data_7A1Y # _entry.id 7A1Y # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.353 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7A1Y pdb_00007a1y 10.2210/pdb7a1y/pdb WWPDB D_1292110741 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7A1Y _pdbx_database_status.recvd_initial_deposition_date 2020-08-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mathieu, M.' 1 0000-0003-4960-0632 'Steier, V.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Small Gtpases' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2154-1256 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 225 _citation.page_last 238 _citation.title 'KRAS G12C fragment screening renders new binding pockets.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1080/21541248.2021.1979360 _citation.pdbx_database_id_PubMed 34558391 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mathieu, M.' 1 ? primary 'Steier, V.' 2 ? primary 'Fassy, F.' 3 ? primary 'Delorme, C.' 4 ? primary 'Papin, D.' 5 ? primary 'Genet, B.' 6 ? primary 'Duffieux, F.' 7 ? primary 'Bertrand, T.' 8 ? primary 'Delarbre, L.' 9 ? primary 'Le-Borgne, H.' 10 ? primary 'Parent, A.' 11 ? primary 'Didier, P.' 12 ? primary 'Marquette, J.P.' 13 ? primary 'Lowinski, M.' 14 ? primary 'Houtmann, J.' 15 ? primary 'Lamberton, A.' 16 ? primary 'Debussche, L.' 17 ? primary 'Alexey, R.' 18 ? # _cell.angle_alpha 90 _cell.angle_alpha_esd ? _cell.angle_beta 90 _cell.angle_beta_esd ? _cell.angle_gamma 120 _cell.angle_gamma_esd ? _cell.entry_id 7A1Y _cell.details ? _cell.formula_units_Z ? _cell.length_a 91.754 _cell.length_a_esd ? _cell.length_b 91.754 _cell.length_b_esd ? _cell.length_c 120.763 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7A1Y _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GTPase KRas' 19374.902 1 3.6.5.2 G12C ? ? 2 non-polymer syn '~{N}-(3-bromanyl-2,6-dimethyl-pyridin-4-yl)propanamide' 257.127 1 ? ? ? ? 3 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE" 443.201 1 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 5 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 6 water nat water 18.015 96 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'K-Ras 2,Ki-Ras,c-K-ras,c-Ki-ras' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFL CVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTL VREIRKHKEK ; _entity_poly.pdbx_seq_one_letter_code_can ;GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFL CVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTL VREIRKHKEK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 THR n 1 4 GLU n 1 5 TYR n 1 6 LYS n 1 7 LEU n 1 8 VAL n 1 9 VAL n 1 10 VAL n 1 11 GLY n 1 12 ALA n 1 13 CYS n 1 14 GLY n 1 15 VAL n 1 16 GLY n 1 17 LYS n 1 18 SER n 1 19 ALA n 1 20 LEU n 1 21 THR n 1 22 ILE n 1 23 GLN n 1 24 LEU n 1 25 ILE n 1 26 GLN n 1 27 ASN n 1 28 HIS n 1 29 PHE n 1 30 VAL n 1 31 ASP n 1 32 GLU n 1 33 TYR n 1 34 ASP n 1 35 PRO n 1 36 THR n 1 37 ILE n 1 38 GLU n 1 39 ASP n 1 40 SER n 1 41 TYR n 1 42 ARG n 1 43 LYS n 1 44 GLN n 1 45 VAL n 1 46 VAL n 1 47 ILE n 1 48 ASP n 1 49 GLY n 1 50 GLU n 1 51 THR n 1 52 CYS n 1 53 LEU n 1 54 LEU n 1 55 ASP n 1 56 ILE n 1 57 LEU n 1 58 ASP n 1 59 THR n 1 60 ALA n 1 61 GLY n 1 62 GLN n 1 63 GLU n 1 64 GLU n 1 65 TYR n 1 66 SER n 1 67 ALA n 1 68 MET n 1 69 ARG n 1 70 ASP n 1 71 GLN n 1 72 TYR n 1 73 MET n 1 74 ARG n 1 75 THR n 1 76 GLY n 1 77 GLU n 1 78 GLY n 1 79 PHE n 1 80 LEU n 1 81 CYS n 1 82 VAL n 1 83 PHE n 1 84 ALA n 1 85 ILE n 1 86 ASN n 1 87 ASN n 1 88 THR n 1 89 LYS n 1 90 SER n 1 91 PHE n 1 92 GLU n 1 93 ASP n 1 94 ILE n 1 95 HIS n 1 96 HIS n 1 97 TYR n 1 98 ARG n 1 99 GLU n 1 100 GLN n 1 101 ILE n 1 102 LYS n 1 103 ARG n 1 104 VAL n 1 105 LYS n 1 106 ASP n 1 107 SER n 1 108 GLU n 1 109 ASP n 1 110 VAL n 1 111 PRO n 1 112 MET n 1 113 VAL n 1 114 LEU n 1 115 VAL n 1 116 GLY n 1 117 ASN n 1 118 LYS n 1 119 CYS n 1 120 ASP n 1 121 LEU n 1 122 PRO n 1 123 SER n 1 124 ARG n 1 125 THR n 1 126 VAL n 1 127 ASP n 1 128 THR n 1 129 LYS n 1 130 GLN n 1 131 ALA n 1 132 GLN n 1 133 ASP n 1 134 LEU n 1 135 ALA n 1 136 ARG n 1 137 SER n 1 138 TYR n 1 139 GLY n 1 140 ILE n 1 141 PRO n 1 142 PHE n 1 143 ILE n 1 144 GLU n 1 145 THR n 1 146 SER n 1 147 ALA n 1 148 LYS n 1 149 THR n 1 150 ARG n 1 151 GLN n 1 152 GLY n 1 153 VAL n 1 154 ASP n 1 155 ASP n 1 156 ALA n 1 157 PHE n 1 158 TYR n 1 159 THR n 1 160 LEU n 1 161 VAL n 1 162 ARG n 1 163 GLU n 1 164 ILE n 1 165 ARG n 1 166 LYS n 1 167 HIS n 1 168 LYS n 1 169 GLU n 1 170 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 170 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'KRAS, KRAS2, RASK2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ NA _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue NA _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant NA _entity_src_gen.pdbx_host_org_cell_line NA _entity_src_gen.pdbx_host_org_atcc NA _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell NA _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type 'Episomal low copy number' _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details 'T7 promoter' _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RASK_HUMAN _struct_ref.pdbx_db_accession P01116 _struct_ref.pdbx_db_isoform P01116-2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLC VFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLV REIR ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7A1Y _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 165 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01116 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 164 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 164 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7A1Y GLY A 1 ? UNP P01116 ? ? 'expression tag' 0 1 1 7A1Y CYS A 13 ? UNP P01116 GLY 12 'engineered mutation' 12 2 1 7A1Y GLY A 152 ? UNP P01116 ARG 151 conflict 151 3 1 7A1Y ASP A 154 ? UNP P01116 GLU 153 conflict 153 4 1 7A1Y LYS A 166 ? UNP P01116 ? ? 'expression tag' 165 5 1 7A1Y HIS A 167 ? UNP P01116 ? ? 'expression tag' 166 6 1 7A1Y LYS A 168 ? UNP P01116 ? ? 'expression tag' 167 7 1 7A1Y GLU A 169 ? UNP P01116 ? ? 'expression tag' 168 8 1 7A1Y LYS A 170 ? UNP P01116 ? ? 'expression tag' 169 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GDP 'RNA linking' n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 QWH non-polymer . '~{N}-(3-bromanyl-2,6-dimethyl-pyridin-4-yl)propanamide' RA399 'C10 H13 Br N2 O' 257.127 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7A1Y _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.52 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.28 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'HEPES 100mM - (NH4)2SO4 2.25M - pH7.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-05-14 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976251 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.976251 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7A1Y _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.00 _reflns.d_resolution_low 48.08 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12999 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.8 _reflns.pdbx_Rmerge_I_obs 0.082 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.11 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1899 _reflns_shell.percent_possible_all 99.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.368 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 3.9865 _refine.aniso_B[1][2] 0 _refine.aniso_B[1][3] 0 _refine.aniso_B[2][2] 3.9865 _refine.aniso_B[2][3] 0 _refine.aniso_B[3][3] -7.973 _refine.B_iso_max ? _refine.B_iso_mean 25.63 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.932 _refine.correlation_coeff_Fo_to_Fc_free 0.922 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7A1Y _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.004 _refine.ls_d_res_low 48.08 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12990 _refine.ls_number_reflns_R_free 636 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.1 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1898 _refine.ls_R_factor_R_free 0.21 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1888 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'internal model' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.143 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.146 _refine.pdbx_overall_SU_R_Blow_DPI 0.184 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.176 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 7A1Y _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.26 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.004 _refine_hist.d_res_low 48.08 _refine_hist.number_atoms_solvent 96 _refine_hist.number_atoms_total 1485 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1341 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 48 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1428 ? t_bond_d 2 HARMONIC 'X-RAY DIFFRACTION' ? 0.9 ? 1939 ? t_angle_deg 2 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 518 ? t_dihedral_angle_d 2 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 256 ? t_gen_planes 5 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1416 ? t_it 10 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 185 ? t_chiral_improper_torsion 5 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? 1301 ? t_ideal_dist_contact 4 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 3.43 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 16.56 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.004 _refine_ls_shell.d_res_low 2.02 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 25 _refine_ls_shell.number_reflns_R_work 420 _refine_ls_shell.percent_reflns_obs 97.64 _refine_ls_shell.percent_reflns_R_free 5.95 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3647 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2458 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7A1Y _struct.title 'KRASG12C GDP form in complex with Cpd2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7A1Y _struct_keywords.text 'inhibitor, mutant, ONCOPROTEIN' _struct_keywords.pdbx_keywords ONCOPROTEIN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 16 ? ASN A 27 ? GLY A 15 ASN A 26 1 ? 12 HELX_P HELX_P2 AA2 ASN A 87 ? ASP A 93 ? ASN A 86 ASP A 92 1 ? 7 HELX_P HELX_P3 AA3 ASP A 93 ? ASP A 106 ? ASP A 92 ASP A 105 1 ? 14 HELX_P HELX_P4 AA4 ASP A 127 ? GLY A 139 ? ASP A 126 GLY A 138 1 ? 13 HELX_P HELX_P5 AA5 GLY A 152 ? LYS A 168 ? GLY A 151 LYS A 167 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 13 SG ? ? ? 1_555 B QWH . C12 ? ? A CYS 12 A QWH 201 1_555 ? ? ? ? ? ? ? 1.747 ? ? metalc1 metalc ? ? A SER 18 OG ? ? ? 1_555 D MG . MG ? ? A SER 17 A MG 203 1_555 ? ? ? ? ? ? ? 2.122 ? ? metalc2 metalc ? ? C GDP . O3B ? ? ? 1_555 D MG . MG ? ? A GDP 202 A MG 203 1_555 ? ? ? ? ? ? ? 2.055 ? ? metalc3 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 203 A HOH 310 1_555 ? ? ? ? ? ? ? 2.440 ? ? metalc4 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 203 A HOH 323 1_555 ? ? ? ? ? ? ? 1.931 ? ? metalc5 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 203 A HOH 336 1_555 ? ? ? ? ? ? ? 2.200 ? ? metalc6 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 203 A HOH 340 1_555 ? ? ? ? ? ? ? 2.182 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 39 ? ILE A 47 ? ASP A 38 ILE A 46 AA1 2 GLU A 50 ? ASP A 58 ? GLU A 49 ASP A 57 AA1 3 THR A 3 ? GLY A 11 ? THR A 2 GLY A 10 AA1 4 GLY A 78 ? ALA A 84 ? GLY A 77 ALA A 83 AA1 5 MET A 112 ? ASN A 117 ? MET A 111 ASN A 116 AA1 6 PHE A 142 ? GLU A 144 ? PHE A 141 GLU A 143 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 43 ? N LYS A 42 O LEU A 54 ? O LEU A 53 AA1 2 3 O ASP A 55 ? O ASP A 54 N TYR A 5 ? N TYR A 4 AA1 3 4 N VAL A 10 ? N VAL A 9 O VAL A 82 ? O VAL A 81 AA1 4 5 N CYS A 81 ? N CYS A 80 O VAL A 113 ? O VAL A 112 AA1 5 6 N LEU A 114 ? N LEU A 113 O ILE A 143 ? O ILE A 142 # _atom_sites.entry_id 7A1Y _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010899 _atom_sites.fract_transf_matrix[1][2] 0.006292 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012585 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008281 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol BR C H MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 MET 2 1 1 MET MET A . n A 1 3 THR 3 2 2 THR THR A . n A 1 4 GLU 4 3 3 GLU GLU A . n A 1 5 TYR 5 4 4 TYR TYR A . n A 1 6 LYS 6 5 5 LYS LYS A . n A 1 7 LEU 7 6 6 LEU LEU A . n A 1 8 VAL 8 7 7 VAL VAL A . n A 1 9 VAL 9 8 8 VAL VAL A . n A 1 10 VAL 10 9 9 VAL VAL A . n A 1 11 GLY 11 10 10 GLY GLY A . n A 1 12 ALA 12 11 11 ALA ALA A . n A 1 13 CYS 13 12 12 CYS CYS A . n A 1 14 GLY 14 13 13 GLY GLY A . n A 1 15 VAL 15 14 14 VAL VAL A . n A 1 16 GLY 16 15 15 GLY GLY A . n A 1 17 LYS 17 16 16 LYS LYS A . n A 1 18 SER 18 17 17 SER SER A . n A 1 19 ALA 19 18 18 ALA ALA A . n A 1 20 LEU 20 19 19 LEU LEU A . n A 1 21 THR 21 20 20 THR THR A . n A 1 22 ILE 22 21 21 ILE ILE A . n A 1 23 GLN 23 22 22 GLN GLN A . n A 1 24 LEU 24 23 23 LEU LEU A . n A 1 25 ILE 25 24 24 ILE ILE A . n A 1 26 GLN 26 25 25 GLN GLN A . n A 1 27 ASN 27 26 26 ASN ASN A . n A 1 28 HIS 28 27 27 HIS HIS A . n A 1 29 PHE 29 28 28 PHE PHE A . n A 1 30 VAL 30 29 29 VAL VAL A . n A 1 31 ASP 31 30 30 ASP ASP A . n A 1 32 GLU 32 31 31 GLU GLU A . n A 1 33 TYR 33 32 32 TYR TYR A . n A 1 34 ASP 34 33 33 ASP ASP A . n A 1 35 PRO 35 34 34 PRO PRO A . n A 1 36 THR 36 35 35 THR THR A . n A 1 37 ILE 37 36 36 ILE ILE A . n A 1 38 GLU 38 37 37 GLU GLU A . n A 1 39 ASP 39 38 38 ASP ASP A . n A 1 40 SER 40 39 39 SER SER A . n A 1 41 TYR 41 40 40 TYR TYR A . n A 1 42 ARG 42 41 41 ARG ARG A . n A 1 43 LYS 43 42 42 LYS LYS A . n A 1 44 GLN 44 43 43 GLN GLN A . n A 1 45 VAL 45 44 44 VAL VAL A . n A 1 46 VAL 46 45 45 VAL VAL A . n A 1 47 ILE 47 46 46 ILE ILE A . n A 1 48 ASP 48 47 47 ASP ASP A . n A 1 49 GLY 49 48 48 GLY GLY A . n A 1 50 GLU 50 49 49 GLU GLU A . n A 1 51 THR 51 50 50 THR THR A . n A 1 52 CYS 52 51 51 CYS CYS A . n A 1 53 LEU 53 52 52 LEU LEU A . n A 1 54 LEU 54 53 53 LEU LEU A . n A 1 55 ASP 55 54 54 ASP ASP A . n A 1 56 ILE 56 55 55 ILE ILE A . n A 1 57 LEU 57 56 56 LEU LEU A . n A 1 58 ASP 58 57 57 ASP ASP A . n A 1 59 THR 59 58 58 THR THR A . n A 1 60 ALA 60 59 59 ALA ALA A . n A 1 61 GLY 61 60 60 GLY GLY A . n A 1 62 GLN 62 61 61 GLN GLN A . n A 1 63 GLU 63 62 62 GLU GLU A . n A 1 64 GLU 64 63 63 GLU GLU A . n A 1 65 TYR 65 64 64 TYR TYR A . n A 1 66 SER 66 65 ? ? ? A . n A 1 67 ALA 67 66 ? ? ? A . n A 1 68 MET 68 67 67 MET MET A . n A 1 69 ARG 69 68 68 ARG ARG A . n A 1 70 ASP 70 69 69 ASP ASP A . n A 1 71 GLN 71 70 70 GLN GLN A . n A 1 72 TYR 72 71 71 TYR TYR A . n A 1 73 MET 73 72 72 MET MET A . n A 1 74 ARG 74 73 73 ARG ARG A . n A 1 75 THR 75 74 74 THR THR A . n A 1 76 GLY 76 75 75 GLY GLY A . n A 1 77 GLU 77 76 76 GLU GLU A . n A 1 78 GLY 78 77 77 GLY GLY A . n A 1 79 PHE 79 78 78 PHE PHE A . n A 1 80 LEU 80 79 79 LEU LEU A . n A 1 81 CYS 81 80 80 CYS CYS A . n A 1 82 VAL 82 81 81 VAL VAL A . n A 1 83 PHE 83 82 82 PHE PHE A . n A 1 84 ALA 84 83 83 ALA ALA A . n A 1 85 ILE 85 84 84 ILE ILE A . n A 1 86 ASN 86 85 85 ASN ASN A . n A 1 87 ASN 87 86 86 ASN ASN A . n A 1 88 THR 88 87 87 THR THR A . n A 1 89 LYS 89 88 88 LYS LYS A . n A 1 90 SER 90 89 89 SER SER A . n A 1 91 PHE 91 90 90 PHE PHE A . n A 1 92 GLU 92 91 91 GLU GLU A . n A 1 93 ASP 93 92 92 ASP ASP A . n A 1 94 ILE 94 93 93 ILE ILE A . n A 1 95 HIS 95 94 94 HIS HIS A . n A 1 96 HIS 96 95 95 HIS HIS A . n A 1 97 TYR 97 96 96 TYR TYR A . n A 1 98 ARG 98 97 97 ARG ARG A . n A 1 99 GLU 99 98 98 GLU GLU A . n A 1 100 GLN 100 99 99 GLN GLN A . n A 1 101 ILE 101 100 100 ILE ILE A . n A 1 102 LYS 102 101 101 LYS LYS A . n A 1 103 ARG 103 102 102 ARG ARG A . n A 1 104 VAL 104 103 103 VAL VAL A . n A 1 105 LYS 105 104 104 LYS LYS A . n A 1 106 ASP 106 105 105 ASP ASP A . n A 1 107 SER 107 106 106 SER SER A . n A 1 108 GLU 108 107 107 GLU GLU A . n A 1 109 ASP 109 108 108 ASP ASP A . n A 1 110 VAL 110 109 109 VAL VAL A . n A 1 111 PRO 111 110 110 PRO PRO A . n A 1 112 MET 112 111 111 MET MET A . n A 1 113 VAL 113 112 112 VAL VAL A . n A 1 114 LEU 114 113 113 LEU LEU A . n A 1 115 VAL 115 114 114 VAL VAL A . n A 1 116 GLY 116 115 115 GLY GLY A . n A 1 117 ASN 117 116 116 ASN ASN A . n A 1 118 LYS 118 117 117 LYS LYS A . n A 1 119 CYS 119 118 118 CYS CYS A . n A 1 120 ASP 120 119 119 ASP ASP A . n A 1 121 LEU 121 120 120 LEU LEU A . n A 1 122 PRO 122 121 121 PRO PRO A . n A 1 123 SER 123 122 122 SER SER A . n A 1 124 ARG 124 123 123 ARG ARG A . n A 1 125 THR 125 124 124 THR THR A . n A 1 126 VAL 126 125 125 VAL VAL A . n A 1 127 ASP 127 126 126 ASP ASP A . n A 1 128 THR 128 127 127 THR THR A . n A 1 129 LYS 129 128 128 LYS LYS A . n A 1 130 GLN 130 129 129 GLN GLN A . n A 1 131 ALA 131 130 130 ALA ALA A . n A 1 132 GLN 132 131 131 GLN GLN A . n A 1 133 ASP 133 132 132 ASP ASP A . n A 1 134 LEU 134 133 133 LEU LEU A . n A 1 135 ALA 135 134 134 ALA ALA A . n A 1 136 ARG 136 135 135 ARG ARG A . n A 1 137 SER 137 136 136 SER SER A . n A 1 138 TYR 138 137 137 TYR TYR A . n A 1 139 GLY 139 138 138 GLY GLY A . n A 1 140 ILE 140 139 139 ILE ILE A . n A 1 141 PRO 141 140 140 PRO PRO A . n A 1 142 PHE 142 141 141 PHE PHE A . n A 1 143 ILE 143 142 142 ILE ILE A . n A 1 144 GLU 144 143 143 GLU GLU A . n A 1 145 THR 145 144 144 THR THR A . n A 1 146 SER 146 145 145 SER SER A . n A 1 147 ALA 147 146 146 ALA ALA A . n A 1 148 LYS 148 147 147 LYS LYS A . n A 1 149 THR 149 148 148 THR THR A . n A 1 150 ARG 150 149 149 ARG ARG A . n A 1 151 GLN 151 150 150 GLN GLN A . n A 1 152 GLY 152 151 151 GLY GLY A . n A 1 153 VAL 153 152 152 VAL VAL A . n A 1 154 ASP 154 153 153 ASP ASP A . n A 1 155 ASP 155 154 154 ASP ASP A . n A 1 156 ALA 156 155 155 ALA ALA A . n A 1 157 PHE 157 156 156 PHE PHE A . n A 1 158 TYR 158 157 157 TYR TYR A . n A 1 159 THR 159 158 158 THR THR A . n A 1 160 LEU 160 159 159 LEU LEU A . n A 1 161 VAL 161 160 160 VAL VAL A . n A 1 162 ARG 162 161 161 ARG ARG A . n A 1 163 GLU 163 162 162 GLU GLU A . n A 1 164 ILE 164 163 163 ILE ILE A . n A 1 165 ARG 165 164 164 ARG ARG A . n A 1 166 LYS 166 165 165 LYS LYS A . n A 1 167 HIS 167 166 166 HIS HIS A . n A 1 168 LYS 168 167 167 LYS LYS A . n A 1 169 GLU 169 168 168 GLU GLU A . n A 1 170 LYS 170 169 169 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 QWH 1 201 201 QWH INH A . C 3 GDP 1 202 3 GDP GDP A . D 4 MG 1 203 1 MG MG A . E 5 SO4 1 204 1 SO4 SO4 A . F 6 HOH 1 301 34 HOH HOH A . F 6 HOH 2 302 57 HOH HOH A . F 6 HOH 3 303 43 HOH HOH A . F 6 HOH 4 304 79 HOH HOH A . F 6 HOH 5 305 91 HOH HOH A . F 6 HOH 6 306 94 HOH HOH A . F 6 HOH 7 307 1 HOH HOH A . F 6 HOH 8 308 33 HOH HOH A . F 6 HOH 9 309 41 HOH HOH A . F 6 HOH 10 310 6 HOH HOH A . F 6 HOH 11 311 73 HOH HOH A . F 6 HOH 12 312 50 HOH HOH A . F 6 HOH 13 313 36 HOH HOH A . F 6 HOH 14 314 35 HOH HOH A . F 6 HOH 15 315 39 HOH HOH A . F 6 HOH 16 316 47 HOH HOH A . F 6 HOH 17 317 63 HOH HOH A . F 6 HOH 18 318 15 HOH HOH A . F 6 HOH 19 319 44 HOH HOH A . F 6 HOH 20 320 26 HOH HOH A . F 6 HOH 21 321 65 HOH HOH A . F 6 HOH 22 322 27 HOH HOH A . F 6 HOH 23 323 8 HOH HOH A . F 6 HOH 24 324 19 HOH HOH A . F 6 HOH 25 325 52 HOH HOH A . F 6 HOH 26 326 48 HOH HOH A . F 6 HOH 27 327 25 HOH HOH A . F 6 HOH 28 328 95 HOH HOH A . F 6 HOH 29 329 83 HOH HOH A . F 6 HOH 30 330 72 HOH HOH A . F 6 HOH 31 331 29 HOH HOH A . F 6 HOH 32 332 59 HOH HOH A . F 6 HOH 33 333 64 HOH HOH A . F 6 HOH 34 334 71 HOH HOH A . F 6 HOH 35 335 10 HOH HOH A . F 6 HOH 36 336 7 HOH HOH A . F 6 HOH 37 337 46 HOH HOH A . F 6 HOH 38 338 3 HOH HOH A . F 6 HOH 39 339 42 HOH HOH A . F 6 HOH 40 340 9 HOH HOH A . F 6 HOH 41 341 31 HOH HOH A . F 6 HOH 42 342 5 HOH HOH A . F 6 HOH 43 343 62 HOH HOH A . F 6 HOH 44 344 53 HOH HOH A . F 6 HOH 45 345 92 HOH HOH A . F 6 HOH 46 346 20 HOH HOH A . F 6 HOH 47 347 40 HOH HOH A . F 6 HOH 48 348 60 HOH HOH A . F 6 HOH 49 349 22 HOH HOH A . F 6 HOH 50 350 4 HOH HOH A . F 6 HOH 51 351 75 HOH HOH A . F 6 HOH 52 352 90 HOH HOH A . F 6 HOH 53 353 76 HOH HOH A . F 6 HOH 54 354 11 HOH HOH A . F 6 HOH 55 355 82 HOH HOH A . F 6 HOH 56 356 66 HOH HOH A . F 6 HOH 57 357 80 HOH HOH A . F 6 HOH 58 358 45 HOH HOH A . F 6 HOH 59 359 54 HOH HOH A . F 6 HOH 60 360 70 HOH HOH A . F 6 HOH 61 361 85 HOH HOH A . F 6 HOH 62 362 55 HOH HOH A . F 6 HOH 63 363 81 HOH HOH A . F 6 HOH 64 364 14 HOH HOH A . F 6 HOH 65 365 12 HOH HOH A . F 6 HOH 66 366 87 HOH HOH A . F 6 HOH 67 367 16 HOH HOH A . F 6 HOH 68 368 2 HOH HOH A . F 6 HOH 69 369 67 HOH HOH A . F 6 HOH 70 370 37 HOH HOH A . F 6 HOH 71 371 38 HOH HOH A . F 6 HOH 72 372 58 HOH HOH A . F 6 HOH 73 373 28 HOH HOH A . F 6 HOH 74 374 18 HOH HOH A . F 6 HOH 75 375 23 HOH HOH A . F 6 HOH 76 376 17 HOH HOH A . F 6 HOH 77 377 93 HOH HOH A . F 6 HOH 78 378 69 HOH HOH A . F 6 HOH 79 379 49 HOH HOH A . F 6 HOH 80 380 74 HOH HOH A . F 6 HOH 81 381 61 HOH HOH A . F 6 HOH 82 382 51 HOH HOH A . F 6 HOH 83 383 13 HOH HOH A . F 6 HOH 84 384 56 HOH HOH A . F 6 HOH 85 385 30 HOH HOH A . F 6 HOH 86 386 24 HOH HOH A . F 6 HOH 87 387 77 HOH HOH A . F 6 HOH 88 388 68 HOH HOH A . F 6 HOH 89 389 97 HOH HOH A . F 6 HOH 90 390 88 HOH HOH A . F 6 HOH 91 391 86 HOH HOH A . F 6 HOH 92 392 96 HOH HOH A . F 6 HOH 93 393 21 HOH HOH A . F 6 HOH 94 394 89 HOH HOH A . F 6 HOH 95 395 32 HOH HOH A . F 6 HOH 96 396 78 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1000 ? 1 MORE -27 ? 1 'SSA (A^2)' 8170 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A SO4 204 ? E SO4 . 2 1 A HOH 388 ? F HOH . 3 1 A HOH 396 ? F HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OG ? A SER 18 ? A SER 17 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O3B ? C GDP . ? A GDP 202 ? 1_555 91.4 ? 2 OG ? A SER 18 ? A SER 17 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 310 ? 1_555 86.9 ? 3 O3B ? C GDP . ? A GDP 202 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 310 ? 1_555 87.8 ? 4 OG ? A SER 18 ? A SER 17 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 323 ? 1_555 92.2 ? 5 O3B ? C GDP . ? A GDP 202 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 323 ? 1_555 95.6 ? 6 O ? F HOH . ? A HOH 310 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 323 ? 1_555 176.5 ? 7 OG ? A SER 18 ? A SER 17 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 336 ? 1_555 92.8 ? 8 O3B ? C GDP . ? A GDP 202 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 336 ? 1_555 169.2 ? 9 O ? F HOH . ? A HOH 310 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 336 ? 1_555 82.5 ? 10 O ? F HOH . ? A HOH 323 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 336 ? 1_555 94.2 ? 11 OG ? A SER 18 ? A SER 17 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 340 ? 1_555 174.7 ? 12 O3B ? C GDP . ? A GDP 202 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 340 ? 1_555 93.8 ? 13 O ? F HOH . ? A HOH 310 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 340 ? 1_555 92.1 ? 14 O ? F HOH . ? A HOH 323 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 340 ? 1_555 88.5 ? 15 O ? F HOH . ? A HOH 336 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 340 ? 1_555 81.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-10-13 2 'Structure model' 1 1 2022-01-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_volume' 4 2 'Structure model' '_citation.page_first' 5 2 'Structure model' '_citation.page_last' 6 2 'Structure model' '_citation.year' 7 2 'Structure model' '_citation_author.identifier_ORCID' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.7 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 7A1Y _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 33 ? ? -39.22 111.26 2 1 LYS A 117 ? ? 70.49 35.15 3 1 SER A 122 ? ? -90.63 51.47 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A SER 65 ? A SER 66 3 1 Y 1 A ALA 66 ? A ALA 67 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id QWH _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id QWH _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '~{N}-(3-bromanyl-2,6-dimethyl-pyridin-4-yl)propanamide' QWH 3 "GUANOSINE-5'-DIPHOSPHATE" GDP 4 'MAGNESIUM ION' MG 5 'SULFATE ION' SO4 6 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #