data_6ZYC
# 
_entry.id   6ZYC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.394 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6ZYC         pdb_00006zyc 10.2210/pdb6zyc/pdb 
WWPDB D_1292110500 ?            ?                   
BMRB  34545        ?            10.13018/BMR34545   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2021-05-19 
2 'Structure model' 1 1 2021-05-26 
3 'Structure model' 1 2 2023-06-14 
4 'Structure model' 1 3 2024-06-19 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
3 3 'Structure model' Other                 
4 4 'Structure model' 'Data collection'     
5 4 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation             
2 3 'Structure model' database_2           
3 3 'Structure model' pdbx_database_status 
4 4 'Structure model' chem_comp_atom       
5 4 'Structure model' chem_comp_bond       
6 4 'Structure model' database_2           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'                   
2 2 'Structure model' '_citation.title'                            
3 3 'Structure model' '_database_2.pdbx_DOI'                       
4 3 'Structure model' '_database_2.pdbx_database_accession'        
5 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 
6 4 'Structure model' '_database_2.pdbx_DOI'                       
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        6ZYC 
_pdbx_database_status.recvd_initial_deposition_date   2020-07-31 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.status_code_nmr_data            REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB  .                                                                                                                     6ZXP  
unspecified 
PDB  .                                                                                                                     4OD8  
unspecified 
BMRB 'Solution structure of the C-terminal domain of the vaccinia virus DNA polymerase processivity factor component A20.' 34545 
unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bersch, B.'      1 0000-0003-1138-4911 
'Iseni, F.'       2 0000-0003-3909-9688 
'Burmeister, W.'  3 0000-0003-0876-6118 
'Tarbouriech, N.' 4 0000-0002-0206-3959 
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.unpublished_flag 
? ? ? ? ? ? ? UK ? ? primary J.Mol.Biol.             JMOBAK 0070 1089-8638 ? ? 433 ? 167009 167009 
;Solution Structure of the C-terminal Domain of A20, the Missing Brick for the Characterization of the Interface between Vaccinia Virus DNA Polymerase and its Processivity Factor.
;
2021 ? 10.1016/j.jmb.2021.167009  33901538 ? 
? ? ? ? ? ? ? UK ? ? 1       'Nature Communications' ?      ?    2041-1723 ? ? 8   ? 1455   ?      
'The vaccinia virus DNA polymerase structure provides insights into the mode of processivity factor binding.' 2017 ? 
10.1038/s41467-017-01542-z 29129932 ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bersch, B.'       1  ? 
primary 'Tarbouriech, N.'  2  ? 
primary 'Burmeister, W.P.' 3  ? 
primary 'Iseni, F.'        4  ? 
1       'Tarbouriech, N.'  5  ? 
1       'Ducournau, C.'    6  ? 
1       'Hutin, S.'        7  ? 
1       'Mas, P.J.'        8  ? 
1       'Man, P.'          9  ? 
1       'Forest, E.'       10 ? 
1       'Hart, D.J.'       11 ? 
1       'Peyrefitte, C.N.' 12 ? 
1       'Burmeister, W.'   13 ? 
1       'Iseni, F.'        14 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'DNA polymerase processivity factor component A20' 
_entity.formula_weight             16668.709 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    
;Residues 2-124 of the construct correspond to A20:304-426, residues 125-134 to a flexible linker and residues 136-148 to a Biotin Affinity Peptide (BAP),Residues 2-124 of the construct correspond to A20:304-426, residues 125-134 to a flexible linker and residues 136-148 to a Biotin Affinity Peptide (BAP)
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GNGKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENC
KVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFENASGNGSGGGLNDIFEAQKIEWHE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GNGKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENC
KVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFENASGNGSGGGLNDIFEAQKIEWHE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASN n 
1 3   GLY n 
1 4   LYS n 
1 5   TYR n 
1 6   PHE n 
1 7   SER n 
1 8   LYS n 
1 9   VAL n 
1 10  GLY n 
1 11  SER n 
1 12  ALA n 
1 13  GLY n 
1 14  LEU n 
1 15  LYS n 
1 16  GLN n 
1 17  LEU n 
1 18  THR n 
1 19  ASN n 
1 20  LYS n 
1 21  LEU n 
1 22  ASP n 
1 23  ILE n 
1 24  ASN n 
1 25  GLU n 
1 26  CYS n 
1 27  ALA n 
1 28  THR n 
1 29  VAL n 
1 30  ASP n 
1 31  GLU n 
1 32  LEU n 
1 33  VAL n 
1 34  ASP n 
1 35  GLU n 
1 36  ILE n 
1 37  ASN n 
1 38  LYS n 
1 39  SER n 
1 40  GLY n 
1 41  THR n 
1 42  VAL n 
1 43  LYS n 
1 44  ARG n 
1 45  LYS n 
1 46  ILE n 
1 47  LYS n 
1 48  ASN n 
1 49  GLN n 
1 50  SER n 
1 51  ALA n 
1 52  PHE n 
1 53  ASP n 
1 54  LEU n 
1 55  SER n 
1 56  ARG n 
1 57  GLU n 
1 58  CYS n 
1 59  LEU n 
1 60  GLY n 
1 61  TYR n 
1 62  PRO n 
1 63  GLU n 
1 64  ALA n 
1 65  ASP n 
1 66  PHE n 
1 67  ILE n 
1 68  THR n 
1 69  LEU n 
1 70  VAL n 
1 71  ASN n 
1 72  ASN n 
1 73  MET n 
1 74  ARG n 
1 75  PHE n 
1 76  LYS n 
1 77  ILE n 
1 78  GLU n 
1 79  ASN n 
1 80  CYS n 
1 81  LYS n 
1 82  VAL n 
1 83  VAL n 
1 84  ASN n 
1 85  PHE n 
1 86  ASN n 
1 87  ILE n 
1 88  GLU n 
1 89  ASN n 
1 90  THR n 
1 91  ASN n 
1 92  CYS n 
1 93  LEU n 
1 94  ASN n 
1 95  ASN n 
1 96  PRO n 
1 97  SER n 
1 98  ILE n 
1 99  GLU n 
1 100 THR n 
1 101 ILE n 
1 102 TYR n 
1 103 ARG n 
1 104 ASN n 
1 105 PHE n 
1 106 ASN n 
1 107 GLN n 
1 108 PHE n 
1 109 VAL n 
1 110 SER n 
1 111 ILE n 
1 112 PHE n 
1 113 ASN n 
1 114 VAL n 
1 115 VAL n 
1 116 THR n 
1 117 ASP n 
1 118 VAL n 
1 119 LYS n 
1 120 LYS n 
1 121 ARG n 
1 122 LEU n 
1 123 PHE n 
1 124 GLU n 
1 125 ASN n 
1 126 ALA n 
1 127 SER n 
1 128 GLY n 
1 129 ASN n 
1 130 GLY n 
1 131 SER n 
1 132 GLY n 
1 133 GLY n 
1 134 GLY n 
1 135 LEU n 
1 136 ASN n 
1 137 ASP n 
1 138 ILE n 
1 139 PHE n 
1 140 GLU n 
1 141 ALA n 
1 142 GLN n 
1 143 LYS n 
1 144 ILE n 
1 145 GLU n 
1 146 TRP n 
1 147 HIS n 
1 148 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   148 
_entity_src_gen.gene_src_common_name               VACV 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 A20R 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    Copenhagen 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Vaccinia virus (strain Copenhagen)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10249 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              -Star 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   1   GLY GLY A . n 
A 1 2   ASN 2   2   2   ASN ASN A . n 
A 1 3   GLY 3   3   3   GLY GLY A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   TYR 5   5   5   TYR TYR A . n 
A 1 6   PHE 6   6   6   PHE PHE A . n 
A 1 7   SER 7   7   7   SER SER A . n 
A 1 8   LYS 8   8   8   LYS LYS A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  LYS 15  15  15  LYS LYS A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ASN 19  19  19  ASN ASN A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  ASP 22  22  22  ASP ASP A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  CYS 26  26  26  CYS CYS A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  GLU 31  31  31  GLU GLU A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  ILE 36  36  36  ILE ILE A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  SER 39  39  39  SER SER A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  ILE 46  46  46  ILE ILE A . n 
A 1 47  LYS 47  47  47  LYS LYS A . n 
A 1 48  ASN 48  48  48  ASN ASN A . n 
A 1 49  GLN 49  49  49  GLN GLN A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  ALA 51  51  51  ALA ALA A . n 
A 1 52  PHE 52  52  52  PHE PHE A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  CYS 58  58  58  CYS CYS A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  GLY 60  60  60  GLY GLY A . n 
A 1 61  TYR 61  61  61  TYR TYR A . n 
A 1 62  PRO 62  62  62  PRO PRO A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  PHE 66  66  66  PHE PHE A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  MET 73  73  73  MET MET A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  ILE 77  77  77  ILE ILE A . n 
A 1 78  GLU 78  78  78  GLU GLU A . n 
A 1 79  ASN 79  79  79  ASN ASN A . n 
A 1 80  CYS 80  80  80  CYS CYS A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  VAL 83  83  83  VAL VAL A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  PHE 85  85  85  PHE PHE A . n 
A 1 86  ASN 86  86  86  ASN ASN A . n 
A 1 87  ILE 87  87  87  ILE ILE A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  ASN 91  91  91  ASN ASN A . n 
A 1 92  CYS 92  92  92  CYS CYS A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  ASN 94  94  94  ASN ASN A . n 
A 1 95  ASN 95  95  95  ASN ASN A . n 
A 1 96  PRO 96  96  96  PRO PRO A . n 
A 1 97  SER 97  97  97  SER SER A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  GLU 99  99  99  GLU GLU A . n 
A 1 100 THR 100 100 100 THR THR A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 TYR 102 102 102 TYR TYR A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 ASN 104 104 104 ASN ASN A . n 
A 1 105 PHE 105 105 105 PHE PHE A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 GLN 107 107 107 GLN GLN A . n 
A 1 108 PHE 108 108 108 PHE PHE A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 ILE 111 111 111 ILE ILE A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 ASP 117 117 117 ASP ASP A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 ARG 121 121 121 ARG ARG A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 GLU 124 124 124 GLU GLU A . n 
A 1 125 ASN 125 125 125 ASN ASN A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 SER 127 127 127 SER SER A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 ASN 129 129 129 ASN ASN A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 SER 131 131 131 SER SER A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ASN 136 136 136 ASN ASN A . n 
A 1 137 ASP 137 137 137 ASP ASP A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 PHE 139 139 139 PHE PHE A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 ALA 141 141 141 ALA ALA A . n 
A 1 142 GLN 142 142 142 GLN GLN A . n 
A 1 143 LYS 143 143 143 LYS LYS A . n 
A 1 144 ILE 144 144 144 ILE ILE A . n 
A 1 145 GLU 145 145 145 GLU GLU A . n 
A 1 146 TRP 146 146 146 TRP TRP A . n 
A 1 147 HIS 147 147 147 HIS HIS A . n 
A 1 148 GLU 148 148 148 GLU GLU A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6ZYC 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6ZYC 
_struct.title                        
'Solution structure of the C-terminal domain of the vaccinia virus DNA polymerase processivity factor component A20.' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6ZYC 
_struct_keywords.text            'Poxviridae, DNA polymerase holoenzyme, processivity factor binding, REPLICATION' 
_struct_keywords.pdbx_keywords   REPLICATION 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A20_VACCC 
_struct_ref.pdbx_db_accession          P20995 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;NGKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCK
VVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE
;
_struct_ref.pdbx_align_begin           304 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6ZYC 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 124 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P20995 
_struct_ref_seq.db_align_beg                  304 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  426 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       124 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6ZYC GLY A 1   ? UNP P20995 ? ? 'expression tag' 1   1  
1 6ZYC ASN A 125 ? UNP P20995 ? ? linker           125 2  
1 6ZYC ALA A 126 ? UNP P20995 ? ? linker           126 3  
1 6ZYC SER A 127 ? UNP P20995 ? ? linker           127 4  
1 6ZYC GLY A 128 ? UNP P20995 ? ? linker           128 5  
1 6ZYC ASN A 129 ? UNP P20995 ? ? linker           129 6  
1 6ZYC GLY A 130 ? UNP P20995 ? ? linker           130 7  
1 6ZYC SER A 131 ? UNP P20995 ? ? linker           131 8  
1 6ZYC GLY A 132 ? UNP P20995 ? ? linker           132 9  
1 6ZYC GLY A 133 ? UNP P20995 ? ? linker           133 10 
1 6ZYC GLY A 134 ? UNP P20995 ? ? linker           134 11 
1 6ZYC LEU A 135 ? UNP P20995 ? ? 'expression tag' 135 12 
1 6ZYC ASN A 136 ? UNP P20995 ? ? 'expression tag' 136 13 
1 6ZYC ASP A 137 ? UNP P20995 ? ? 'expression tag' 137 14 
1 6ZYC ILE A 138 ? UNP P20995 ? ? 'expression tag' 138 15 
1 6ZYC PHE A 139 ? UNP P20995 ? ? 'expression tag' 139 16 
1 6ZYC GLU A 140 ? UNP P20995 ? ? 'expression tag' 140 17 
1 6ZYC ALA A 141 ? UNP P20995 ? ? 'expression tag' 141 18 
1 6ZYC GLN A 142 ? UNP P20995 ? ? 'expression tag' 142 19 
1 6ZYC LYS A 143 ? UNP P20995 ? ? 'expression tag' 143 20 
1 6ZYC ILE A 144 ? UNP P20995 ? ? 'expression tag' 144 21 
1 6ZYC GLU A 145 ? UNP P20995 ? ? 'expression tag' 145 22 
1 6ZYC TRP A 146 ? UNP P20995 ? ? 'expression tag' 146 23 
1 6ZYC HIS A 147 ? UNP P20995 ? ? 'expression tag' 147 24 
1 6ZYC GLU A 148 ? UNP P20995 ? ? 'expression tag' 148 25 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 0    ? 
1 MORE         0    ? 
1 'SSA (A^2)'  8580 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   SAXS 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 SER A 11  ? ASP A 22  ? SER A 11  ASP A 22  1 ? 12 
HELX_P HELX_P2 AA2 THR A 28  ? SER A 39  ? THR A 28  SER A 39  1 ? 12 
HELX_P HELX_P3 AA3 SER A 39  ? GLN A 49  ? SER A 39  GLN A 49  1 ? 11 
HELX_P HELX_P4 AA4 SER A 50  ? LEU A 59  ? SER A 50  LEU A 59  1 ? 10 
HELX_P HELX_P5 AA5 PRO A 62  ? ASN A 72  ? PRO A 62  ASN A 72  1 ? 11 
HELX_P HELX_P6 AA6 ASN A 91  ? ASN A 94  ? ASN A 91  ASN A 94  5 ? 4  
HELX_P HELX_P7 AA7 ASN A 95  ? ASN A 104 ? ASN A 95  ASN A 104 1 ? 10 
HELX_P HELX_P8 AA8 ASN A 104 ? PHE A 123 ? ASN A 104 PHE A 123 1 ? 20 
HELX_P HELX_P9 AA9 GLY A 134 ? ILE A 138 ? GLY A 134 ILE A 138 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     AA1 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 MET A 73 ? GLU A 78 ? MET A 73 GLU A 78 
AA1 2 LYS A 81 ? ILE A 87 ? LYS A 81 ILE A 87 
# 
_pdbx_struct_sheet_hbond.sheet_id                AA1 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ARG 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    74 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ARG 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     74 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   ASN 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    86 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    ASN 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     86 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  3  H   A GLU 78  ? ? O   A LYS 81  ? ? 1.58 
2  4  OE2 A GLU 124 ? ? HG  A SER 127 ? ? 1.59 
3  7  H   A GLU 78  ? ? O   A LYS 81  ? ? 1.59 
4  8  H   A GLU 78  ? ? O   A LYS 81  ? ? 1.59 
5  9  H   A ARG 74  ? ? O   A ASN 86  ? ? 1.58 
6  10 H   A GLU 78  ? ? O   A LYS 81  ? ? 1.59 
7  13 H   A GLU 78  ? ? O   A LYS 81  ? ? 1.58 
8  14 HZ2 A LYS 45  ? ? OE1 A GLU 57  ? ? 1.60 
9  16 O   A GLY 10  ? ? HG  A SER 11  ? ? 1.59 
10 16 H   A GLU 78  ? ? O   A LYS 81  ? ? 1.59 
11 20 HG  A CYS 26  ? ? OE1 A GLU 35  ? ? 1.55 
12 20 H   A GLU 78  ? ? O   A LYS 81  ? ? 1.59 
13 20 HZ2 A LYS 81  ? ? OD2 A ASP 117 ? ? 1.59 
14 20 O   A SER 50  ? ? H   A LEU 54  ? ? 1.60 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  LYS A 4   ? ? -107.40 -66.30  
2   1  VAL A 9   ? ? -103.32 -86.72  
3   1  SER A 11  ? ? 71.72   -12.99  
4   1  GLU A 124 ? ? -79.29  -84.09  
5   1  SER A 131 ? ? 59.97   -172.51 
6   1  ASN A 136 ? ? -76.58  26.18   
7   1  PHE A 139 ? ? -96.17  32.28   
8   2  LYS A 4   ? ? -94.66  -67.36  
9   2  VAL A 9   ? ? -94.04  -94.92  
10  2  SER A 11  ? ? 75.55   -15.86  
11  2  PHE A 123 ? ? -104.89 -66.44  
12  2  GLU A 124 ? ? 61.94   160.37  
13  2  ASN A 125 ? ? 48.62   28.66   
14  2  LEU A 135 ? ? -73.22  -98.42  
15  2  ASN A 136 ? ? 44.77   23.57   
16  2  ALA A 141 ? ? 59.69   110.84  
17  2  TRP A 146 ? ? 65.31   135.49  
18  3  TYR A 5   ? ? -148.17 -56.56  
19  3  VAL A 9   ? ? -92.75  -90.65  
20  3  SER A 11  ? ? 71.71   -13.73  
21  3  GLU A 124 ? ? -98.82  -79.99  
22  3  ASN A 125 ? ? -115.96 64.30   
23  3  ASN A 136 ? ? -77.14  24.04   
24  4  LYS A 4   ? ? -100.00 -70.50  
25  4  VAL A 9   ? ? -94.98  -95.00  
26  4  SER A 11  ? ? 81.55   -10.05  
27  4  SER A 131 ? ? -88.50  45.68   
28  5  VAL A 9   ? ? -99.78  -91.61  
29  5  SER A 11  ? ? 71.53   -5.82   
30  5  PHE A 123 ? ? -98.21  -89.01  
31  5  GLU A 124 ? ? 51.73   -85.72  
32  5  SER A 131 ? ? 57.63   -170.97 
33  5  ASN A 136 ? ? -77.79  32.11   
34  5  PHE A 139 ? ? -88.36  40.24   
35  6  LYS A 4   ? ? -102.66 -70.03  
36  6  VAL A 9   ? ? -93.74  -82.44  
37  6  SER A 11  ? ? 69.86   -13.02  
38  6  GLU A 124 ? ? -79.61  -85.26  
39  6  LEU A 135 ? ? -89.41  -114.92 
40  6  ASN A 136 ? ? 37.51   30.81   
41  6  PHE A 139 ? ? -92.72  38.54   
42  6  GLU A 140 ? ? 58.01   97.24   
43  7  ASN A 2   ? ? -102.61 -167.83 
44  7  VAL A 9   ? ? -85.51  -88.26  
45  7  SER A 11  ? ? 69.48   -10.99  
46  7  ASN A 94  ? ? -65.17  0.76    
47  7  PHE A 123 ? ? -106.50 -75.30  
48  7  GLU A 124 ? ? 60.88   -76.89  
49  7  LEU A 135 ? ? -125.42 -125.99 
50  7  ASN A 136 ? ? 45.16   28.35   
51  7  PHE A 139 ? ? -97.53  39.23   
52  7  GLN A 142 ? ? -98.29  37.34   
53  8  LYS A 4   ? ? -120.53 -57.31  
54  8  PHE A 6   ? ? -105.91 -169.78 
55  8  VAL A 9   ? ? -100.29 -79.51  
56  8  SER A 11  ? ? 69.49   -8.36   
57  8  GLU A 124 ? ? -74.31  -75.07  
58  8  ASN A 136 ? ? -80.82  30.90   
59  8  PHE A 139 ? ? -86.95  40.60   
60  8  ALA A 141 ? ? 69.06   145.30  
61  8  LYS A 143 ? ? -101.00 67.44   
62  9  VAL A 9   ? ? -113.00 -87.34  
63  9  SER A 11  ? ? 70.07   -1.96   
64  9  GLU A 124 ? ? -56.56  -73.08  
65  9  SER A 127 ? ? -172.46 54.97   
66  9  LEU A 135 ? ? -101.57 -112.73 
67  9  PHE A 139 ? ? -82.41  39.64   
68  9  LYS A 143 ? ? 71.96   126.85  
69  10 PHE A 6   ? ? -141.19 -63.33  
70  10 SER A 7   ? ? 73.29   147.87  
71  10 VAL A 9   ? ? -99.27  -76.80  
72  10 SER A 11  ? ? 74.60   -14.72  
73  10 PHE A 123 ? ? -102.13 -79.49  
74  10 GLU A 124 ? ? 48.94   -91.73  
75  10 LEU A 135 ? ? -103.19 -136.23 
76  10 ASN A 136 ? ? 37.48   35.56   
77  10 GLN A 142 ? ? -111.94 66.06   
78  10 LYS A 143 ? ? 65.58   106.95  
79  11 LYS A 4   ? ? -107.55 -67.98  
80  11 PHE A 6   ? ? -128.11 -165.58 
81  11 VAL A 9   ? ? -117.60 -81.89  
82  11 SER A 11  ? ? 70.44   -6.72   
83  11 ASN A 94  ? ? -67.11  2.37    
84  11 PHE A 123 ? ? -99.27  -116.22 
85  11 GLU A 124 ? ? 47.39   -90.99  
86  11 SER A 127 ? ? -157.74 26.85   
87  11 ASN A 136 ? ? -78.85  25.91   
88  11 PHE A 139 ? ? -91.08  38.99   
89  11 TRP A 146 ? ? 66.49   115.66  
90  12 VAL A 9   ? ? -103.97 -83.09  
91  12 SER A 11  ? ? 69.26   -10.03  
92  12 ASN A 94  ? ? -65.78  0.31    
93  12 PHE A 123 ? ? -95.91  -101.42 
94  12 GLU A 124 ? ? 50.42   -91.56  
95  12 ASN A 125 ? ? -85.07  40.24   
96  12 ASN A 129 ? ? 72.39   -34.16  
97  12 GLU A 140 ? ? 40.33   86.21   
98  12 ALA A 141 ? ? 64.74   166.41  
99  12 LYS A 143 ? ? 65.66   120.90  
100 13 LYS A 4   ? ? -95.95  -64.47  
101 13 VAL A 9   ? ? -97.69  -89.38  
102 13 SER A 11  ? ? 72.40   -13.11  
103 13 PHE A 123 ? ? -104.21 -74.55  
104 13 GLU A 124 ? ? 53.04   -92.56  
105 13 ALA A 126 ? ? 51.45   -135.85 
106 13 SER A 127 ? ? -81.84  46.46   
107 13 LYS A 143 ? ? 59.24   73.18   
108 13 TRP A 146 ? ? -129.27 -60.62  
109 14 LYS A 4   ? ? -111.79 -72.05  
110 14 VAL A 9   ? ? -110.59 -83.51  
111 14 SER A 11  ? ? 73.77   -6.41   
112 14 ASN A 94  ? ? -65.45  1.27    
113 14 PHE A 123 ? ? -94.36  -87.14  
114 14 GLU A 124 ? ? 31.86   -114.91 
115 14 LEU A 135 ? ? -66.05  -77.00  
116 14 PHE A 139 ? ? -88.76  40.98   
117 15 LYS A 4   ? ? -91.08  -68.58  
118 15 VAL A 9   ? ? -117.50 -102.59 
119 15 SER A 11  ? ? 72.89   -2.13   
120 15 PHE A 123 ? ? -103.42 -77.68  
121 15 GLU A 124 ? ? 58.97   157.36  
122 15 SER A 127 ? ? -167.63 36.56   
123 15 LEU A 135 ? ? -74.02  -94.19  
124 15 LYS A 143 ? ? 64.55   91.42   
125 16 ASN A 2   ? ? -73.73  -70.19  
126 16 LYS A 4   ? ? -94.34  -72.69  
127 16 PHE A 6   ? ? -106.29 -168.85 
128 16 VAL A 9   ? ? -108.06 -76.31  
129 16 SER A 11  ? ? 57.44   -3.11   
130 16 PHE A 123 ? ? -101.22 -111.79 
131 16 GLU A 124 ? ? 55.04   169.62  
132 16 SER A 127 ? ? -151.06 32.53   
133 16 PHE A 139 ? ? -88.55  40.85   
134 17 VAL A 9   ? ? -88.11  -90.31  
135 17 SER A 11  ? ? 71.33   -11.89  
136 17 GLU A 124 ? ? -83.40  -104.90 
137 17 PHE A 139 ? ? -91.85  39.46   
138 18 LYS A 4   ? ? -105.09 -64.67  
139 18 VAL A 9   ? ? -95.10  -88.16  
140 18 SER A 11  ? ? 72.25   -12.51  
141 18 PHE A 123 ? ? -109.05 -68.27  
142 18 GLU A 124 ? ? 62.20   152.56  
143 18 SER A 127 ? ? -153.16 32.88   
144 18 SER A 131 ? ? 63.86   78.29   
145 18 LEU A 135 ? ? -117.65 -135.71 
146 18 HIS A 147 ? ? 72.02   151.44  
147 19 LYS A 4   ? ? -102.47 -64.65  
148 19 PHE A 6   ? ? -105.32 -166.30 
149 19 VAL A 9   ? ? -100.83 -79.02  
150 19 SER A 11  ? ? 68.78   -6.28   
151 19 PHE A 123 ? ? -99.72  -89.10  
152 19 GLU A 124 ? ? 48.89   -85.45  
153 19 SER A 131 ? ? 62.72   82.75   
154 19 TRP A 146 ? ? 68.51   121.80  
155 20 ASN A 2   ? ? 74.76   -40.24  
156 20 LYS A 4   ? ? -98.91  -72.70  
157 20 VAL A 9   ? ? -107.10 -80.57  
158 20 SER A 11  ? ? 73.83   -13.23  
159 20 SER A 127 ? ? -148.80 33.07   
160 20 LEU A 135 ? ? -78.38  -96.30  
161 20 ASN A 136 ? ? 46.20   23.45   
162 20 ALA A 141 ? ? 66.19   172.05  
163 20 GLU A 145 ? ? -58.10  102.84  
# 
_pdbx_nmr_ensemble.entry_id                                      6ZYC 
_pdbx_nmr_ensemble.conformers_calculated_total_number            1000 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             6ZYC 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
_pdbx_nmr_sample_details.label 
_pdbx_nmr_sample_details.type 
_pdbx_nmr_sample_details.details 
1 '1 mM [U-15N] A20-BAP, 50 mM sodium citrate, 300 mM sodium chloride, 2 mg/L TCEP, 90% H2O/10% D2O'      '90% H2O/10% D2O' 
15N-A20-BAP            solution ? 
4 '1 mM [U-15N] A20-BAP, 50 mM sodium citrate, 300 mM sodium chloride, 2 mg/L TCEP, 90% H2O/10% D2O'      '90% H2O/10% D2O' 
15N13C-A20-BAP-initial solution ? 
2 '1 mM [U-15N] A20-BAP, 50 mM potassium phosphate, 300 mM sodium chloride, 1.2 mM TCEP, 100% D2O'        '100% D2O'        
15N-A20-BAP-D2O        solution ? 
3 '1 mM [U-15N] A20-BAP, 50 mM potassium phosphate, 300 mM sodium chloride, 1.2 mM TCEP, 90% H2O/10% D2O' '90% H2O/10% D2O' 
13C15N-A20-BAP         solution ? 
# 
loop_
_pdbx_nmr_exptl_sample.solution_id 
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
1 A20-BAP               1   ? mM   '[U-15N]'           
1 'sodium citrate'      50  ? mM   'natural abundance' 
1 'sodium chloride'     300 ? mM   'natural abundance' 
1 TCEP                  2   ? mg/L 'natural abundance' 
4 A20-BAP               1   ? mM   '[U-15N]'           
4 'sodium citrate'      50  ? mM   'natural abundance' 
4 'sodium chloride'     300 ? mM   'natural abundance' 
4 TCEP                  2   ? mg/L 'natural abundance' 
2 A20-BAP               1   ? mM   '[U-15N]'           
2 'potassium phosphate' 50  ? mM   'natural abundance' 
2 'sodium chloride'     300 ? mM   'natural abundance' 
2 TCEP                  1.2 ? mM   'natural abundance' 
3 A20-BAP               1   ? mM   '[U-15N]'           
3 'potassium phosphate' 50  ? mM   'natural abundance' 
3 'sodium chloride'     300 ? mM   'natural abundance' 
3 TCEP                  1.2 ? mM   'natural abundance' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            298 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     6 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         0.3 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   M 
_pdbx_nmr_exptl_sample_conditions.label                  general 
_pdbx_nmr_exptl_sample_conditions.pH_err                 0.1 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1 1 1 '2D 15N-TROSY'       1 isotropic 
2 1 3 '2D 13C-HSQC'        1 isotropic 
3 1 4 '3D HNCO'            3 isotropic 
4 1 4 '3D HNCACB'          1 isotropic 
5 1 3 '3D HCCH-TOCSY'      2 isotropic 
8 1 1 15N-NOESY            1 isotropic 
7 1 3 13C-NOESY            1 isotropic 
6 1 2 2D-NOESY             1 isotropic 
9 1 3 13C-13C-methyl-NOESY 1 isotropic 
# 
_pdbx_nmr_refine.entry_id           6ZYC 
_pdbx_nmr_refine.method             'molecular dynamics' 
_pdbx_nmr_refine.details            'water refinement' 
_pdbx_nmr_refine.software_ordinal   5 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 collection                  TopSpin           ? 'Bruker Biospin'               
2 processing                  TopSpin           ? 'Bruker Biospin'               
3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN                           
4 'peak picking'              UNIO              ? 'Torsten Herrmann'             
5 'structure calculation'     ARIA              ? 
;Linge, O'Donoghue and Nilges
;
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
ILE N    N N N 158 
ILE CA   C N S 159 
ILE C    C N N 160 
ILE O    O N N 161 
ILE CB   C N S 162 
ILE CG1  C N N 163 
ILE CG2  C N N 164 
ILE CD1  C N N 165 
ILE OXT  O N N 166 
ILE H    H N N 167 
ILE H2   H N N 168 
ILE HA   H N N 169 
ILE HB   H N N 170 
ILE HG12 H N N 171 
ILE HG13 H N N 172 
ILE HG21 H N N 173 
ILE HG22 H N N 174 
ILE HG23 H N N 175 
ILE HD11 H N N 176 
ILE HD12 H N N 177 
ILE HD13 H N N 178 
ILE HXT  H N N 179 
LEU N    N N N 180 
LEU CA   C N S 181 
LEU C    C N N 182 
LEU O    O N N 183 
LEU CB   C N N 184 
LEU CG   C N N 185 
LEU CD1  C N N 186 
LEU CD2  C N N 187 
LEU OXT  O N N 188 
LEU H    H N N 189 
LEU H2   H N N 190 
LEU HA   H N N 191 
LEU HB2  H N N 192 
LEU HB3  H N N 193 
LEU HG   H N N 194 
LEU HD11 H N N 195 
LEU HD12 H N N 196 
LEU HD13 H N N 197 
LEU HD21 H N N 198 
LEU HD22 H N N 199 
LEU HD23 H N N 200 
LEU HXT  H N N 201 
LYS N    N N N 202 
LYS CA   C N S 203 
LYS C    C N N 204 
LYS O    O N N 205 
LYS CB   C N N 206 
LYS CG   C N N 207 
LYS CD   C N N 208 
LYS CE   C N N 209 
LYS NZ   N N N 210 
LYS OXT  O N N 211 
LYS H    H N N 212 
LYS H2   H N N 213 
LYS HA   H N N 214 
LYS HB2  H N N 215 
LYS HB3  H N N 216 
LYS HG2  H N N 217 
LYS HG3  H N N 218 
LYS HD2  H N N 219 
LYS HD3  H N N 220 
LYS HE2  H N N 221 
LYS HE3  H N N 222 
LYS HZ1  H N N 223 
LYS HZ2  H N N 224 
LYS HZ3  H N N 225 
LYS HXT  H N N 226 
MET N    N N N 227 
MET CA   C N S 228 
MET C    C N N 229 
MET O    O N N 230 
MET CB   C N N 231 
MET CG   C N N 232 
MET SD   S N N 233 
MET CE   C N N 234 
MET OXT  O N N 235 
MET H    H N N 236 
MET H2   H N N 237 
MET HA   H N N 238 
MET HB2  H N N 239 
MET HB3  H N N 240 
MET HG2  H N N 241 
MET HG3  H N N 242 
MET HE1  H N N 243 
MET HE2  H N N 244 
MET HE3  H N N 245 
MET HXT  H N N 246 
PHE N    N N N 247 
PHE CA   C N S 248 
PHE C    C N N 249 
PHE O    O N N 250 
PHE CB   C N N 251 
PHE CG   C Y N 252 
PHE CD1  C Y N 253 
PHE CD2  C Y N 254 
PHE CE1  C Y N 255 
PHE CE2  C Y N 256 
PHE CZ   C Y N 257 
PHE OXT  O N N 258 
PHE H    H N N 259 
PHE H2   H N N 260 
PHE HA   H N N 261 
PHE HB2  H N N 262 
PHE HB3  H N N 263 
PHE HD1  H N N 264 
PHE HD2  H N N 265 
PHE HE1  H N N 266 
PHE HE2  H N N 267 
PHE HZ   H N N 268 
PHE HXT  H N N 269 
PRO N    N N N 270 
PRO CA   C N S 271 
PRO C    C N N 272 
PRO O    O N N 273 
PRO CB   C N N 274 
PRO CG   C N N 275 
PRO CD   C N N 276 
PRO OXT  O N N 277 
PRO H    H N N 278 
PRO HA   H N N 279 
PRO HB2  H N N 280 
PRO HB3  H N N 281 
PRO HG2  H N N 282 
PRO HG3  H N N 283 
PRO HD2  H N N 284 
PRO HD3  H N N 285 
PRO HXT  H N N 286 
SER N    N N N 287 
SER CA   C N S 288 
SER C    C N N 289 
SER O    O N N 290 
SER CB   C N N 291 
SER OG   O N N 292 
SER OXT  O N N 293 
SER H    H N N 294 
SER H2   H N N 295 
SER HA   H N N 296 
SER HB2  H N N 297 
SER HB3  H N N 298 
SER HG   H N N 299 
SER HXT  H N N 300 
THR N    N N N 301 
THR CA   C N S 302 
THR C    C N N 303 
THR O    O N N 304 
THR CB   C N R 305 
THR OG1  O N N 306 
THR CG2  C N N 307 
THR OXT  O N N 308 
THR H    H N N 309 
THR H2   H N N 310 
THR HA   H N N 311 
THR HB   H N N 312 
THR HG1  H N N 313 
THR HG21 H N N 314 
THR HG22 H N N 315 
THR HG23 H N N 316 
THR HXT  H N N 317 
TRP N    N N N 318 
TRP CA   C N S 319 
TRP C    C N N 320 
TRP O    O N N 321 
TRP CB   C N N 322 
TRP CG   C Y N 323 
TRP CD1  C Y N 324 
TRP CD2  C Y N 325 
TRP NE1  N Y N 326 
TRP CE2  C Y N 327 
TRP CE3  C Y N 328 
TRP CZ2  C Y N 329 
TRP CZ3  C Y N 330 
TRP CH2  C Y N 331 
TRP OXT  O N N 332 
TRP H    H N N 333 
TRP H2   H N N 334 
TRP HA   H N N 335 
TRP HB2  H N N 336 
TRP HB3  H N N 337 
TRP HD1  H N N 338 
TRP HE1  H N N 339 
TRP HE3  H N N 340 
TRP HZ2  H N N 341 
TRP HZ3  H N N 342 
TRP HH2  H N N 343 
TRP HXT  H N N 344 
TYR N    N N N 345 
TYR CA   C N S 346 
TYR C    C N N 347 
TYR O    O N N 348 
TYR CB   C N N 349 
TYR CG   C Y N 350 
TYR CD1  C Y N 351 
TYR CD2  C Y N 352 
TYR CE1  C Y N 353 
TYR CE2  C Y N 354 
TYR CZ   C Y N 355 
TYR OH   O N N 356 
TYR OXT  O N N 357 
TYR H    H N N 358 
TYR H2   H N N 359 
TYR HA   H N N 360 
TYR HB2  H N N 361 
TYR HB3  H N N 362 
TYR HD1  H N N 363 
TYR HD2  H N N 364 
TYR HE1  H N N 365 
TYR HE2  H N N 366 
TYR HH   H N N 367 
TYR HXT  H N N 368 
VAL N    N N N 369 
VAL CA   C N S 370 
VAL C    C N N 371 
VAL O    O N N 372 
VAL CB   C N N 373 
VAL CG1  C N N 374 
VAL CG2  C N N 375 
VAL OXT  O N N 376 
VAL H    H N N 377 
VAL H2   H N N 378 
VAL HA   H N N 379 
VAL HB   H N N 380 
VAL HG11 H N N 381 
VAL HG12 H N N 382 
VAL HG13 H N N 383 
VAL HG21 H N N 384 
VAL HG22 H N N 385 
VAL HG23 H N N 386 
VAL HXT  H N N 387 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
MET N   CA   sing N N 216 
MET N   H    sing N N 217 
MET N   H2   sing N N 218 
MET CA  C    sing N N 219 
MET CA  CB   sing N N 220 
MET CA  HA   sing N N 221 
MET C   O    doub N N 222 
MET C   OXT  sing N N 223 
MET CB  CG   sing N N 224 
MET CB  HB2  sing N N 225 
MET CB  HB3  sing N N 226 
MET CG  SD   sing N N 227 
MET CG  HG2  sing N N 228 
MET CG  HG3  sing N N 229 
MET SD  CE   sing N N 230 
MET CE  HE1  sing N N 231 
MET CE  HE2  sing N N 232 
MET CE  HE3  sing N N 233 
MET OXT HXT  sing N N 234 
PHE N   CA   sing N N 235 
PHE N   H    sing N N 236 
PHE N   H2   sing N N 237 
PHE CA  C    sing N N 238 
PHE CA  CB   sing N N 239 
PHE CA  HA   sing N N 240 
PHE C   O    doub N N 241 
PHE C   OXT  sing N N 242 
PHE CB  CG   sing N N 243 
PHE CB  HB2  sing N N 244 
PHE CB  HB3  sing N N 245 
PHE CG  CD1  doub Y N 246 
PHE CG  CD2  sing Y N 247 
PHE CD1 CE1  sing Y N 248 
PHE CD1 HD1  sing N N 249 
PHE CD2 CE2  doub Y N 250 
PHE CD2 HD2  sing N N 251 
PHE CE1 CZ   doub Y N 252 
PHE CE1 HE1  sing N N 253 
PHE CE2 CZ   sing Y N 254 
PHE CE2 HE2  sing N N 255 
PHE CZ  HZ   sing N N 256 
PHE OXT HXT  sing N N 257 
PRO N   CA   sing N N 258 
PRO N   CD   sing N N 259 
PRO N   H    sing N N 260 
PRO CA  C    sing N N 261 
PRO CA  CB   sing N N 262 
PRO CA  HA   sing N N 263 
PRO C   O    doub N N 264 
PRO C   OXT  sing N N 265 
PRO CB  CG   sing N N 266 
PRO CB  HB2  sing N N 267 
PRO CB  HB3  sing N N 268 
PRO CG  CD   sing N N 269 
PRO CG  HG2  sing N N 270 
PRO CG  HG3  sing N N 271 
PRO CD  HD2  sing N N 272 
PRO CD  HD3  sing N N 273 
PRO OXT HXT  sing N N 274 
SER N   CA   sing N N 275 
SER N   H    sing N N 276 
SER N   H2   sing N N 277 
SER CA  C    sing N N 278 
SER CA  CB   sing N N 279 
SER CA  HA   sing N N 280 
SER C   O    doub N N 281 
SER C   OXT  sing N N 282 
SER CB  OG   sing N N 283 
SER CB  HB2  sing N N 284 
SER CB  HB3  sing N N 285 
SER OG  HG   sing N N 286 
SER OXT HXT  sing N N 287 
THR N   CA   sing N N 288 
THR N   H    sing N N 289 
THR N   H2   sing N N 290 
THR CA  C    sing N N 291 
THR CA  CB   sing N N 292 
THR CA  HA   sing N N 293 
THR C   O    doub N N 294 
THR C   OXT  sing N N 295 
THR CB  OG1  sing N N 296 
THR CB  CG2  sing N N 297 
THR CB  HB   sing N N 298 
THR OG1 HG1  sing N N 299 
THR CG2 HG21 sing N N 300 
THR CG2 HG22 sing N N 301 
THR CG2 HG23 sing N N 302 
THR OXT HXT  sing N N 303 
TRP N   CA   sing N N 304 
TRP N   H    sing N N 305 
TRP N   H2   sing N N 306 
TRP CA  C    sing N N 307 
TRP CA  CB   sing N N 308 
TRP CA  HA   sing N N 309 
TRP C   O    doub N N 310 
TRP C   OXT  sing N N 311 
TRP CB  CG   sing N N 312 
TRP CB  HB2  sing N N 313 
TRP CB  HB3  sing N N 314 
TRP CG  CD1  doub Y N 315 
TRP CG  CD2  sing Y N 316 
TRP CD1 NE1  sing Y N 317 
TRP CD1 HD1  sing N N 318 
TRP CD2 CE2  doub Y N 319 
TRP CD2 CE3  sing Y N 320 
TRP NE1 CE2  sing Y N 321 
TRP NE1 HE1  sing N N 322 
TRP CE2 CZ2  sing Y N 323 
TRP CE3 CZ3  doub Y N 324 
TRP CE3 HE3  sing N N 325 
TRP CZ2 CH2  doub Y N 326 
TRP CZ2 HZ2  sing N N 327 
TRP CZ3 CH2  sing Y N 328 
TRP CZ3 HZ3  sing N N 329 
TRP CH2 HH2  sing N N 330 
TRP OXT HXT  sing N N 331 
TYR N   CA   sing N N 332 
TYR N   H    sing N N 333 
TYR N   H2   sing N N 334 
TYR CA  C    sing N N 335 
TYR CA  CB   sing N N 336 
TYR CA  HA   sing N N 337 
TYR C   O    doub N N 338 
TYR C   OXT  sing N N 339 
TYR CB  CG   sing N N 340 
TYR CB  HB2  sing N N 341 
TYR CB  HB3  sing N N 342 
TYR CG  CD1  doub Y N 343 
TYR CG  CD2  sing Y N 344 
TYR CD1 CE1  sing Y N 345 
TYR CD1 HD1  sing N N 346 
TYR CD2 CE2  doub Y N 347 
TYR CD2 HD2  sing N N 348 
TYR CE1 CZ   doub Y N 349 
TYR CE1 HE1  sing N N 350 
TYR CE2 CZ   sing Y N 351 
TYR CE2 HE2  sing N N 352 
TYR CZ  OH   sing N N 353 
TYR OH  HH   sing N N 354 
TYR OXT HXT  sing N N 355 
VAL N   CA   sing N N 356 
VAL N   H    sing N N 357 
VAL N   H2   sing N N 358 
VAL CA  C    sing N N 359 
VAL CA  CB   sing N N 360 
VAL CA  HA   sing N N 361 
VAL C   O    doub N N 362 
VAL C   OXT  sing N N 363 
VAL CB  CG1  sing N N 364 
VAL CB  CG2  sing N N 365 
VAL CB  HB   sing N N 366 
VAL CG1 HG11 sing N N 367 
VAL CG1 HG12 sing N N 368 
VAL CG1 HG13 sing N N 369 
VAL CG2 HG21 sing N N 370 
VAL CG2 HG22 sing N N 371 
VAL CG2 HG23 sing N N 372 
VAL OXT HXT  sing N N 373 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.details 
1 AVANCE ? Bruker 950 ? 
2 AVANCE ? Bruker 850 ? 
3 AVANCE ? Bruker 600 ? 
# 
_atom_sites.entry_id                    6ZYC 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_