6ZXP ALA A 126 ? UNP P20995 ? ? linker           126 3  
1 6ZXP SER A 127 ? UNP P20995 ? ? linker           127 4  
1 6ZXP GLY A 128 ? UNP P20995 ? ? linker           128 5  
1 6ZXP ASN A 129 ? UNP P20995 ? ? linker           129 6  
1 6ZXP GLY A 130 ? UNP P20995 ? ? linker           130 7  
1 6ZXP SER A 131 ? UNP P20995 ? ? linker           131 8  
1 6ZXP GLY A 132 ? UNP P20995 ? ? linker           132 9  
1 6ZXP GLY A 133 ? UNP P20995 ? ? linker           133 10 
1 6ZXP GLY A 134 ? UNP P20995 ? ? linker           134 11 
1 6ZXP SER A 135 ? UNP P20995 ? ? linker           135 12 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 0    ? 
1 MORE         0    ? 
1 'SSA (A^2)'  8440 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 GLY A 10  ? ASP A 22  ? GLY A 10  ASP A 22  1 ? 13 
HELX_P HELX_P2 AA2 THR A 28  ? SER A 39  ? THR A 28  SER A 39  1 ? 12 
HELX_P HELX_P3 AA3 SER A 39  ? GLN A 49  ? SER A 39  GLN A 49  1 ? 11 
HELX_P HELX_P4 AA4 SER A 50  ? GLY A 60  ? SER A 50  GLY A 60  1 ? 11 
HELX_P HELX_P5 AA5 PRO A 62  ? ASN A 72  ? PRO A 62  ASN A 72  1 ? 11 
HELX_P HELX_P6 AA6 ASN A 91  ? ASN A 94  ? ASN A 91  ASN A 94  5 ? 4  
HELX_P HELX_P7 AA7 ASN A 95  ? ASN A 104 ? ASN A 95  ASN A 104 1 ? 10 
HELX_P HELX_P8 AA8 ASN A 104 ? PHE A 123 ? ASN A 104 PHE A 123 1 ? 20 
HELX_P HELX_P9 AA9 ARG A 137 ? LEU A 148 ? ARG A 137 LEU A 148 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     AA1 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 MET A 73 ? GLU A 78 ? MET A 73 GLU A 78 
AA1 2 LYS A 81 ? ILE A 87 ? LYS A 81 ILE A 87 
# 
_pdbx_struct_sheet_hbond.sheet_id                AA1 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ARG 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    74 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ARG 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     74 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   ASN 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    86 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    ASN 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     86 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  3  OD2  A ASP 117 ? ? HH12 A ARG 121 ? ? 1.58 
2  3  HZ1  A LYS 81  ? ? OD1  A ASP 117 ? ? 1.59 
3  6  HZ1  A LYS 81  ? ? OD1  A ASP 117 ? ? 1.60 
4  7  OE1  A GLU 35  ? ? HZ3  A LYS 38  ? ? 1.57 
5  7  HE   A ARG 137 ? ? OE2  A GLU 140 ? ? 1.59 
6  8  O    A LEU 54  ? ? HG   A CYS 58  ? ? 1.60 
7  10 OH   A TYR 5   ? ? HH   A TYR 102 ? ? 1.57 
8  12 HZ1  A LYS 81  ? ? OD1  A ASP 117 ? ? 1.58 
9  14 HG   A SER 135 ? ? OE1  A GLU 139 ? ? 1.57 
10 17 HG   A SER 135 ? ? OE1  A GLU 139 ? ? 1.59 
11 19 O    A PHE 6   ? ? HG   A SER 7   ? ? 1.59 
12 20 HH21 A ARG 137 ? ? OE1  A GLU 139 ? ? 1.57 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  LYS A 4   ? ? 59.41   70.93   
2   1  VAL A 9   ? ? 66.37   157.43  
3   1  ASN A 125 ? ? 178.22  140.50  
4   1  SER A 135 ? ? -52.70  -85.59  
5   1  ARG A 137 ? ? 67.04   -57.69  
6   2  LYS A 4   ? ? -97.30  43.34   
7   2  PHE A 6   ? ? 68.67   143.89  
8   2  VAL A 9   ? ? 177.13  158.12  
9   2  THR A 90  ? ? -77.16  25.81   
10  2  GLU A 124 ? ? -50.99  104.37  
11  2  ASN A 136 ? ? 68.89   -49.27  
12  2  ARG A 137 ? ? -143.77 -39.79  
13  3  TYR A 5   ? ? -101.09 -166.09 
14  3  VAL A 9   ? ? -37.81  143.87  
15  3  GLU A 124 ? ? -53.27  104.83  
16  3  ASN A 129 ? ? -159.10 59.75   
17  3  SER A 135 ? ? -56.04  -72.48  
18  3  ASN A 136 ? ? -177.58 -124.34 
19  4  GLU A 124 ? ? -47.60  104.16  
20  4  SER A 127 ? ? -107.86 44.18   
21  4  ARG A 137 ? ? 74.53   -67.93  
22  4  GLN A 149 ? ? -91.73  57.16   
23  5  LYS A 4   ? ? -132.03 -73.84  
24  5  TYR A 5   ? ? 59.26   -170.88 
25  5  PHE A 6   ? ? 61.81   -170.38 
26  5  SER A 7   ? ? 74.61   107.17  
27  5  GLU A 124 ? ? -52.13  96.08   
28  5  ASN A 136 ? ? -168.33 -167.90 
29  5  LEU A 148 ? ? -57.69  96.86   
30  5  LYS A 150 ? ? 61.44   126.70  
31  6  SER A 7   ? ? 49.06   87.09   
32  6  VAL A 9   ? ? 69.06   150.69  
33  6  GLU A 124 ? ? 45.09   71.19   
34  6  ASN A 129 ? ? -131.93 -73.89  
35  6  ASN A 136 ? ? -178.20 -170.89 
36  7  LYS A 4   ? ? 61.80   69.61   
37  7  PHE A 6   ? ? 57.35   99.08   
38  7  VAL A 9   ? ? 60.83   176.25  
39  7  SER A 11  ? ? 75.02   -8.05   
40  7  THR A 90  ? ? -78.94  20.77   
41  7  GLU A 124 ? ? -53.83  102.95  
42  7  SER A 131 ? ? 72.96   136.92  
43  7  SER A 135 ? ? -63.62  -78.91  
44  7  ASN A 136 ? ? -134.89 -152.01 
45  7  LEU A 148 ? ? -59.03  107.93  
46  7  LYS A 150 ? ? 72.17   127.53  
47  8  SER A 11  ? ? -98.05  40.37   
48  8  GLU A 124 ? ? -51.14  103.62  
49  8  ASN A 125 ? ? 67.67   63.44   
50  8  ASN A 136 ? ? 165.65  -161.04 
51  9  SER A 7   ? ? -165.16 39.07   
52  9  VAL A 9   ? ? 58.30   173.03  
53  9  GLU A 124 ? ? -50.80  107.70  
54  9  ASN A 129 ? ? -170.12 -36.56  
55  9  ASN A 136 ? ? 62.67   -165.77 
56  10 TYR A 5   ? ? 58.31   -167.95 
57  10 GLU A 124 ? ? -57.02  99.95   
58  10 ASN A 125 ? ? 55.41   77.13   
59  10 ASN A 129 ? ? 70.22   -63.14  
60  10 SER A 135 ? ? -62.25  94.64   
61  10 ASN A 136 ? ? 62.47   -74.28  
62  10 ARG A 137 ? ? -146.93 -37.29  
63  10 LEU A 148 ? ? -63.71  98.04   
64  10 GLN A 149 ? ? -117.89 67.92   
65  10 LYS A 150 ? ? 71.00   123.27  
66  11 THR A 90  ? ? -77.18  27.28   
67  11 LEU A 93  ? ? -69.13  0.59    
68  11 GLU A 124 ? ? 40.35   70.79   
69  11 ASN A 129 ? ? -153.58 -31.60  
70  11 ASN A 136 ? ? -175.31 -168.96 
71  12 TYR A 5   ? ? 55.53   90.22   
72  12 SER A 7   ? ? 54.45   85.77   
73  12 ASN A 125 ? ? 59.26   81.56   
74  12 ALA A 126 ? ? -121.45 -156.86 
75  12 SER A 127 ? ? -66.48  98.49   
76  12 SER A 131 ? ? -96.27  35.70   
77  12 SER A 135 ? ? -49.38  -70.22  
78  12 ASN A 136 ? ? 174.86  -27.03  
79  12 ARG A 137 ? ? -136.98 -51.76  
80  13 VAL A 9   ? ? 68.50   153.16  
81  13 CYS A 80  ? ? 73.62   -0.82   
82  13 GLU A 124 ? ? -48.21  102.98  
83  13 ASN A 125 ? ? 72.95   87.19   
84  14 THR A 90  ? ? -78.83  25.23   
85  14 GLU A 124 ? ? -45.00  97.28   
86  14 SER A 127 ? ? -107.82 62.08   
87  14 SER A 135 ? ? -88.23  -75.56  
88  14 ASN A 136 ? ? -145.04 -42.43  
89  14 ARG A 137 ? ? -157.71 -37.99  
90  15 VAL A 9   ? ? 68.31   147.09  
91  15 GLU A 124 ? ? -56.91  102.51  
92  15 ASN A 125 ? ? 59.78   75.97   
93  15 SER A 131 ? ? -171.22 141.37  
94  15 ASN A 136 ? ? 179.10  -51.82  
95  16 ASN A 2   ? ? -120.78 -69.94  
96  16 LYS A 4   ? ? -168.01 31.38   
97  16 PHE A 6   ? ? 59.39   -170.41 
98  16 LYS A 8   ? ? 64.66   118.83  
99  16 GLU A 124 ? ? -46.84  104.78  
100 16 ALA A 126 ? ? -100.04 -153.08 
101 16 SER A 127 ? ? -48.23  107.47  
102 16 ASN A 129 ? ? 70.92   -66.18  
103 16 SER A 131 ? ? -93.26  46.93   
104 16 ARG A 137 ? ? 70.56   -58.45  
105 17 LYS A 4   ? ? 54.09   78.44   
106 17 PHE A 6   ? ? 55.75   93.16   
107 17 LYS A 8   ? ? 32.58   99.99   
108 17 GLU A 124 ? ? -48.94  106.09  
109 17 SER A 135 ? ? -79.36  -79.93  
110 17 ARG A 137 ? ? -175.24 -43.95  
111 17 GLN A 149 ? ? 56.71   81.33   
112 18 LYS A 4   ? ? 53.08   72.37   
113 18 SER A 7   ? ? 65.05   -174.05 
114 18 LYS A 8   ? ? 74.40   114.39  
115 18 GLU A 124 ? ? -32.73  100.64  
116 18 ASN A 125 ? ? 70.18   86.42   
117 18 SER A 135 ? ? -57.65  -75.91  
118 18 ASN A 136 ? ? 178.83  -13.80  
119 18 ARG A 137 ? ? -148.78 -57.83  
120 19 LYS A 4   ? ? -136.40 -32.57  
121 19 TYR A 5   ? ? 60.53   -159.09 
122 19 SER A 7   ? ? 56.17   -169.71 
123 19 SER A 11  ? ? -91.68  32.94   
124 19 SER A 135 ? ? 51.82   -92.64  
125 19 ASN A 136 ? ? -155.86 -45.03  
126 19 ARG A 137 ? ? -151.51 -38.78  
127 19 GLN A 149 ? ? 54.53   79.74   
128 20 PHE A 6   ? ? 64.58   138.44  
129 20 VAL A 9   ? ? 66.67   143.91  
130 20 GLU A 124 ? ? -57.81  100.66  
131 20 ASN A 125 ? ? 53.87   72.59   
# 
_pdbx_nmr_ensemble.entry_id                                      6ZXP 
_pdbx_nmr_ensemble.conformers_calculated_total_number            1000 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             6ZXP 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
_pdbx_nmr_sample_details.label 
_pdbx_nmr_sample_details.type 
_pdbx_nmr_sample_details.details 
1 '1 mM [U-15N] A20-i3, 50 mM potassium phosphate, 300 mM NaCl, 1.2 mM TCEP, 90% H2O/10% D2O'      '90% H2O/10% D2O' 15N-H2O    
solution '3 mm tube' 
2 '0.8 mM [U-15N13C] A20-i3, 50 mM potassium phosphate, 300 mM NaCl, 1.2 mM TCEP, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N13C-H2O 
solution '3 mm tube' 
3 '1 mM [U-15N13C] A20-i3, 50 mM potassium phosphate, 300 mM NaCl, 1.2 mM TCEP, 90% H2O/10% D2O'   '90% H2O/10% D2O' 15N-D2O    
solution '3 mm tube' 
# 
loop_
_pdbx_nmr_exptl_sample.solution_id 
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
1 A20-i3                1   ? mM '[U-15N]'           
1 'potassium phosphate' 50  ? mM 'natural abundance' 
1 NaCl                  300 ? mM 'natural abundance' 
1 TCEP                  1.2 ? mM 'natural abundance' 
2 A20-i3                0.8 ? mM '[U-15N13C]'        
2 'potassium phosphate' 50  ? mM 'natural abundance' 
2 NaCl                  300 ? mM 'natural abundance' 
2 TCEP                  1.2 ? mM 'natural abundance' 
3 A20-i3                1   ? mM '[U-15N13C]'        
3 'potassium phosphate' 50  ? mM 'natural abundance' 
3 NaCl                  300 ? mM 'natural abundance' 
3 TCEP                  1.2 ? mM 'natural abundance' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            298 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     6 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         0.3 
_pdbx_nmr_exptl_sample_conditions.details                '3 mm tube' 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   M 
_pdbx_nmr_exptl_sample_conditions.label                  general 
_pdbx_nmr_exptl_sample_conditions.pH_err                 0.1 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        0.5 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1  1 1 15N-Trosy                 1 isotropic 
2  1 2 13C-HSQC                  1 isotropic 
3  1 3 2D-Tocsy                  1 isotropic 
4  1 2 '3D HNCO'                 1 isotropic 
5  1 2 '3D HNCACB'               1 isotropic 
11 1 2 '3D HN(COCA)CB'           1 isotropic 
10 1 2 '3D HCCH-TOCSY'           1 isotropic 
9  1 1 '3D-15N-edited NOESY'     1 isotropic 
8  1 2 '3D-13C edited NOESY'     1 isotropic 
7  1 2 '3D-13C-13C methyl noesy' 1 isotropic 
6  1 3 '2D NOESY'                1 isotropic 
14 1 1 15N-R1                    2 isotropic 
13 1 1 15N-R2                    2 isotropic 
12 1 1 '15N hetNOE'              2 isotropic 
# 
_pdbx_nmr_refine.entry_id           6ZXP 
_pdbx_nmr_refine.method             'molecular dynamics' 
_pdbx_nmr_refine.details            'in explicit water' 
_pdbx_nmr_refine.software_ordinal   6 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 collection                  TopSpin           ? 'Bruker Biospin'                               
2 processing                  TopSpin           ? 'Bruker Biospin'                               
3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN                                           
4 'peak picking'              UNIO              ? 'Torsten Herrmann'                             
5 'structure calculation'     ARIA              ? 
;Linge, O'Donoghue and Nilges
;
6 'structure calculation'     CNS               ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
ILE N    N N N 137 
ILE CA   C N S 138 
ILE C    C N N 139 
ILE O    O N N 140 
ILE CB   C N S 141 
ILE CG1  C N N 142 
ILE CG2  C N N 143 
ILE CD1  C N N 144 
ILE OXT  O N N 145 
ILE H    H N N 146 
ILE H2   H N N 147 
ILE HA   H N N 148 
ILE HB   H N N 149 
ILE HG12 H N N 150 
ILE HG13 H N N 151 
ILE HG21 H N N 152 
ILE HG22 H N N 153 
ILE HG23 H N N 154 
ILE HD11 H N N 155 
ILE HD12 H N N 156 
ILE HD13 H N N 157 
ILE HXT  H N N 158 
LEU N    N N N 159 
LEU CA   C N S 160 
LEU C    C N N 161 
LEU O    O N N 162 
LEU CB   C N N 163 
LEU CG   C N N 164 
LEU CD1  C N N 165 
LEU CD2  C N N 166 
LEU OXT  O N N 167 
LEU H    H N N 168 
LEU H2   H N N 169 
LEU HA   H N N 170 
LEU HB2  H N N 171 
LEU HB3  H N N 172 
LEU HG   H N N 173 
LEU HD11 H N N 174 
LEU HD12 H N N 175 
LEU HD13 H N N 176 
LEU HD21 H N N 177 
LEU HD22 H N N 178 
LEU HD23 H N N 179 
LEU HXT  H N N 180 
LYS N    N N N 181 
LYS CA   C N S 182 
LYS C    C N N 183 
LYS O    O N N 184 
LYS CB   C N N 185 
LYS CG   C N N 186 
LYS CD   C N N 187 
LYS CE   C N N 188 
LYS NZ   N N N 189 
LYS OXT  O N N 190 
LYS H    H N N 191 
LYS H2   H N N 192 
LYS HA   H N N 193 
LYS HB2  H N N 194 
LYS HB3  H N N 195 
LYS HG2  H N N 196 
LYS HG3  H N N 197 
LYS HD2  H N N 198 
LYS HD3  H N N 199 
LYS HE2  H N N 200 
LYS HE3  H N N 201 
LYS HZ1  H N N 202 
LYS HZ2  H N N 203 
LYS HZ3  H N N 204 
LYS HXT  H N N 205 
MET N    N N N 206 
MET CA   C N S 207 
MET C    C N N 208 
MET O    O N N 209 
MET CB   C N N 210 
MET CG   C N N 211 
MET SD   S N N 212 
MET CE   C N N 213 
MET OXT  O N N 214 
MET H    H N N 215 
MET H2   H N N 216 
MET HA   H N N 217 
MET HB2  H N N 218 
MET HB3  H N N 219 
MET HG2  H N N 220 
MET HG3  H N N 221 
MET HE1  H N N 222 
MET HE2  H N N 223 
MET HE3  H N N 224 
MET HXT  H N N 225 
PHE N    N N N 226 
PHE CA   C N S 227 
PHE C    C N N 228 
PHE O    O N N 229 
PHE CB   C N N 230 
PHE CG   C Y N 231 
PHE CD1  C Y N 232 
PHE CD2  C Y N 233 
PHE CE1  C Y N 234 
PHE CE2  C Y N 235 
PHE CZ   C Y N 236 
PHE OXT  O N N 237 
PHE H    H N N 238 
PHE H2   H N N 239 
PHE HA   H N N 240 
PHE HB2  H N N 241 
PHE HB3  H N N 242 
PHE HD1  H N N 243 
PHE HD2  H N N 244 
PHE HE1  H N N 245 
PHE HE2  H N N 246 
PHE HZ   H N N 247 
PHE HXT  H N N 248 
PRO N    N N N 249 
PRO CA   C N S 250 
PRO C    C N N 251 
PRO O    O N N 252 
PRO CB   C N N 253 
PRO CG   C N N 254 
PRO CD   C N N 255 
PRO OXT  O N N 256 
PRO H    H N N 257 
PRO HA   H N N 258 
PRO HB2  H N N 259 
PRO HB3  H N N 260 
PRO HG2  H N N 261 
PRO HG3  H N N 262 
PRO HD2  H N N 263 
PRO HD3  H N N 264 
PRO HXT  H N N 265 
SER N    N N N 266 
SER CA   C N S 267 
SER C    C N N 268 
SER O    O N N 269 
SER CB   C N N 270 
SER OG   O N N 271 
SER OXT  O N N 272 
SER H    H N N 273 
SER H2   H N N 274 
SER HA   H N N 275 
SER HB2  H N N 276 
SER HB3  H N N 277 
SER HG   H N N 278 
SER HXT  H N N 279 
THR N    N N N 280 
THR CA   C N S 281 
THR C    C N N 282 
THR O    O N N 283 
THR CB   C N R 284 
THR OG1  O N N 285 
THR CG2  C N N 286 
THR OXT  O N N 287 
THR H    H N N 288 
THR H2   H N N 289 
THR HA   H N N 290 
THR HB   H N N 291 
THR HG1  H N N 292 
THR HG21 H N N 293 
THR HG22 H N N 294 
THR HG23 H N N 295 
THR HXT  H N N 296 
TYR N    N N N 297 
TYR CA   C N S 298 
TYR C    C N N 299 
TYR O    O N N 300 
TYR CB   C N N 301 
TYR CG   C Y N 302 
TYR CD1  C Y N 303 
TYR CD2  C Y N 304 
TYR CE1  C Y N 305 
TYR CE2  C Y N 306 
TYR CZ   C Y N 307 
TYR OH   O N N 308 
TYR OXT  O N N 309 
TYR H    H N N 310 
TYR H2   H N N 311 
TYR HA   H N N 312 
TYR HB2  H N N 313 
TYR HB3  H N N 314 
TYR HD1  H N N 315 
TYR HD2  H N N 316 
TYR HE1  H N N 317 
TYR HE2  H N N 318 
TYR HH   H N N 319 
TYR HXT  H N N 320 
VAL N    N N N 321 
VAL CA   C N S 322 
VAL C    C N N 323 
VAL O    O N N 324 
VAL CB   C N N 325 
VAL CG1  C N N 326 
VAL CG2  C N N 327 
VAL OXT  O N N 328 
VAL H    H N N 329 
VAL H2   H N N 330 
VAL HA   H N N 331 
VAL HB   H N N 332 
VAL HG11 H N N 333 
VAL HG12 H N N 334 
VAL HG13 H N N 335 
VAL HG21 H N N 336 
VAL HG22 H N N 337 
VAL HG23 H N N 338 
VAL HXT  H N N 339 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
ILE N   CA   sing N N 129 
ILE N   H    sing N N 130 
ILE N   H2   sing N N 131 
ILE CA  C    sing N N 132 
ILE CA  CB   sing N N 133 
ILE CA  HA   sing N N 134 
ILE C   O    doub N N 135 
ILE C   OXT  sing N N 136 
ILE CB  CG1  sing N N 137 
ILE CB  CG2  sing N N 138 
ILE CB  HB   sing N N 139 
ILE CG1 CD1  sing N N 140 
ILE CG1 HG12 sing N N 141 
ILE CG1 HG13 sing N N 142 
ILE CG2 HG21 sing N N 143 
ILE CG2 HG22 sing N N 144 
ILE CG2 HG23 sing N N 145 
ILE CD1 HD11 sing N N 146 
ILE CD1 HD12 sing N N 147 
ILE CD1 HD13 sing N N 148 
ILE OXT HXT  sing N N 149 
LEU N   CA   sing N N 150 
LEU N   H    sing N N 151 
LEU N   H2   sing N N 152 
LEU CA  C    sing N N 153 
LEU CA  CB   sing N N 154 
LEU CA  HA   sing N N 155 
LEU C   O    doub N N 156 
LEU C   OXT  sing N N 157 
LEU CB  CG   sing N N 158 
LEU CB  HB2  sing N N 159 
LEU CB  HB3  sing N N 160 
LEU CG  CD1  sing N N 161 
LEU CG  CD2  sing N N 162 
LEU CG  HG   sing N N 163 
LEU CD1 HD11 sing N N 164 
LEU CD1 HD12 sing N N 165 
LEU CD1 HD13 sing N N 166 
LEU CD2 HD21 sing N N 167 
LEU CD2 HD22 sing N N 168 
LEU CD2 HD23 sing N N 169 
LEU OXT HXT  sing N N 170 
LYS N   CA   sing N N 171 
LYS N   H    sing N N 172 
LYS N   H2   sing N N 173 
LYS CA  C    sing N N 174 
LYS CA  CB   sing N N 175 
LYS CA  HA   sing N N 176 
LYS C   O    doub N N 177 
LYS C   OXT  sing N N 178 
LYS CB  CG   sing N N 179 
LYS CB  HB2  sing N N 180 
LYS CB  HB3  sing N N 181 
LYS CG  CD   sing N N 182 
LYS CG  HG2  sing N N 183 
LYS CG  HG3  sing N N 184 
LYS CD  CE   sing N N 185 
LYS CD  HD2  sing N N 186 
LYS CD  HD3  sing N N 187 
LYS CE  NZ   sing N N 188 
LYS CE  HE2  sing N N 189 
LYS CE  HE3  sing N N 190 
LYS NZ  HZ1  sing N N 191 
LYS NZ  HZ2  sing N N 192 
LYS NZ  HZ3  sing N N 193 
LYS OXT HXT  sing N N 194 
MET N   CA   sing N N 195 
MET N   H    sing N N 196 
MET N   H2   sing N N 197 
MET CA  C    sing N N 198 
MET CA  CB   sing N N 199 
MET CA  HA   sing N N 200 
MET C   O    doub N N 201 
MET C   OXT  sing N N 202 
MET CB  CG   sing N N 203 
MET CB  HB2  sing N N 204 
MET CB  HB3  sing N N 205 
MET CG  SD   sing N N 206 
MET CG  HG2  sing N N 207 
MET CG  HG3  sing N N 208 
MET SD  CE   sing N N 209 
MET CE  HE1  sing N N 210 
MET CE  HE2  sing N N 211 
MET CE  HE3  sing N N 212 
MET OXT HXT  sing N N 213 
PHE N   CA   sing N N 214 
PHE N   H    sing N N 215 
PHE N   H2   sing N N 216 
PHE CA  C    sing N N 217 
PHE CA  CB   sing N N 218 
PHE CA  HA   sing N N 219 
PHE C   O    doub N N 220 
PHE C   OXT  sing N N 221 
PHE CB  CG   sing N N 222 
PHE CB  HB2  sing N N 223 
PHE CB  HB3  sing N N 224 
PHE CG  CD1  doub Y N 225 
PHE CG  CD2  sing Y N 226 
PHE CD1 CE1  sing Y N 227 
PHE CD1 HD1  sing N N 228 
PHE CD2 CE2  doub Y N 229 
PHE CD2 HD2  sing N N 230 
PHE CE1 CZ   doub Y N 231 
PHE CE1 HE1  sing N N 232 
PHE CE2 CZ   sing Y N 233 
PHE CE2 HE2  sing N N 234 
PHE CZ  HZ   sing N N 235 
PHE OXT HXT  sing N N 236 
PRO N   CA   sing N N 237 
PRO N   CD   sing N N 238 
PRO N   H    sing N N 239 
PRO CA  C    sing N N 240 
PRO CA  CB   sing N N 241 
PRO CA  HA   sing N N 242 
PRO C   O    doub N N 243 
PRO C   OXT  sing N N 244 
PRO CB  CG   sing N N 245 
PRO CB  HB2  sing N N 246 
PRO CB  HB3  sing N N 247 
PRO CG  CD   sing N N 248 
PRO CG  HG2  sing N N 249 
PRO CG  HG3  sing N N 250 
PRO CD  HD2  sing N N 251 
PRO CD  HD3  sing N N 252 
PRO OXT HXT  sing N N 253 
SER N   CA   sing N N 254 
SER N   H    sing N N 255 
SER N   H2   sing N N 256 
SER CA  C    sing N N 257 
SER CA  CB   sing N N 258 
SER CA  HA   sing N N 259 
SER C   O    doub N N 260 
SER C   OXT  sing N N 261 
SER CB  OG   sing N N 262 
SER CB  HB2  sing N N 263 
SER CB  HB3  sing N N 264 
SER OG  HG   sing N N 265 
SER OXT HXT  sing N N 266 
THR N   CA   sing N N 267 
THR N   H    sing N N 268 
THR N   H2   sing N N 269 
THR CA  C    sing N N 270 
THR CA  CB   sing N N 271 
THR CA  HA   sing N N 272 
THR C   O    doub N N 273 
THR C   OXT  sing N N 274 
THR CB  OG1  sing N N 275 
THR CB  CG2  sing N N 276 
THR CB  HB   sing N N 277 
THR OG1 HG1  sing N N 278 
THR CG2 HG21 sing N N 279 
THR CG2 HG22 sing N N 280 
THR CG2 HG23 sing N N 281 
THR OXT HXT  sing N N 282 
TYR N   CA   sing N N 283 
TYR N   H    sing N N 284 
TYR N   H2   sing N N 285 
TYR CA  C    sing N N 286 
TYR CA  CB   sing N N 287 
TYR CA  HA   sing N N 288 
TYR C   O    doub N N 289 
TYR C   OXT  sing N N 290 
TYR CB  CG   sing N N 291 
TYR CB  HB2  sing N N 292 
TYR CB  HB3  sing N N 293 
TYR CG  CD1  doub Y N 294 
TYR CG  CD2  sing Y N 295 
TYR CD1 CE1  sing Y N 296 
TYR CD1 HD1  sing N N 297 
TYR CD2 CE2  doub Y N 298 
TYR CD2 HD2  sing N N 299 
TYR CE1 CZ   doub Y N 300 
TYR CE1 HE1  sing N N 301 
TYR CE2 CZ   sing Y N 302 
TYR CE2 HE2  sing N N 303 
TYR CZ  OH   sing N N 304 
TYR OH  HH   sing N N 305 
TYR OXT HXT  sing N N 306 
VAL N   CA   sing N N 307 
VAL N   H    sing N N 308 
VAL N   H2   sing N N 309 
VAL CA  C    sing N N 310 
VAL CA  CB   sing N N 311 
VAL CA  HA   sing N N 312 
VAL C   O    doub N N 313 
VAL C   OXT  sing N N 314 
VAL CB  CG1  sing N N 315 
VAL CB  CG2  sing N N 316 
VAL CB  HB   sing N N 317 
VAL CG1 HG11 sing N N 318 
VAL CG1 HG12 sing N N 319 
VAL CG1 HG13 sing N N 320 
VAL CG2 HG21 sing N N 321 
VAL CG2 HG22 sing N N 322 
VAL CG2 HG23 sing N N 323 
VAL OXT HXT  sing N N 324 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.details 
1 AVANCE ? Bruker 950 ? 
2 AVANCE ? Bruker 700 ? 
# 
_atom_sites.entry_id                    6ZXP 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_