data_7AFW # _entry.id 7AFW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7AFW pdb_00007afw 10.2210/pdb7afw/pdb WWPDB D_1292111332 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-12-16 2 'Structure model' 1 1 2021-05-19 3 'Structure model' 1 2 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.year' 5 2 'Structure model' '_citation_author.name' 6 3 'Structure model' '_database_2.pdbx_DOI' 7 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7AFW _pdbx_database_status.recvd_initial_deposition_date 2020-09-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Boettcher, J.' 1 0000-0003-2189-5926 'Kessler, D.' 2 0000-0001-6808-9011 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country DE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Chemmedchem _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1860-7187 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first 1420 _citation.page_last 1424 _citation.title 'Getting a Grip on the Undrugged: Targeting beta-Catenin with Fragment-Based Methods.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/cmdc.202000839 _citation.pdbx_database_id_PubMed 33275320 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kessler, D.' 1 ? primary 'Mayer, M.' 2 ? primary 'Zahn, S.K.' 3 ? primary 'Zeeb, M.' 4 ? primary 'Wohrle, S.' 5 ? primary 'Bergner, A.' 6 ? primary 'Bruchhaus, J.' 7 ? primary 'Ciftci, T.' 8 ? primary 'Dahmann, G.' 9 ? primary 'Dettling, M.' 10 ? primary 'Dobel, S.' 11 ? primary 'Fuchs, J.E.' 12 ? primary 'Geist, L.' 13 ? primary 'Hela, W.' 14 ? primary 'Kofink, C.' 15 ? primary 'Kousek, R.' 16 ? primary 'Moser, F.' 17 ? primary 'Puchner, T.' 18 ? primary 'Rumpel, K.' 19 ? primary 'Scharnweber, M.' 20 ? primary 'Werni, P.' 21 ? primary 'Wolkerstorfer, B.' 22 ? primary 'Breitsprecher, D.' 23 ? primary 'Baaske, P.' 24 ? primary 'Pearson, M.' 25 ? primary 'McConnell, D.B.' 26 ? primary 'Bottcher, J.' 27 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Catenin beta-1' 18176.174 1 ? ? ? ? 2 non-polymer syn '3-[(2~{R})-4-methyl-5-oxidanylidene-2,3-dihydro-1,4-benzoxazepin-2-yl]benzenecarbonitrile' 278.305 1 ? ? ? ? 3 water nat water 18.015 69 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Beta-catenin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSNYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTL HNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITT DCLQILA ; _entity_poly.pdbx_seq_one_letter_code_can ;GSNYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTL HNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITT DCLQILA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '3-[(2~{R})-4-methyl-5-oxidanylidene-2,3-dihydro-1,4-benzoxazepin-2-yl]benzenecarbonitrile' R9Q 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ASN n 1 4 TYR n 1 5 GLN n 1 6 ASP n 1 7 ASP n 1 8 ALA n 1 9 GLU n 1 10 LEU n 1 11 ALA n 1 12 THR n 1 13 ARG n 1 14 ALA n 1 15 ILE n 1 16 PRO n 1 17 GLU n 1 18 LEU n 1 19 THR n 1 20 LYS n 1 21 LEU n 1 22 LEU n 1 23 ASN n 1 24 ASP n 1 25 GLU n 1 26 ASP n 1 27 GLN n 1 28 VAL n 1 29 VAL n 1 30 VAL n 1 31 ASN n 1 32 LYS n 1 33 ALA n 1 34 ALA n 1 35 VAL n 1 36 MET n 1 37 VAL n 1 38 HIS n 1 39 GLN n 1 40 LEU n 1 41 SER n 1 42 LYS n 1 43 LYS n 1 44 GLU n 1 45 ALA n 1 46 SER n 1 47 ARG n 1 48 HIS n 1 49 ALA n 1 50 ILE n 1 51 MET n 1 52 ARG n 1 53 SER n 1 54 PRO n 1 55 GLN n 1 56 MET n 1 57 VAL n 1 58 SER n 1 59 ALA n 1 60 ILE n 1 61 VAL n 1 62 ARG n 1 63 THR n 1 64 MET n 1 65 GLN n 1 66 ASN n 1 67 THR n 1 68 ASN n 1 69 ASP n 1 70 VAL n 1 71 GLU n 1 72 THR n 1 73 ALA n 1 74 ARG n 1 75 CYS n 1 76 THR n 1 77 ALA n 1 78 GLY n 1 79 THR n 1 80 LEU n 1 81 HIS n 1 82 ASN n 1 83 LEU n 1 84 SER n 1 85 HIS n 1 86 HIS n 1 87 ARG n 1 88 GLU n 1 89 GLY n 1 90 LEU n 1 91 LEU n 1 92 ALA n 1 93 ILE n 1 94 PHE n 1 95 LYS n 1 96 SER n 1 97 GLY n 1 98 GLY n 1 99 ILE n 1 100 PRO n 1 101 ALA n 1 102 LEU n 1 103 VAL n 1 104 LYS n 1 105 MET n 1 106 LEU n 1 107 GLY n 1 108 SER n 1 109 PRO n 1 110 VAL n 1 111 ASP n 1 112 SER n 1 113 VAL n 1 114 LEU n 1 115 PHE n 1 116 TYR n 1 117 ALA n 1 118 ILE n 1 119 THR n 1 120 THR n 1 121 LEU n 1 122 HIS n 1 123 ASN n 1 124 LEU n 1 125 LEU n 1 126 LEU n 1 127 HIS n 1 128 GLN n 1 129 GLU n 1 130 GLY n 1 131 ALA n 1 132 LYS n 1 133 MET n 1 134 ALA n 1 135 VAL n 1 136 ARG n 1 137 LEU n 1 138 ALA n 1 139 GLY n 1 140 GLY n 1 141 LEU n 1 142 GLN n 1 143 LYS n 1 144 MET n 1 145 VAL n 1 146 ALA n 1 147 LEU n 1 148 LEU n 1 149 ASN n 1 150 LYS n 1 151 THR n 1 152 ASN n 1 153 VAL n 1 154 LYS n 1 155 PHE n 1 156 LEU n 1 157 ALA n 1 158 ILE n 1 159 THR n 1 160 THR n 1 161 ASP n 1 162 CYS n 1 163 LEU n 1 164 GLN n 1 165 ILE n 1 166 LEU n 1 167 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 167 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CTNNB1, CTNNB, OK/SW-cl.35, PRO2286' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 R9Q non-polymer . '3-[(2~{R})-4-methyl-5-oxidanylidene-2,3-dihydro-1,4-benzoxazepin-2-yl]benzenecarbonitrile' ? 'C17 H14 N2 O2' 278.305 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 139 ? ? ? A . n A 1 2 SER 2 140 ? ? ? A . n A 1 3 ASN 3 141 ? ? ? A . n A 1 4 TYR 4 142 ? ? ? A . n A 1 5 GLN 5 143 ? ? ? A . n A 1 6 ASP 6 144 144 ASP ASP A . n A 1 7 ASP 7 145 145 ASP ASP A . n A 1 8 ALA 8 146 146 ALA ALA A . n A 1 9 GLU 9 147 147 GLU GLU A . n A 1 10 LEU 10 148 148 LEU LEU A . n A 1 11 ALA 11 149 149 ALA ALA A . n A 1 12 THR 12 150 150 THR THR A . n A 1 13 ARG 13 151 151 ARG ARG A . n A 1 14 ALA 14 152 152 ALA ALA A . n A 1 15 ILE 15 153 153 ILE ILE A . n A 1 16 PRO 16 154 154 PRO PRO A . n A 1 17 GLU 17 155 155 GLU GLU A . n A 1 18 LEU 18 156 156 LEU LEU A . n A 1 19 THR 19 157 157 THR THR A . n A 1 20 LYS 20 158 158 LYS LYS A . n A 1 21 LEU 21 159 159 LEU LEU A . n A 1 22 LEU 22 160 160 LEU LEU A . n A 1 23 ASN 23 161 161 ASN ASN A . n A 1 24 ASP 24 162 162 ASP ASP A . n A 1 25 GLU 25 163 163 GLU GLU A . n A 1 26 ASP 26 164 164 ASP ASP A . n A 1 27 GLN 27 165 165 GLN GLN A . n A 1 28 VAL 28 166 166 VAL VAL A . n A 1 29 VAL 29 167 167 VAL VAL A . n A 1 30 VAL 30 168 168 VAL VAL A . n A 1 31 ASN 31 169 169 ASN ASN A . n A 1 32 LYS 32 170 170 LYS LYS A . n A 1 33 ALA 33 171 171 ALA ALA A . n A 1 34 ALA 34 172 172 ALA ALA A . n A 1 35 VAL 35 173 173 VAL VAL A . n A 1 36 MET 36 174 174 MET MET A . n A 1 37 VAL 37 175 175 VAL VAL A . n A 1 38 HIS 38 176 176 HIS HIS A . n A 1 39 GLN 39 177 177 GLN GLN A . n A 1 40 LEU 40 178 178 LEU LEU A . n A 1 41 SER 41 179 179 SER SER A . n A 1 42 LYS 42 180 180 LYS LYS A . n A 1 43 LYS 43 181 181 LYS LYS A . n A 1 44 GLU 44 182 182 GLU GLU A . n A 1 45 ALA 45 183 183 ALA ALA A . n A 1 46 SER 46 184 184 SER SER A . n A 1 47 ARG 47 185 185 ARG ARG A . n A 1 48 HIS 48 186 186 HIS HIS A . n A 1 49 ALA 49 187 187 ALA ALA A . n A 1 50 ILE 50 188 188 ILE ILE A . n A 1 51 MET 51 189 189 MET MET A . n A 1 52 ARG 52 190 190 ARG ARG A . n A 1 53 SER 53 191 191 SER SER A . n A 1 54 PRO 54 192 192 PRO PRO A . n A 1 55 GLN 55 193 193 GLN GLN A . n A 1 56 MET 56 194 194 MET MET A . n A 1 57 VAL 57 195 195 VAL VAL A . n A 1 58 SER 58 196 196 SER SER A . n A 1 59 ALA 59 197 197 ALA ALA A . n A 1 60 ILE 60 198 198 ILE ILE A . n A 1 61 VAL 61 199 199 VAL VAL A . n A 1 62 ARG 62 200 200 ARG ARG A . n A 1 63 THR 63 201 201 THR THR A . n A 1 64 MET 64 202 202 MET MET A . n A 1 65 GLN 65 203 203 GLN GLN A . n A 1 66 ASN 66 204 204 ASN ASN A . n A 1 67 THR 67 205 205 THR THR A . n A 1 68 ASN 68 206 206 ASN ASN A . n A 1 69 ASP 69 207 207 ASP ASP A . n A 1 70 VAL 70 208 208 VAL VAL A . n A 1 71 GLU 71 209 209 GLU GLU A . n A 1 72 THR 72 210 210 THR THR A . n A 1 73 ALA 73 211 211 ALA ALA A . n A 1 74 ARG 74 212 212 ARG ARG A . n A 1 75 CYS 75 213 213 CYS CYS A . n A 1 76 THR 76 214 214 THR THR A . n A 1 77 ALA 77 215 215 ALA ALA A . n A 1 78 GLY 78 216 216 GLY GLY A . n A 1 79 THR 79 217 217 THR THR A . n A 1 80 LEU 80 218 218 LEU LEU A . n A 1 81 HIS 81 219 219 HIS HIS A . n A 1 82 ASN 82 220 220 ASN ASN A . n A 1 83 LEU 83 221 221 LEU LEU A . n A 1 84 SER 84 222 222 SER SER A . n A 1 85 HIS 85 223 223 HIS HIS A . n A 1 86 HIS 86 224 224 HIS HIS A . n A 1 87 ARG 87 225 225 ARG ARG A . n A 1 88 GLU 88 226 226 GLU GLU A . n A 1 89 GLY 89 227 227 GLY GLY A . n A 1 90 LEU 90 228 228 LEU LEU A . n A 1 91 LEU 91 229 229 LEU LEU A . n A 1 92 ALA 92 230 230 ALA ALA A . n A 1 93 ILE 93 231 231 ILE ILE A . n A 1 94 PHE 94 232 232 PHE PHE A . n A 1 95 LYS 95 233 233 LYS LYS A . n A 1 96 SER 96 234 234 SER SER A . n A 1 97 GLY 97 235 235 GLY GLY A . n A 1 98 GLY 98 236 236 GLY GLY A . n A 1 99 ILE 99 237 237 ILE ILE A . n A 1 100 PRO 100 238 238 PRO PRO A . n A 1 101 ALA 101 239 239 ALA ALA A . n A 1 102 LEU 102 240 240 LEU LEU A . n A 1 103 VAL 103 241 241 VAL VAL A . n A 1 104 LYS 104 242 242 LYS LYS A . n A 1 105 MET 105 243 243 MET MET A . n A 1 106 LEU 106 244 244 LEU LEU A . n A 1 107 GLY 107 245 245 GLY GLY A . n A 1 108 SER 108 246 246 SER SER A . n A 1 109 PRO 109 247 247 PRO PRO A . n A 1 110 VAL 110 248 248 VAL VAL A . n A 1 111 ASP 111 249 249 ASP ASP A . n A 1 112 SER 112 250 250 SER SER A . n A 1 113 VAL 113 251 251 VAL VAL A . n A 1 114 LEU 114 252 252 LEU LEU A . n A 1 115 PHE 115 253 253 PHE PHE A . n A 1 116 TYR 116 254 254 TYR TYR A . n A 1 117 ALA 117 255 255 ALA ALA A . n A 1 118 ILE 118 256 256 ILE ILE A . n A 1 119 THR 119 257 257 THR THR A . n A 1 120 THR 120 258 258 THR THR A . n A 1 121 LEU 121 259 259 LEU LEU A . n A 1 122 HIS 122 260 260 HIS HIS A . n A 1 123 ASN 123 261 261 ASN ASN A . n A 1 124 LEU 124 262 262 LEU LEU A . n A 1 125 LEU 125 263 263 LEU LEU A . n A 1 126 LEU 126 264 264 LEU LEU A . n A 1 127 HIS 127 265 265 HIS HIS A . n A 1 128 GLN 128 266 266 GLN GLN A . n A 1 129 GLU 129 267 267 GLU GLU A . n A 1 130 GLY 130 268 268 GLY GLY A . n A 1 131 ALA 131 269 269 ALA ALA A . n A 1 132 LYS 132 270 270 LYS LYS A . n A 1 133 MET 133 271 271 MET MET A . n A 1 134 ALA 134 272 272 ALA ALA A . n A 1 135 VAL 135 273 273 VAL VAL A . n A 1 136 ARG 136 274 274 ARG ARG A . n A 1 137 LEU 137 275 275 LEU LEU A . n A 1 138 ALA 138 276 276 ALA ALA A . n A 1 139 GLY 139 277 277 GLY GLY A . n A 1 140 GLY 140 278 278 GLY GLY A . n A 1 141 LEU 141 279 279 LEU LEU A . n A 1 142 GLN 142 280 280 GLN GLN A . n A 1 143 LYS 143 281 281 LYS LYS A . n A 1 144 MET 144 282 282 MET MET A . n A 1 145 VAL 145 283 283 VAL VAL A . n A 1 146 ALA 146 284 284 ALA ALA A . n A 1 147 LEU 147 285 285 LEU LEU A . n A 1 148 LEU 148 286 286 LEU LEU A . n A 1 149 ASN 149 287 287 ASN ASN A . n A 1 150 LYS 150 288 288 LYS LYS A . n A 1 151 THR 151 289 289 THR THR A . n A 1 152 ASN 152 290 290 ASN ASN A . n A 1 153 VAL 153 291 291 VAL VAL A . n A 1 154 LYS 154 292 292 LYS LYS A . n A 1 155 PHE 155 293 293 PHE PHE A . n A 1 156 LEU 156 294 294 LEU LEU A . n A 1 157 ALA 157 295 295 ALA ALA A . n A 1 158 ILE 158 296 296 ILE ILE A . n A 1 159 THR 159 297 297 THR THR A . n A 1 160 THR 160 298 298 THR THR A . n A 1 161 ASP 161 299 299 ASP ASP A . n A 1 162 CYS 162 300 300 CYS CYS A . n A 1 163 LEU 163 301 301 LEU LEU A . n A 1 164 GLN 164 302 302 GLN GLN A . n A 1 165 ILE 165 303 303 ILE ILE A . n A 1 166 LEU 166 304 304 LEU LEU A . n A 1 167 ALA 167 305 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 R9Q 1 401 1 R9Q LIG A . C 3 HOH 1 501 5 HOH HOH A . C 3 HOH 2 502 60 HOH HOH A . C 3 HOH 3 503 34 HOH HOH A . C 3 HOH 4 504 48 HOH HOH A . C 3 HOH 5 505 7 HOH HOH A . C 3 HOH 6 506 3 HOH HOH A . C 3 HOH 7 507 33 HOH HOH A . C 3 HOH 8 508 69 HOH HOH A . C 3 HOH 9 509 26 HOH HOH A . C 3 HOH 10 510 8 HOH HOH A . C 3 HOH 11 511 61 HOH HOH A . C 3 HOH 12 512 32 HOH HOH A . C 3 HOH 13 513 62 HOH HOH A . C 3 HOH 14 514 4 HOH HOH A . C 3 HOH 15 515 29 HOH HOH A . C 3 HOH 16 516 2 HOH HOH A . C 3 HOH 17 517 55 HOH HOH A . C 3 HOH 18 518 52 HOH HOH A . C 3 HOH 19 519 51 HOH HOH A . C 3 HOH 20 520 65 HOH HOH A . C 3 HOH 21 521 44 HOH HOH A . C 3 HOH 22 522 24 HOH HOH A . C 3 HOH 23 523 35 HOH HOH A . C 3 HOH 24 524 9 HOH HOH A . C 3 HOH 25 525 66 HOH HOH A . C 3 HOH 26 526 22 HOH HOH A . C 3 HOH 27 527 10 HOH HOH A . C 3 HOH 28 528 23 HOH HOH A . C 3 HOH 29 529 21 HOH HOH A . C 3 HOH 30 530 16 HOH HOH A . C 3 HOH 31 531 12 HOH HOH A . C 3 HOH 32 532 39 HOH HOH A . C 3 HOH 33 533 47 HOH HOH A . C 3 HOH 34 534 25 HOH HOH A . C 3 HOH 35 535 43 HOH HOH A . C 3 HOH 36 536 50 HOH HOH A . C 3 HOH 37 537 31 HOH HOH A . C 3 HOH 38 538 11 HOH HOH A . C 3 HOH 39 539 1 HOH HOH A . C 3 HOH 40 540 27 HOH HOH A . C 3 HOH 41 541 36 HOH HOH A . C 3 HOH 42 542 17 HOH HOH A . C 3 HOH 43 543 45 HOH HOH A . C 3 HOH 44 544 58 HOH HOH A . C 3 HOH 45 545 6 HOH HOH A . C 3 HOH 46 546 56 HOH HOH A . C 3 HOH 47 547 63 HOH HOH A . C 3 HOH 48 548 46 HOH HOH A . C 3 HOH 49 549 64 HOH HOH A . C 3 HOH 50 550 18 HOH HOH A . C 3 HOH 51 551 20 HOH HOH A . C 3 HOH 52 552 28 HOH HOH A . C 3 HOH 53 553 19 HOH HOH A . C 3 HOH 54 554 54 HOH HOH A . C 3 HOH 55 555 70 HOH HOH A . C 3 HOH 56 556 42 HOH HOH A . C 3 HOH 57 557 15 HOH HOH A . C 3 HOH 58 558 37 HOH HOH A . C 3 HOH 59 559 67 HOH HOH A . C 3 HOH 60 560 57 HOH HOH A . C 3 HOH 61 561 14 HOH HOH A . C 3 HOH 62 562 13 HOH HOH A . C 3 HOH 63 563 40 HOH HOH A . C 3 HOH 64 564 30 HOH HOH A . C 3 HOH 65 565 74 HOH HOH A . C 3 HOH 66 566 72 HOH HOH A . C 3 HOH 67 567 71 HOH HOH A . C 3 HOH 68 568 53 HOH HOH A . C 3 HOH 69 569 73 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.7 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'Jan 26, 201' 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? 1.1.7 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 5 # _cell.angle_alpha 90 _cell.angle_alpha_esd ? _cell.angle_beta 90 _cell.angle_beta_esd ? _cell.angle_gamma 120 _cell.angle_gamma_esd ? _cell.entry_id 7AFW _cell.details ? _cell.formula_units_Z ? _cell.length_a 53.453 _cell.length_a_esd ? _cell.length_b 53.453 _cell.length_b_esd ? _cell.length_c 87.545 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7AFW _symmetry.cell_setting ? _symmetry.Int_Tables_number 150 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 3 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7AFW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.99 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.08 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 278 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '25% PEG 3350, 100 mM BIS-TRIS buffer pH 5.5 and 0.2 M Magnesium chloride' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type RIGAKU _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-11-27 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.541800 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'SEALED TUBE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-003' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.541800 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7AFW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.814 _reflns.d_resolution_low 87.545 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11045 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 80.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.3 _reflns.pdbx_Rmerge_I_obs 0.075 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.075 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.814 _reflns_shell.d_res_low 1.929 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1066 _reflns_shell.percent_possible_all 24.5 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.825 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 1.9 _reflns_shell.pdbx_Rsym_value 0.825 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 2.3237 _refine.aniso_B[1][2] 0 _refine.aniso_B[1][3] 0 _refine.aniso_B[2][2] 2.3237 _refine.aniso_B[2][3] 0 _refine.aniso_B[3][3] -4.6475 _refine.B_iso_max ? _refine.B_iso_mean 19.06 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.872 _refine.correlation_coeff_Fo_to_Fc_free 0.811 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7AFW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.814 _refine.ls_d_res_low 87.55 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11045 _refine.ls_number_reflns_R_free 551 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 80.8 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2299 _refine.ls_R_factor_R_free 0.2813 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2272 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3SLA _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.188 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.192 _refine.pdbx_overall_SU_R_Blow_DPI 0.222 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.21 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 7AFW _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.35 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.814 _refine_hist.d_res_low 87.55 _refine_hist.number_atoms_solvent 69 _refine_hist.number_atoms_total 1314 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1224 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 21 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 1261 ? t_bond_d 2 HARMONIC 'X-RAY DIFFRACTION' ? 0.97 ? 1706 ? t_angle_deg 2 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 456 ? t_dihedral_angle_d 2 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 211 ? t_gen_planes 5 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1261 ? t_it 10 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 174 ? t_chiral_improper_torsion 5 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? 1133 ? t_ideal_dist_contact 4 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 2.68 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 17.42 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.814 _refine_ls_shell.d_res_low 1.91 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 24 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.percent_reflns_obs 21.05 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3613 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2498 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7AFW _struct.title 'Beta-Catenin in complex with compound 6' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7AFW _struct_keywords.text 'Fragment, ONCOPROTEIN' _struct_keywords.pdbx_keywords ONCOPROTEIN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CTNB1_HUMAN _struct_ref.pdbx_db_accession P35222 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHN LSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC LQILA ; _struct_ref.pdbx_align_begin 141 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7AFW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 167 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P35222 _struct_ref_seq.db_align_beg 141 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 305 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 141 _struct_ref_seq.pdbx_auth_seq_align_end 305 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7AFW GLY A 1 ? UNP P35222 ? ? 'expression tag' 139 1 1 7AFW SER A 2 ? UNP P35222 ? ? 'expression tag' 140 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8370 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 6 ? ASN A 23 ? ASP A 144 ASN A 161 1 ? 18 HELX_P HELX_P2 AA2 ASP A 26 ? LYS A 42 ? ASP A 164 LYS A 180 1 ? 17 HELX_P HELX_P3 AA3 LYS A 43 ? ARG A 52 ? LYS A 181 ARG A 190 1 ? 10 HELX_P HELX_P4 AA4 SER A 53 ? THR A 67 ? SER A 191 THR A 205 1 ? 15 HELX_P HELX_P5 AA5 ASP A 69 ? SER A 84 ? ASP A 207 SER A 222 1 ? 16 HELX_P HELX_P6 AA6 HIS A 86 ? SER A 96 ? HIS A 224 SER A 234 1 ? 11 HELX_P HELX_P7 AA7 GLY A 97 ? LEU A 106 ? GLY A 235 LEU A 244 1 ? 10 HELX_P HELX_P8 AA8 VAL A 110 ? GLN A 128 ? VAL A 248 GLN A 266 1 ? 19 HELX_P HELX_P9 AA9 GLY A 130 ? ALA A 138 ? GLY A 268 ALA A 276 1 ? 9 HELX_P HELX_P10 AB1 GLY A 139 ? LEU A 147 ? GLY A 277 LEU A 285 1 ? 9 HELX_P HELX_P11 AB2 LEU A 148 ? LYS A 150 ? LEU A 286 LYS A 288 5 ? 3 HELX_P HELX_P12 AB3 ASN A 152 ? LEU A 166 ? ASN A 290 LEU A 304 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id R9Q _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 12 _struct_site.details 'binding site for residue R9Q A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 THR A 67 ? THR A 205 . ? 1_555 ? 2 AC1 12 ASN A 68 ? ASN A 206 . ? 1_555 ? 3 AC1 12 VAL A 70 ? VAL A 208 . ? 1_555 ? 4 AC1 12 ALA A 73 ? ALA A 211 . ? 1_555 ? 5 AC1 12 LYS A 104 ? LYS A 242 . ? 1_555 ? 6 AC1 12 MET A 105 ? MET A 243 . ? 1_555 ? 7 AC1 12 GLY A 107 ? GLY A 245 . ? 1_555 ? 8 AC1 12 SER A 108 ? SER A 246 . ? 1_555 ? 9 AC1 12 PRO A 109 ? PRO A 247 . ? 1_555 ? 10 AC1 12 VAL A 110 ? VAL A 248 . ? 1_555 ? 11 AC1 12 PHE A 115 ? PHE A 253 . ? 3_755 ? 12 AC1 12 LYS A 154 ? LYS A 292 . ? 3_755 ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LEU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 286 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -59.94 _pdbx_validate_torsion.psi -6.58 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 565 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method ? _pdbx_refine_tls.origin_x 70.298 _pdbx_refine_tls.origin_y -30.7596 _pdbx_refine_tls.origin_z 22.2517 _pdbx_refine_tls.T[1][1] -0.0392 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0073 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0392 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.03 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0358 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] -0.0939 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.7963 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.3018 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.4623 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.7771 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.3635 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 2.6755 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0628 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0536 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0236 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0536 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0037 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.3457 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0236 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.3457 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0665 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '{ A|* }' # _pdbx_entry_details.entry_id 7AFW _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 139 ? A GLY 1 2 1 Y 1 A SER 140 ? A SER 2 3 1 Y 1 A ASN 141 ? A ASN 3 4 1 Y 1 A TYR 142 ? A TYR 4 5 1 Y 1 A GLN 143 ? A GLN 5 6 1 Y 1 A ALA 305 ? A ALA 167 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 R9Q C4 C Y N 290 R9Q C5 C Y N 291 R9Q C6 C Y N 292 R9Q C7 C Y N 293 R9Q C8 C Y N 294 R9Q C13 C Y N 295 R9Q C15 C Y N 296 R9Q C17 C Y N 297 R9Q C20 C N N 298 R9Q C1 C N N 299 R9Q C11 C N N 300 R9Q C12 C N R 301 R9Q C16 C Y N 302 R9Q C18 C Y N 303 R9Q C19 C Y N 304 R9Q C3 C Y N 305 R9Q C9 C N N 306 R9Q N2 N N N 307 R9Q N21 N N N 308 R9Q O10 O N N 309 R9Q O14 O N N 310 R9Q H1 H N N 311 R9Q H2 H N N 312 R9Q H3 H N N 313 R9Q H4 H N N 314 R9Q H5 H N N 315 R9Q H6 H N N 316 R9Q H7 H N N 317 R9Q H8 H N N 318 R9Q H9 H N N 319 R9Q H10 H N N 320 R9Q H11 H N N 321 R9Q H12 H N N 322 R9Q H13 H N N 323 R9Q H14 H N N 324 SER N N N N 325 SER CA C N S 326 SER C C N N 327 SER O O N N 328 SER CB C N N 329 SER OG O N N 330 SER OXT O N N 331 SER H H N N 332 SER H2 H N N 333 SER HA H N N 334 SER HB2 H N N 335 SER HB3 H N N 336 SER HG H N N 337 SER HXT H N N 338 THR N N N N 339 THR CA C N S 340 THR C C N N 341 THR O O N N 342 THR CB C N R 343 THR OG1 O N N 344 THR CG2 C N N 345 THR OXT O N N 346 THR H H N N 347 THR H2 H N N 348 THR HA H N N 349 THR HB H N N 350 THR HG1 H N N 351 THR HG21 H N N 352 THR HG22 H N N 353 THR HG23 H N N 354 THR HXT H N N 355 TYR N N N N 356 TYR CA C N S 357 TYR C C N N 358 TYR O O N N 359 TYR CB C N N 360 TYR CG C Y N 361 TYR CD1 C Y N 362 TYR CD2 C Y N 363 TYR CE1 C Y N 364 TYR CE2 C Y N 365 TYR CZ C Y N 366 TYR OH O N N 367 TYR OXT O N N 368 TYR H H N N 369 TYR H2 H N N 370 TYR HA H N N 371 TYR HB2 H N N 372 TYR HB3 H N N 373 TYR HD1 H N N 374 TYR HD2 H N N 375 TYR HE1 H N N 376 TYR HE2 H N N 377 TYR HH H N N 378 TYR HXT H N N 379 VAL N N N N 380 VAL CA C N S 381 VAL C C N N 382 VAL O O N N 383 VAL CB C N N 384 VAL CG1 C N N 385 VAL CG2 C N N 386 VAL OXT O N N 387 VAL H H N N 388 VAL H2 H N N 389 VAL HA H N N 390 VAL HB H N N 391 VAL HG11 H N N 392 VAL HG12 H N N 393 VAL HG13 H N N 394 VAL HG21 H N N 395 VAL HG22 H N N 396 VAL HG23 H N N 397 VAL HXT H N N 398 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 R9Q C5 C6 doub Y N 277 R9Q C5 C4 sing Y N 278 R9Q C6 C7 sing Y N 279 R9Q C4 C3 doub Y N 280 R9Q C7 O14 sing N N 281 R9Q C7 C8 doub Y N 282 R9Q O14 C12 sing N N 283 R9Q C3 C8 sing Y N 284 R9Q C8 C9 sing N N 285 R9Q C12 C13 sing N N 286 R9Q C12 C11 sing N N 287 R9Q C19 C13 doub Y N 288 R9Q C19 C18 sing Y N 289 R9Q N21 C20 trip N N 290 R9Q C20 C18 sing N N 291 R9Q C9 O10 doub N N 292 R9Q C9 N2 sing N N 293 R9Q C13 C15 sing Y N 294 R9Q C18 C17 doub Y N 295 R9Q C11 N2 sing N N 296 R9Q C15 C16 doub Y N 297 R9Q N2 C1 sing N N 298 R9Q C17 C16 sing Y N 299 R9Q C4 H1 sing N N 300 R9Q C5 H2 sing N N 301 R9Q C6 H3 sing N N 302 R9Q C15 H4 sing N N 303 R9Q C17 H5 sing N N 304 R9Q C1 H6 sing N N 305 R9Q C1 H7 sing N N 306 R9Q C1 H8 sing N N 307 R9Q C11 H9 sing N N 308 R9Q C11 H10 sing N N 309 R9Q C12 H11 sing N N 310 R9Q C16 H12 sing N N 311 R9Q C19 H13 sing N N 312 R9Q C3 H14 sing N N 313 SER N CA sing N N 314 SER N H sing N N 315 SER N H2 sing N N 316 SER CA C sing N N 317 SER CA CB sing N N 318 SER CA HA sing N N 319 SER C O doub N N 320 SER C OXT sing N N 321 SER CB OG sing N N 322 SER CB HB2 sing N N 323 SER CB HB3 sing N N 324 SER OG HG sing N N 325 SER OXT HXT sing N N 326 THR N CA sing N N 327 THR N H sing N N 328 THR N H2 sing N N 329 THR CA C sing N N 330 THR CA CB sing N N 331 THR CA HA sing N N 332 THR C O doub N N 333 THR C OXT sing N N 334 THR CB OG1 sing N N 335 THR CB CG2 sing N N 336 THR CB HB sing N N 337 THR OG1 HG1 sing N N 338 THR CG2 HG21 sing N N 339 THR CG2 HG22 sing N N 340 THR CG2 HG23 sing N N 341 THR OXT HXT sing N N 342 TYR N CA sing N N 343 TYR N H sing N N 344 TYR N H2 sing N N 345 TYR CA C sing N N 346 TYR CA CB sing N N 347 TYR CA HA sing N N 348 TYR C O doub N N 349 TYR C OXT sing N N 350 TYR CB CG sing N N 351 TYR CB HB2 sing N N 352 TYR CB HB3 sing N N 353 TYR CG CD1 doub Y N 354 TYR CG CD2 sing Y N 355 TYR CD1 CE1 sing Y N 356 TYR CD1 HD1 sing N N 357 TYR CD2 CE2 doub Y N 358 TYR CD2 HD2 sing N N 359 TYR CE1 CZ doub Y N 360 TYR CE1 HE1 sing N N 361 TYR CE2 CZ sing Y N 362 TYR CE2 HE2 sing N N 363 TYR CZ OH sing N N 364 TYR OH HH sing N N 365 TYR OXT HXT sing N N 366 VAL N CA sing N N 367 VAL N H sing N N 368 VAL N H2 sing N N 369 VAL CA C sing N N 370 VAL CA CB sing N N 371 VAL CA HA sing N N 372 VAL C O doub N N 373 VAL C OXT sing N N 374 VAL CB CG1 sing N N 375 VAL CB CG2 sing N N 376 VAL CB HB sing N N 377 VAL CG1 HG11 sing N N 378 VAL CG1 HG12 sing N N 379 VAL CG1 HG13 sing N N 380 VAL CG2 HG21 sing N N 381 VAL CG2 HG22 sing N N 382 VAL CG2 HG23 sing N N 383 VAL OXT HXT sing N N 384 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id R9Q _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id R9Q _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3SLA _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7AFW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.018708 _atom_sites.fract_transf_matrix[1][2] 0.010801 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021602 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011423 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_