data_7AIK
# 
_entry.id   7AIK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.384 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7AIK         pdb_00007aik 10.2210/pdb7aik/pdb 
WWPDB D_1292111381 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2021-11-03 
2 'Structure model' 1 1 2022-04-20 
3 'Structure model' 1 2 2024-01-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'        
2 2 'Structure model' 'Database references'    
3 2 'Structure model' 'Refinement description' 
4 3 'Structure model' 'Data collection'        
5 3 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                      
2 2 'Structure model' citation_author               
3 2 'Structure model' diffrn_source                 
4 2 'Structure model' refine                        
5 3 'Structure model' chem_comp_atom                
6 3 'Structure model' chem_comp_bond                
7 3 'Structure model' pdbx_initial_refinement_model 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                    
2  2 'Structure model' '_citation.journal_abbrev'             
3  2 'Structure model' '_citation.journal_id_ASTM'            
4  2 'Structure model' '_citation.journal_id_CSD'             
5  2 'Structure model' '_citation.journal_id_ISSN'            
6  2 'Structure model' '_citation.journal_volume'             
7  2 'Structure model' '_citation.page_first'                 
8  2 'Structure model' '_citation.page_last'                  
9  2 'Structure model' '_citation.pdbx_database_id_DOI'       
10 2 'Structure model' '_citation.pdbx_database_id_PubMed'    
11 2 'Structure model' '_citation.title'                      
12 2 'Structure model' '_citation.year'                       
13 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 
14 2 'Structure model' '_refine.pdbx_diffrn_id'               
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7AIK 
_pdbx_database_status.recvd_initial_deposition_date   2020-09-27 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_pdbx_contact_author.id                 2 
_pdbx_contact_author.email              stenmark@dbb.su.se 
_pdbx_contact_author.name_first         Pal 
_pdbx_contact_author.name_last          Stenmark 
_pdbx_contact_author.name_mi            ? 
_pdbx_contact_author.role               'principal investigator/group leader' 
_pdbx_contact_author.identifier_ORCID   0000-0003-4777-3417 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Rehling, D.'    1 ? 
'Scaletti, E.R.' 2 ? 
'Stenmark, P.'   3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Biochemistry 
_citation.journal_id_ASTM           BICHAW 
_citation.journal_id_CSD            0033 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            61 
_citation.language                  ? 
_citation.page_first                92 
_citation.page_last                 106 
_citation.title                     
'Structural and Biochemical Investigation of Class I Ribonucleotide Reductase from the Hyperthermophile Aquifex aeolicus.' 
_citation.year                      2022 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.biochem.1c00503 
_citation.pdbx_database_id_PubMed   34941255 
_citation.pdbx_database_id_patent   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Rehling, D.'         1 ?                   
primary 'Scaletti, E.R.'      2 ?                   
primary 'Rozman Grinberg, I.' 3 ?                   
primary 'Lundin, D.'          4 ?                   
primary 'Sahlin, M.'          5 ?                   
primary 'Hofer, A.'           6 ?                   
primary 'Sjoberg, B.M.'       7 ?                   
primary 'Stenmark, P.'        8 0000-0003-4777-3417 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ribonucleoside-diphosphate reductase subunit beta,Ribonucleoside-diphosphate reductase subunit beta' 38619.000 
1   1.17.4.1,1.17.4.1 ? ? ? 
2 non-polymer syn 'FE (II) ION'                                                                                         55.845    
2   ?                 ? ? ? 
3 water       nat water                                                                                                 18.015    
111 ?                 ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Ribonucleotide reductase small subunit,Ribonucleotide reductase small subunit' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;NELVRKLIFNPQGDREASKRKIIKGNPTNIFELNEIKYSWAFDLYKLMGFTNFWIPEEIQMLEDRKQYETVLSDYEKRAY
ELVLSFLIALDSFQVDMLKEFGRMITAPEVEMAITAQEFQESVHAYSYQFILESVVDPVKADEIYNYWREDERLLERNKV
IAELYNEFIRKPNEENFIKATIGNYILESLYFYSGFAFFYTLGRQGKMRNTVQQIKYINRDELCHVTLFRNIINTLRKEN
PELFTPEIEKWIVEYFKYAVNEEIKWGQYVTQNQILGINDVLIERYIKYLGNLRITQIGFDPIYPEVTENPLKWIDEFRK
I
;
_entity_poly.pdbx_seq_one_letter_code_can   
;NELVRKLIFNPQGDREASKRKIIKGNPTNIFELNEIKYSWAFDLYKLMGFTNFWIPEEIQMLEDRKQYETVLSDYEKRAY
ELVLSFLIALDSFQVDMLKEFGRMITAPEVEMAITAQEFQESVHAYSYQFILESVVDPVKADEIYNYWREDERLLERNKV
IAELYNEFIRKPNEENFIKATIGNYILESLYFYSGFAFFYTLGRQGKMRNTVQQIKYINRDELCHVTLFRNIINTLRKEN
PELFTPEIEKWIVEYFKYAVNEEIKWGQYVTQNQILGINDVLIERYIKYLGNLRITQIGFDPIYPEVTENPLKWIDEFRK
I
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FE (II) ION' FE2 
3 water         HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASN n 
1 2   GLU n 
1 3   LEU n 
1 4   VAL n 
1 5   ARG n 
1 6   LYS n 
1 7   LEU n 
1 8   ILE n 
1 9   PHE n 
1 10  ASN n 
1 11  PRO n 
1 12  GLN n 
1 13  GLY n 
1 14  ASP n 
1 15  ARG n 
1 16  GLU n 
1 17  ALA n 
1 18  SER n 
1 19  LYS n 
1 20  ARG n 
1 21  LYS n 
1 22  ILE n 
1 23  ILE n 
1 24  LYS n 
1 25  GLY n 
1 26  ASN n 
1 27  PRO n 
1 28  THR n 
1 29  ASN n 
1 30  ILE n 
1 31  PHE n 
1 32  GLU n 
1 33  LEU n 
1 34  ASN n 
1 35  GLU n 
1 36  ILE n 
1 37  LYS n 
1 38  TYR n 
1 39  SER n 
1 40  TRP n 
1 41  ALA n 
1 42  PHE n 
1 43  ASP n 
1 44  LEU n 
1 45  TYR n 
1 46  LYS n 
1 47  LEU n 
1 48  MET n 
1 49  GLY n 
1 50  PHE n 
1 51  THR n 
1 52  ASN n 
1 53  PHE n 
1 54  TRP n 
1 55  ILE n 
1 56  PRO n 
1 57  GLU n 
1 58  GLU n 
1 59  ILE n 
1 60  GLN n 
1 61  MET n 
1 62  LEU n 
1 63  GLU n 
1 64  ASP n 
1 65  ARG n 
1 66  LYS n 
1 67  GLN n 
1 68  TYR n 
1 69  GLU n 
1 70  THR n 
1 71  VAL n 
1 72  LEU n 
1 73  SER n 
1 74  ASP n 
1 75  TYR n 
1 76  GLU n 
1 77  LYS n 
1 78  ARG n 
1 79  ALA n 
1 80  TYR n 
1 81  GLU n 
1 82  LEU n 
1 83  VAL n 
1 84  LEU n 
1 85  SER n 
1 86  PHE n 
1 87  LEU n 
1 88  ILE n 
1 89  ALA n 
1 90  LEU n 
1 91  ASP n 
1 92  SER n 
1 93  PHE n 
1 94  GLN n 
1 95  VAL n 
1 96  ASP n 
1 97  MET n 
1 98  LEU n 
1 99  LYS n 
1 100 GLU n 
1 101 PHE n 
1 102 GLY n 
1 103 ARG n 
1 104 MET n 
1 105 ILE n 
1 106 THR n 
1 107 ALA n 
1 108 PRO n 
1 109 GLU n 
1 110 VAL n 
1 111 GLU n 
1 112 MET n 
1 113 ALA n 
1 114 ILE n 
1 115 THR n 
1 116 ALA n 
1 117 GLN n 
1 118 GLU n 
1 119 PHE n 
1 120 GLN n 
1 121 GLU n 
1 122 SER n 
1 123 VAL n 
1 124 HIS n 
1 125 ALA n 
1 126 TYR n 
1 127 SER n 
1 128 TYR n 
1 129 GLN n 
1 130 PHE n 
1 131 ILE n 
1 132 LEU n 
1 133 GLU n 
1 134 SER n 
1 135 VAL n 
1 136 VAL n 
1 137 ASP n 
1 138 PRO n 
1 139 VAL n 
1 140 LYS n 
1 141 ALA n 
1 142 ASP n 
1 143 GLU n 
1 144 ILE n 
1 145 TYR n 
1 146 ASN n 
1 147 TYR n 
1 148 TRP n 
1 149 ARG n 
1 150 GLU n 
1 151 ASP n 
1 152 GLU n 
1 153 ARG n 
1 154 LEU n 
1 155 LEU n 
1 156 GLU n 
1 157 ARG n 
1 158 ASN n 
1 159 LYS n 
1 160 VAL n 
1 161 ILE n 
1 162 ALA n 
1 163 GLU n 
1 164 LEU n 
1 165 TYR n 
1 166 ASN n 
1 167 GLU n 
1 168 PHE n 
1 169 ILE n 
1 170 ARG n 
1 171 LYS n 
1 172 PRO n 
1 173 ASN n 
1 174 GLU n 
1 175 GLU n 
1 176 ASN n 
1 177 PHE n 
1 178 ILE n 
1 179 LYS n 
1 180 ALA n 
1 181 THR n 
1 182 ILE n 
1 183 GLY n 
1 184 ASN n 
1 185 TYR n 
1 186 ILE n 
1 187 LEU n 
1 188 GLU n 
1 189 SER n 
1 190 LEU n 
1 191 TYR n 
1 192 PHE n 
1 193 TYR n 
1 194 SER n 
1 195 GLY n 
1 196 PHE n 
1 197 ALA n 
1 198 PHE n 
1 199 PHE n 
1 200 TYR n 
1 201 THR n 
1 202 LEU n 
1 203 GLY n 
1 204 ARG n 
1 205 GLN n 
1 206 GLY n 
1 207 LYS n 
1 208 MET n 
1 209 ARG n 
1 210 ASN n 
1 211 THR n 
1 212 VAL n 
1 213 GLN n 
1 214 GLN n 
1 215 ILE n 
1 216 LYS n 
1 217 TYR n 
1 218 ILE n 
1 219 ASN n 
1 220 ARG n 
1 221 ASP n 
1 222 GLU n 
1 223 LEU n 
1 224 CYS n 
1 225 HIS n 
1 226 VAL n 
1 227 THR n 
1 228 LEU n 
1 229 PHE n 
1 230 ARG n 
1 231 ASN n 
1 232 ILE n 
1 233 ILE n 
1 234 ASN n 
1 235 THR n 
1 236 LEU n 
1 237 ARG n 
1 238 LYS n 
1 239 GLU n 
1 240 ASN n 
1 241 PRO n 
1 242 GLU n 
1 243 LEU n 
1 244 PHE n 
1 245 THR n 
1 246 PRO n 
1 247 GLU n 
1 248 ILE n 
1 249 GLU n 
1 250 LYS n 
1 251 TRP n 
1 252 ILE n 
1 253 VAL n 
1 254 GLU n 
1 255 TYR n 
1 256 PHE n 
1 257 LYS n 
1 258 TYR n 
1 259 ALA n 
1 260 VAL n 
1 261 ASN n 
1 262 GLU n 
1 263 GLU n 
1 264 ILE n 
1 265 LYS n 
1 266 TRP n 
1 267 GLY n 
1 268 GLN n 
1 269 TYR n 
1 270 VAL n 
1 271 THR n 
1 272 GLN n 
1 273 ASN n 
1 274 GLN n 
1 275 ILE n 
1 276 LEU n 
1 277 GLY n 
1 278 ILE n 
1 279 ASN n 
1 280 ASP n 
1 281 VAL n 
1 282 LEU n 
1 283 ILE n 
1 284 GLU n 
1 285 ARG n 
1 286 TYR n 
1 287 ILE n 
1 288 LYS n 
1 289 TYR n 
1 290 LEU n 
1 291 GLY n 
1 292 ASN n 
1 293 LEU n 
1 294 ARG n 
1 295 ILE n 
1 296 THR n 
1 297 GLN n 
1 298 ILE n 
1 299 GLY n 
1 300 PHE n 
1 301 ASP n 
1 302 PRO n 
1 303 ILE n 
1 304 TYR n 
1 305 PRO n 
1 306 GLU n 
1 307 VAL n 
1 308 THR n 
1 309 GLU n 
1 310 ASN n 
1 311 PRO n 
1 312 LEU n 
1 313 LYS n 
1 314 TRP n 
1 315 ILE n 
1 316 ASP n 
1 317 GLU n 
1 318 PHE n 
1 319 ARG n 
1 320 LYS n 
1 321 ILE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   224 ? ? 'nrdB, aq_1505' ? ? ? ? ? ? 'Aquifex aeolicus VF5' 224324 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 225 321 ? ? 'nrdB, aq_1505' ? ? ? ? ? ? 'Aquifex aeolicus VF5' 224324 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
FE2 non-polymer         . 'FE (II) ION'   ? 'Fe 2'           55.845  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASN 1   7   7   ASN ASN A . n 
A 1 2   GLU 2   8   8   GLU GLU A . n 
A 1 3   LEU 3   9   9   LEU LEU A . n 
A 1 4   VAL 4   10  10  VAL VAL A . n 
A 1 5   ARG 5   11  11  ARG ARG A . n 
A 1 6   LYS 6   12  12  LYS LYS A . n 
A 1 7   LEU 7   13  13  LEU LEU A . n 
A 1 8   ILE 8   14  14  ILE ILE A . n 
A 1 9   PHE 9   15  15  PHE PHE A . n 
A 1 10  ASN 10  16  16  ASN ASN A . n 
A 1 11  PRO 11  17  17  PRO PRO A . n 
A 1 12  GLN 12  18  18  GLN GLN A . n 
A 1 13  GLY 13  19  19  GLY GLY A . n 
A 1 14  ASP 14  20  20  ASP ASP A . n 
A 1 15  ARG 15  21  21  ARG ARG A . n 
A 1 16  GLU 16  22  22  GLU GLU A . n 
A 1 17  ALA 17  23  23  ALA ALA A . n 
A 1 18  SER 18  24  24  SER SER A . n 
A 1 19  LYS 19  25  25  LYS LYS A . n 
A 1 20  ARG 20  26  26  ARG ARG A . n 
A 1 21  LYS 21  27  27  LYS LYS A . n 
A 1 22  ILE 22  28  28  ILE ILE A . n 
A 1 23  ILE 23  29  29  ILE ILE A . n 
A 1 24  LYS 24  30  30  LYS LYS A . n 
A 1 25  GLY 25  31  31  GLY GLY A . n 
A 1 26  ASN 26  32  32  ASN ASN A . n 
A 1 27  PRO 27  33  33  PRO PRO A . n 
A 1 28  THR 28  34  34  THR THR A . n 
A 1 29  ASN 29  35  35  ASN ASN A . n 
A 1 30  ILE 30  36  36  ILE ILE A . n 
A 1 31  PHE 31  37  37  PHE PHE A . n 
A 1 32  GLU 32  38  38  GLU GLU A . n 
A 1 33  LEU 33  39  39  LEU LEU A . n 
A 1 34  ASN 34  40  40  ASN ASN A . n 
A 1 35  GLU 35  41  41  GLU GLU A . n 
A 1 36  ILE 36  42  42  ILE ILE A . n 
A 1 37  LYS 37  43  43  LYS LYS A . n 
A 1 38  TYR 38  44  44  TYR TYR A . n 
A 1 39  SER 39  45  45  SER SER A . n 
A 1 40  TRP 40  46  46  TRP TRP A . n 
A 1 41  ALA 41  47  47  ALA ALA A . n 
A 1 42  PHE 42  48  48  PHE PHE A . n 
A 1 43  ASP 43  49  49  ASP ASP A . n 
A 1 44  LEU 44  50  50  LEU LEU A . n 
A 1 45  TYR 45  51  51  TYR TYR A . n 
A 1 46  LYS 46  52  52  LYS LYS A . n 
A 1 47  LEU 47  53  53  LEU LEU A . n 
A 1 48  MET 48  54  54  MET MET A . n 
A 1 49  GLY 49  55  55  GLY GLY A . n 
A 1 50  PHE 50  56  56  PHE PHE A . n 
A 1 51  THR 51  57  57  THR THR A . n 
A 1 52  ASN 52  58  58  ASN ASN A . n 
A 1 53  PHE 53  59  59  PHE PHE A . n 
A 1 54  TRP 54  60  60  TRP TRP A . n 
A 1 55  ILE 55  61  61  ILE ILE A . n 
A 1 56  PRO 56  62  62  PRO PRO A . n 
A 1 57  GLU 57  63  63  GLU GLU A . n 
A 1 58  GLU 58  64  64  GLU GLU A . n 
A 1 59  ILE 59  65  65  ILE ILE A . n 
A 1 60  GLN 60  66  66  GLN GLN A . n 
A 1 61  MET 61  67  67  MET MET A . n 
A 1 62  LEU 62  68  68  LEU LEU A . n 
A 1 63  GLU 63  69  69  GLU GLU A . n 
A 1 64  ASP 64  70  70  ASP ASP A . n 
A 1 65  ARG 65  71  71  ARG ARG A . n 
A 1 66  LYS 66  72  72  LYS LYS A . n 
A 1 67  GLN 67  73  73  GLN GLN A . n 
A 1 68  TYR 68  74  74  TYR TYR A . n 
A 1 69  GLU 69  75  75  GLU GLU A . n 
A 1 70  THR 70  76  76  THR THR A . n 
A 1 71  VAL 71  77  77  VAL VAL A . n 
A 1 72  LEU 72  78  78  LEU LEU A . n 
A 1 73  SER 73  79  79  SER SER A . n 
A 1 74  ASP 74  80  80  ASP ASP A . n 
A 1 75  TYR 75  81  81  TYR TYR A . n 
A 1 76  GLU 76  82  82  GLU GLU A . n 
A 1 77  LYS 77  83  83  LYS LYS A . n 
A 1 78  ARG 78  84  84  ARG ARG A . n 
A 1 79  ALA 79  85  85  ALA ALA A . n 
A 1 80  TYR 80  86  86  TYR TYR A . n 
A 1 81  GLU 81  87  87  GLU GLU A . n 
A 1 82  LEU 82  88  88  LEU LEU A . n 
A 1 83  VAL 83  89  89  VAL VAL A . n 
A 1 84  LEU 84  90  90  LEU LEU A . n 
A 1 85  SER 85  91  91  SER SER A . n 
A 1 86  PHE 86  92  92  PHE PHE A . n 
A 1 87  LEU 87  93  93  LEU LEU A . n 
A 1 88  ILE 88  94  94  ILE ILE A . n 
A 1 89  ALA 89  95  95  ALA ALA A . n 
A 1 90  LEU 90  96  96  LEU LEU A . n 
A 1 91  ASP 91  97  97  ASP ASP A . n 
A 1 92  SER 92  98  98  SER SER A . n 
A 1 93  PHE 93  99  99  PHE PHE A . n 
A 1 94  GLN 94  100 100 GLN GLN A . n 
A 1 95  VAL 95  101 101 VAL VAL A . n 
A 1 96  ASP 96  102 102 ASP ASP A . n 
A 1 97  MET 97  103 103 MET MET A . n 
A 1 98  LEU 98  104 104 LEU LEU A . n 
A 1 99  LYS 99  105 105 LYS LYS A . n 
A 1 100 GLU 100 106 106 GLU GLU A . n 
A 1 101 PHE 101 107 107 PHE PHE A . n 
A 1 102 GLY 102 108 108 GLY GLY A . n 
A 1 103 ARG 103 109 109 ARG ARG A . n 
A 1 104 MET 104 110 110 MET MET A . n 
A 1 105 ILE 105 111 111 ILE ILE A . n 
A 1 106 THR 106 112 112 THR THR A . n 
A 1 107 ALA 107 113 113 ALA ALA A . n 
A 1 108 PRO 108 114 114 PRO PRO A . n 
A 1 109 GLU 109 115 115 GLU GLU A . n 
A 1 110 VAL 110 116 116 VAL VAL A . n 
A 1 111 GLU 111 117 117 GLU GLU A . n 
A 1 112 MET 112 118 118 MET MET A . n 
A 1 113 ALA 113 119 119 ALA ALA A . n 
A 1 114 ILE 114 120 120 ILE ILE A . n 
A 1 115 THR 115 121 121 THR THR A . n 
A 1 116 ALA 116 122 122 ALA ALA A . n 
A 1 117 GLN 117 123 123 GLN GLN A . n 
A 1 118 GLU 118 124 124 GLU GLU A . n 
A 1 119 PHE 119 125 125 PHE PHE A . n 
A 1 120 GLN 120 126 126 GLN GLN A . n 
A 1 121 GLU 121 127 127 GLU GLU A . n 
A 1 122 SER 122 128 128 SER SER A . n 
A 1 123 VAL 123 129 129 VAL VAL A . n 
A 1 124 HIS 124 130 130 HIS HIS A . n 
A 1 125 ALA 125 131 131 ALA ALA A . n 
A 1 126 TYR 126 132 132 TYR TYR A . n 
A 1 127 SER 127 133 133 SER SER A . n 
A 1 128 TYR 128 134 134 TYR TYR A . n 
A 1 129 GLN 129 135 135 GLN GLN A . n 
A 1 130 PHE 130 136 136 PHE PHE A . n 
A 1 131 ILE 131 137 137 ILE ILE A . n 
A 1 132 LEU 132 138 138 LEU LEU A . n 
A 1 133 GLU 133 139 139 GLU GLU A . n 
A 1 134 SER 134 140 140 SER SER A . n 
A 1 135 VAL 135 141 141 VAL VAL A . n 
A 1 136 VAL 136 142 142 VAL VAL A . n 
A 1 137 ASP 137 143 143 ASP ASP A . n 
A 1 138 PRO 138 144 144 PRO PRO A . n 
A 1 139 VAL 139 145 145 VAL VAL A . n 
A 1 140 LYS 140 146 146 LYS LYS A . n 
A 1 141 ALA 141 147 147 ALA ALA A . n 
A 1 142 ASP 142 148 148 ASP ASP A . n 
A 1 143 GLU 143 149 149 GLU GLU A . n 
A 1 144 ILE 144 150 150 ILE ILE A . n 
A 1 145 TYR 145 151 151 TYR TYR A . n 
A 1 146 ASN 146 152 152 ASN ASN A . n 
A 1 147 TYR 147 153 153 TYR TYR A . n 
A 1 148 TRP 148 154 154 TRP TRP A . n 
A 1 149 ARG 149 155 155 ARG ARG A . n 
A 1 150 GLU 150 156 156 GLU GLU A . n 
A 1 151 ASP 151 157 157 ASP ASP A . n 
A 1 152 GLU 152 158 158 GLU GLU A . n 
A 1 153 ARG 153 159 159 ARG ARG A . n 
A 1 154 LEU 154 160 160 LEU LEU A . n 
A 1 155 LEU 155 161 161 LEU LEU A . n 
A 1 156 GLU 156 162 162 GLU GLU A . n 
A 1 157 ARG 157 163 163 ARG ARG A . n 
A 1 158 ASN 158 164 164 ASN ASN A . n 
A 1 159 LYS 159 165 165 LYS LYS A . n 
A 1 160 VAL 160 166 166 VAL VAL A . n 
A 1 161 ILE 161 167 167 ILE ILE A . n 
A 1 162 ALA 162 168 168 ALA ALA A . n 
A 1 163 GLU 163 169 169 GLU GLU A . n 
A 1 164 LEU 164 170 170 LEU LEU A . n 
A 1 165 TYR 165 171 171 TYR TYR A . n 
A 1 166 ASN 166 172 172 ASN ASN A . n 
A 1 167 GLU 167 173 173 GLU GLU A . n 
A 1 168 PHE 168 174 174 PHE PHE A . n 
A 1 169 ILE 169 175 175 ILE ILE A . n 
A 1 170 ARG 170 176 176 ARG ARG A . n 
A 1 171 LYS 171 177 177 LYS LYS A . n 
A 1 172 PRO 172 178 178 PRO PRO A . n 
A 1 173 ASN 173 179 179 ASN ASN A . n 
A 1 174 GLU 174 180 180 GLU GLU A . n 
A 1 175 GLU 175 181 181 GLU GLU A . n 
A 1 176 ASN 176 182 182 ASN ASN A . n 
A 1 177 PHE 177 183 183 PHE PHE A . n 
A 1 178 ILE 178 184 184 ILE ILE A . n 
A 1 179 LYS 179 185 185 LYS LYS A . n 
A 1 180 ALA 180 186 186 ALA ALA A . n 
A 1 181 THR 181 187 187 THR THR A . n 
A 1 182 ILE 182 188 188 ILE ILE A . n 
A 1 183 GLY 183 189 189 GLY GLY A . n 
A 1 184 ASN 184 190 190 ASN ASN A . n 
A 1 185 TYR 185 191 191 TYR TYR A . n 
A 1 186 ILE 186 192 192 ILE ILE A . n 
A 1 187 LEU 187 193 193 LEU LEU A . n 
A 1 188 GLU 188 194 194 GLU GLU A . n 
A 1 189 SER 189 195 195 SER SER A . n 
A 1 190 LEU 190 196 196 LEU LEU A . n 
A 1 191 TYR 191 197 197 TYR TYR A . n 
A 1 192 PHE 192 198 198 PHE PHE A . n 
A 1 193 TYR 193 199 199 TYR TYR A . n 
A 1 194 SER 194 200 200 SER SER A . n 
A 1 195 GLY 195 201 201 GLY GLY A . n 
A 1 196 PHE 196 202 202 PHE PHE A . n 
A 1 197 ALA 197 203 203 ALA ALA A . n 
A 1 198 PHE 198 204 204 PHE PHE A . n 
A 1 199 PHE 199 205 205 PHE PHE A . n 
A 1 200 TYR 200 206 206 TYR TYR A . n 
A 1 201 THR 201 207 207 THR THR A . n 
A 1 202 LEU 202 208 208 LEU LEU A . n 
A 1 203 GLY 203 209 209 GLY GLY A . n 
A 1 204 ARG 204 210 210 ARG ARG A . n 
A 1 205 GLN 205 211 211 GLN GLN A . n 
A 1 206 GLY 206 212 212 GLY GLY A . n 
A 1 207 LYS 207 213 213 LYS LYS A . n 
A 1 208 MET 208 214 214 MET MET A . n 
A 1 209 ARG 209 215 215 ARG ARG A . n 
A 1 210 ASN 210 216 216 ASN ASN A . n 
A 1 211 THR 211 217 217 THR THR A . n 
A 1 212 VAL 212 218 218 VAL VAL A . n 
A 1 213 GLN 213 219 219 GLN GLN A . n 
A 1 214 GLN 214 220 220 GLN GLN A . n 
A 1 215 ILE 215 221 221 ILE ILE A . n 
A 1 216 LYS 216 222 222 LYS LYS A . n 
A 1 217 TYR 217 223 223 TYR TYR A . n 
A 1 218 ILE 218 224 224 ILE ILE A . n 
A 1 219 ASN 219 225 225 ASN ASN A . n 
A 1 220 ARG 220 226 226 ARG ARG A . n 
A 1 221 ASP 221 227 227 ASP ASP A . n 
A 1 222 GLU 222 228 228 GLU GLU A . n 
A 1 223 LEU 223 229 229 LEU LEU A . n 
A 1 224 CYS 224 230 230 CYS CYS A . n 
A 1 225 HIS 225 231 231 HIS HIS A . n 
A 1 226 VAL 226 232 232 VAL VAL A . n 
A 1 227 THR 227 233 233 THR THR A . n 
A 1 228 LEU 228 234 234 LEU LEU A . n 
A 1 229 PHE 229 235 235 PHE PHE A . n 
A 1 230 ARG 230 236 236 ARG ARG A . n 
A 1 231 ASN 231 237 237 ASN ASN A . n 
A 1 232 ILE 232 238 238 ILE ILE A . n 
A 1 233 ILE 233 239 239 ILE ILE A . n 
A 1 234 ASN 234 240 240 ASN ASN A . n 
A 1 235 THR 235 241 241 THR THR A . n 
A 1 236 LEU 236 242 242 LEU LEU A . n 
A 1 237 ARG 237 243 243 ARG ARG A . n 
A 1 238 LYS 238 244 244 LYS LYS A . n 
A 1 239 GLU 239 245 245 GLU GLU A . n 
A 1 240 ASN 240 246 246 ASN ASN A . n 
A 1 241 PRO 241 247 247 PRO PRO A . n 
A 1 242 GLU 242 248 248 GLU GLU A . n 
A 1 243 LEU 243 249 249 LEU LEU A . n 
A 1 244 PHE 244 250 250 PHE PHE A . n 
A 1 245 THR 245 251 251 THR THR A . n 
A 1 246 PRO 246 252 252 PRO PRO A . n 
A 1 247 GLU 247 253 253 GLU GLU A . n 
A 1 248 ILE 248 254 254 ILE ILE A . n 
A 1 249 GLU 249 255 255 GLU GLU A . n 
A 1 250 LYS 250 256 256 LYS LYS A . n 
A 1 251 TRP 251 257 257 TRP TRP A . n 
A 1 252 ILE 252 258 258 ILE ILE A . n 
A 1 253 VAL 253 259 259 VAL VAL A . n 
A 1 254 GLU 254 260 260 GLU GLU A . n 
A 1 255 TYR 255 261 261 TYR TYR A . n 
A 1 256 PHE 256 262 262 PHE PHE A . n 
A 1 257 LYS 257 263 263 LYS LYS A . n 
A 1 258 TYR 258 264 264 TYR TYR A . n 
A 1 259 ALA 259 265 265 ALA ALA A . n 
A 1 260 VAL 260 266 266 VAL VAL A . n 
A 1 261 ASN 261 267 267 ASN ASN A . n 
A 1 262 GLU 262 268 268 GLU GLU A . n 
A 1 263 GLU 263 269 269 GLU GLU A . n 
A 1 264 ILE 264 270 270 ILE ILE A . n 
A 1 265 LYS 265 271 271 LYS LYS A . n 
A 1 266 TRP 266 272 272 TRP TRP A . n 
A 1 267 GLY 267 273 273 GLY GLY A . n 
A 1 268 GLN 268 274 274 GLN GLN A . n 
A 1 269 TYR 269 275 275 TYR TYR A . n 
A 1 270 VAL 270 276 276 VAL VAL A . n 
A 1 271 THR 271 277 277 THR THR A . n 
A 1 272 GLN 272 278 278 GLN GLN A . n 
A 1 273 ASN 273 279 279 ASN ASN A . n 
A 1 274 GLN 274 280 280 GLN GLN A . n 
A 1 275 ILE 275 281 281 ILE ILE A . n 
A 1 276 LEU 276 282 282 LEU LEU A . n 
A 1 277 GLY 277 283 283 GLY GLY A . n 
A 1 278 ILE 278 284 284 ILE ILE A . n 
A 1 279 ASN 279 285 285 ASN ASN A . n 
A 1 280 ASP 280 286 286 ASP ASP A . n 
A 1 281 VAL 281 287 287 VAL VAL A . n 
A 1 282 LEU 282 288 288 LEU LEU A . n 
A 1 283 ILE 283 289 289 ILE ILE A . n 
A 1 284 GLU 284 290 290 GLU GLU A . n 
A 1 285 ARG 285 291 291 ARG ARG A . n 
A 1 286 TYR 286 292 292 TYR TYR A . n 
A 1 287 ILE 287 293 293 ILE ILE A . n 
A 1 288 LYS 288 294 294 LYS LYS A . n 
A 1 289 TYR 289 295 295 TYR TYR A . n 
A 1 290 LEU 290 296 296 LEU LEU A . n 
A 1 291 GLY 291 297 297 GLY GLY A . n 
A 1 292 ASN 292 298 298 ASN ASN A . n 
A 1 293 LEU 293 299 299 LEU LEU A . n 
A 1 294 ARG 294 300 300 ARG ARG A . n 
A 1 295 ILE 295 301 301 ILE ILE A . n 
A 1 296 THR 296 302 302 THR THR A . n 
A 1 297 GLN 297 303 303 GLN GLN A . n 
A 1 298 ILE 298 304 304 ILE ILE A . n 
A 1 299 GLY 299 305 305 GLY GLY A . n 
A 1 300 PHE 300 306 306 PHE PHE A . n 
A 1 301 ASP 301 307 307 ASP ASP A . n 
A 1 302 PRO 302 308 308 PRO PRO A . n 
A 1 303 ILE 303 309 309 ILE ILE A . n 
A 1 304 TYR 304 310 310 TYR TYR A . n 
A 1 305 PRO 305 311 311 PRO PRO A . n 
A 1 306 GLU 306 312 312 GLU GLU A . n 
A 1 307 VAL 307 313 313 VAL VAL A . n 
A 1 308 THR 308 314 314 THR THR A . n 
A 1 309 GLU 309 315 315 GLU GLU A . n 
A 1 310 ASN 310 316 316 ASN ASN A . n 
A 1 311 PRO 311 317 317 PRO PRO A . n 
A 1 312 LEU 312 318 318 LEU LEU A . n 
A 1 313 LYS 313 319 319 LYS LYS A . n 
A 1 314 TRP 314 320 320 TRP TRP A . n 
A 1 315 ILE 315 321 321 ILE ILE A . n 
A 1 316 ASP 316 322 322 ASP ASP A . n 
A 1 317 GLU 317 323 323 GLU GLU A . n 
A 1 318 PHE 318 324 324 PHE PHE A . n 
A 1 319 ARG 319 325 325 ARG ARG A . n 
A 1 320 LYS 320 326 326 LYS LYS A . n 
A 1 321 ILE 321 327 327 ILE ILE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 FE2 1   401 401 FE2 FE2 A . 
C 2 FE2 1   402 501 FE2 FE2 A . 
D 3 HOH 1   501 63  HOH HOH A . 
D 3 HOH 2   502 84  HOH HOH A . 
D 3 HOH 3   503 82  HOH HOH A . 
D 3 HOH 4   504 83  HOH HOH A . 
D 3 HOH 5   505 31  HOH HOH A . 
D 3 HOH 6   506 90  HOH HOH A . 
D 3 HOH 7   507 49  HOH HOH A . 
D 3 HOH 8   508 57  HOH HOH A . 
D 3 HOH 9   509 7   HOH HOH A . 
D 3 HOH 10  510 56  HOH HOH A . 
D 3 HOH 11  511 79  HOH HOH A . 
D 3 HOH 12  512 6   HOH HOH A . 
D 3 HOH 13  513 88  HOH HOH A . 
D 3 HOH 14  514 39  HOH HOH A . 
D 3 HOH 15  515 101 HOH HOH A . 
D 3 HOH 16  516 74  HOH HOH A . 
D 3 HOH 17  517 108 HOH HOH A . 
D 3 HOH 18  518 12  HOH HOH A . 
D 3 HOH 19  519 14  HOH HOH A . 
D 3 HOH 20  520 27  HOH HOH A . 
D 3 HOH 21  521 17  HOH HOH A . 
D 3 HOH 22  522 53  HOH HOH A . 
D 3 HOH 23  523 8   HOH HOH A . 
D 3 HOH 24  524 1   HOH HOH A . 
D 3 HOH 25  525 106 HOH HOH A . 
D 3 HOH 26  526 15  HOH HOH A . 
D 3 HOH 27  527 3   HOH HOH A . 
D 3 HOH 28  528 34  HOH HOH A . 
D 3 HOH 29  529 51  HOH HOH A . 
D 3 HOH 30  530 5   HOH HOH A . 
D 3 HOH 31  531 40  HOH HOH A . 
D 3 HOH 32  532 92  HOH HOH A . 
D 3 HOH 33  533 47  HOH HOH A . 
D 3 HOH 34  534 36  HOH HOH A . 
D 3 HOH 35  535 9   HOH HOH A . 
D 3 HOH 36  536 11  HOH HOH A . 
D 3 HOH 37  537 97  HOH HOH A . 
D 3 HOH 38  538 70  HOH HOH A . 
D 3 HOH 39  539 20  HOH HOH A . 
D 3 HOH 40  540 103 HOH HOH A . 
D 3 HOH 41  541 26  HOH HOH A . 
D 3 HOH 42  542 50  HOH HOH A . 
D 3 HOH 43  543 38  HOH HOH A . 
D 3 HOH 44  544 58  HOH HOH A . 
D 3 HOH 45  545 60  HOH HOH A . 
D 3 HOH 46  546 35  HOH HOH A . 
D 3 HOH 47  547 19  HOH HOH A . 
D 3 HOH 48  548 4   HOH HOH A . 
D 3 HOH 49  549 2   HOH HOH A . 
D 3 HOH 50  550 33  HOH HOH A . 
D 3 HOH 51  551 95  HOH HOH A . 
D 3 HOH 52  552 22  HOH HOH A . 
D 3 HOH 53  553 109 HOH HOH A . 
D 3 HOH 54  554 105 HOH HOH A . 
D 3 HOH 55  555 23  HOH HOH A . 
D 3 HOH 56  556 75  HOH HOH A . 
D 3 HOH 57  557 77  HOH HOH A . 
D 3 HOH 58  558 87  HOH HOH A . 
D 3 HOH 59  559 55  HOH HOH A . 
D 3 HOH 60  560 54  HOH HOH A . 
D 3 HOH 61  561 37  HOH HOH A . 
D 3 HOH 62  562 28  HOH HOH A . 
D 3 HOH 63  563 93  HOH HOH A . 
D 3 HOH 64  564 43  HOH HOH A . 
D 3 HOH 65  565 85  HOH HOH A . 
D 3 HOH 66  566 48  HOH HOH A . 
D 3 HOH 67  567 25  HOH HOH A . 
D 3 HOH 68  568 110 HOH HOH A . 
D 3 HOH 69  569 21  HOH HOH A . 
D 3 HOH 70  570 78  HOH HOH A . 
D 3 HOH 71  571 41  HOH HOH A . 
D 3 HOH 72  572 86  HOH HOH A . 
D 3 HOH 73  573 13  HOH HOH A . 
D 3 HOH 74  574 94  HOH HOH A . 
D 3 HOH 75  575 98  HOH HOH A . 
D 3 HOH 76  576 42  HOH HOH A . 
D 3 HOH 77  577 29  HOH HOH A . 
D 3 HOH 78  578 46  HOH HOH A . 
D 3 HOH 79  579 18  HOH HOH A . 
D 3 HOH 80  580 80  HOH HOH A . 
D 3 HOH 81  581 10  HOH HOH A . 
D 3 HOH 82  582 67  HOH HOH A . 
D 3 HOH 83  583 112 HOH HOH A . 
D 3 HOH 84  584 73  HOH HOH A . 
D 3 HOH 85  585 102 HOH HOH A . 
D 3 HOH 86  586 59  HOH HOH A . 
D 3 HOH 87  587 104 HOH HOH A . 
D 3 HOH 88  588 32  HOH HOH A . 
D 3 HOH 89  589 69  HOH HOH A . 
D 3 HOH 90  590 24  HOH HOH A . 
D 3 HOH 91  591 89  HOH HOH A . 
D 3 HOH 92  592 62  HOH HOH A . 
D 3 HOH 93  593 81  HOH HOH A . 
D 3 HOH 94  594 45  HOH HOH A . 
D 3 HOH 95  595 61  HOH HOH A . 
D 3 HOH 96  596 111 HOH HOH A . 
D 3 HOH 97  597 44  HOH HOH A . 
D 3 HOH 98  598 52  HOH HOH A . 
D 3 HOH 99  599 68  HOH HOH A . 
D 3 HOH 100 600 96  HOH HOH A . 
D 3 HOH 101 601 66  HOH HOH A . 
D 3 HOH 102 602 99  HOH HOH A . 
D 3 HOH 103 603 71  HOH HOH A . 
D 3 HOH 104 604 64  HOH HOH A . 
D 3 HOH 105 605 91  HOH HOH A . 
D 3 HOH 106 606 65  HOH HOH A . 
D 3 HOH 107 607 72  HOH HOH A . 
D 3 HOH 108 608 30  HOH HOH A . 
D 3 HOH 109 609 76  HOH HOH A . 
D 3 HOH 110 610 107 HOH HOH A . 
D 3 HOH 111 611 16  HOH HOH A . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC  ? ? ? 5.8.0267 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS   ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .        4 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7AIK 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     69.420 
_cell.length_a_esd                 ? 
_cell.length_b                     69.420 
_cell.length_b_esd                 ? 
_cell.length_c                     177.973 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7AIK 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7AIK 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.58 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         52.24 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M citrate pH 4.0, 1.0 M lithium chloride, 20 % PEG6000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-04-28 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9762 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9762 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate                          ? 
_reflns.entry_id                                       7AIK 
_reflns.data_reduction_details                         ? 
_reflns.data_reduction_method                          ? 
_reflns.d_resolution_high                              2.1 
_reflns.d_resolution_low                               65 
_reflns.details                                        ? 
_reflns.limit_h_max                                    ? 
_reflns.limit_h_min                                    ? 
_reflns.limit_k_max                                    ? 
_reflns.limit_k_min                                    ? 
_reflns.limit_l_max                                    ? 
_reflns.limit_l_min                                    ? 
_reflns.number_all                                     ? 
_reflns.number_obs                                     26676 
_reflns.observed_criterion                             ? 
_reflns.observed_criterion_F_max                       ? 
_reflns.observed_criterion_F_min                       ? 
_reflns.observed_criterion_I_max                       ? 
_reflns.observed_criterion_I_min                       ? 
_reflns.observed_criterion_sigma_F                     ? 
_reflns.observed_criterion_sigma_I                     ? 
_reflns.percent_possible_obs                           100 
_reflns.R_free_details                                 ? 
_reflns.Rmerge_F_all                                   ? 
_reflns.Rmerge_F_obs                                   ? 
_reflns.Friedel_coverage                               ? 
_reflns.number_gt                                      ? 
_reflns.threshold_expression                           ? 
_reflns.pdbx_redundancy                                13.2 
_reflns.pdbx_Rmerge_I_obs                              ? 
_reflns.pdbx_Rmerge_I_all                              ? 
_reflns.pdbx_Rsym_value                                ? 
_reflns.pdbx_netI_over_av_sigmaI                       ? 
_reflns.pdbx_netI_over_sigmaI                          8.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2                 ? 
_reflns.pdbx_res_netI_over_sigmaI_2                    ? 
_reflns.pdbx_chi_squared                               ? 
_reflns.pdbx_scaling_rejects                           ? 
_reflns.pdbx_d_res_high_opt                            ? 
_reflns.pdbx_d_res_low_opt                             ? 
_reflns.pdbx_d_res_opt_method                          ? 
_reflns.phase_calculation_details                      ? 
_reflns.pdbx_Rrim_I_all                                ? 
_reflns.pdbx_Rpim_I_all                                ? 
_reflns.pdbx_d_opt                                     ? 
_reflns.pdbx_number_measured_all                       ? 
_reflns.pdbx_diffrn_id                                 1 
_reflns.pdbx_ordinal                                   1 
_reflns.pdbx_CC_half                                   0.99 
_reflns.pdbx_CC_star                                   ? 
_reflns.pdbx_R_split                                   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2]   ? 
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3]   ? 
_reflns.pdbx_aniso_diffraction_limit_1                 ? 
_reflns.pdbx_aniso_diffraction_limit_2                 ? 
_reflns.pdbx_aniso_diffraction_limit_3                 ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3]     ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_1               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_2               ? 
_reflns.pdbx_aniso_B_tensor_eigenvalue_3               ? 
_reflns.pdbx_orthogonalization_convention              ? 
_reflns.pdbx_percent_possible_ellipsoidal              ? 
_reflns.pdbx_percent_possible_spherical                ? 
_reflns.pdbx_percent_possible_ellipsoidal_anomalous    ? 
_reflns.pdbx_percent_possible_spherical_anomalous      ? 
_reflns.pdbx_redundancy_anomalous                      ? 
_reflns.pdbx_CC_half_anomalous                         ? 
_reflns.pdbx_absDiff_over_sigma_anomalous              ? 
_reflns.pdbx_percent_possible_anomalous                ? 
_reflns.pdbx_observed_signal_threshold                 ? 
_reflns.pdbx_signal_type                               ? 
_reflns.pdbx_signal_details                            ? 
_reflns.pdbx_signal_software_id                        ? 
# 
_reflns_shell.d_res_high                                    2.1 
_reflns_shell.d_res_low                                     2.14 
_reflns_shell.meanI_over_sigI_all                           ? 
_reflns_shell.meanI_over_sigI_obs                           ? 
_reflns_shell.number_measured_all                           ? 
_reflns_shell.number_measured_obs                           ? 
_reflns_shell.number_possible                               ? 
_reflns_shell.number_unique_all                             ? 
_reflns_shell.number_unique_obs                             1295 
_reflns_shell.percent_possible_all                          ? 
_reflns_shell.percent_possible_obs                          ? 
_reflns_shell.Rmerge_F_all                                  ? 
_reflns_shell.Rmerge_F_obs                                  ? 
_reflns_shell.Rmerge_I_all                                  ? 
_reflns_shell.Rmerge_I_obs                                  ? 
_reflns_shell.meanI_over_sigI_gt                            ? 
_reflns_shell.meanI_over_uI_all                             ? 
_reflns_shell.meanI_over_uI_gt                              ? 
_reflns_shell.number_measured_gt                            ? 
_reflns_shell.number_unique_gt                              ? 
_reflns_shell.percent_possible_gt                           ? 
_reflns_shell.Rmerge_F_gt                                   ? 
_reflns_shell.Rmerge_I_gt                                   ? 
_reflns_shell.pdbx_redundancy                               ? 
_reflns_shell.pdbx_Rsym_value                               ? 
_reflns_shell.pdbx_chi_squared                              ? 
_reflns_shell.pdbx_netI_over_sigmaI_all                     ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs                     ? 
_reflns_shell.pdbx_Rrim_I_all                               ? 
_reflns_shell.pdbx_Rpim_I_all                               ? 
_reflns_shell.pdbx_rejects                                  ? 
_reflns_shell.pdbx_ordinal                                  1 
_reflns_shell.pdbx_diffrn_id                                1 
_reflns_shell.pdbx_CC_half                                  0.94 
_reflns_shell.pdbx_CC_star                                  ? 
_reflns_shell.pdbx_R_split                                  ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal             ? 
_reflns_shell.pdbx_percent_possible_spherical               ? 
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous   ? 
_reflns_shell.pdbx_percent_possible_spherical_anomalous     ? 
_reflns_shell.pdbx_redundancy_anomalous                     ? 
_reflns_shell.pdbx_CC_half_anomalous                        ? 
_reflns_shell.pdbx_absDiff_over_sigma_anomalous             ? 
_reflns_shell.pdbx_percent_possible_anomalous               ? 
# 
_refine.aniso_B[1][1]                            1.55 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][2]                            1.55 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            -3.11 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               61.630 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.964 
_refine.correlation_coeff_Fo_to_Fc_free          0.945 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7AIK 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.10 
_refine.ls_d_res_low                             47.37 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     24986 
_refine.ls_number_reflns_R_free                  1309 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.99 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.21948 
_refine.ls_R_factor_R_free                       0.26650 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.21680 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5ci4 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.213 
_refine.pdbx_overall_ESU_R_Free                  0.193 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             8.438 
_refine.overall_SU_ML                            0.205 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        47.37 
_refine_hist.number_atoms_solvent             111 
_refine_hist.number_atoms_total               2844 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        2731 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  0.013  2824 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.017  2672 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.537  1.648  3824 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 1.273  1.577  6141 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.901  5.000  326  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 36.015 22.989 174  ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 18.220 15.000 515  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 19.147 15.000 18   ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.078  0.200  359  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.008  0.020  3194 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  706  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 5.544  6.210  1298 ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 5.545  6.208  1297 ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 7.590  9.295  1626 ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 7.588  9.297  1627 ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 5.740  6.660  1525 ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 5.738  6.661  1526 ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 8.251  9.799  2199 ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 10.319 72.432 3435 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 10.310 72.370 3418 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.100 
_refine_ls_shell.d_res_low                        2.155 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             81 
_refine_ls_shell.number_reflns_R_work             1817 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.420 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.368 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_R_complete                  ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     7AIK 
_struct.title                        'Ribonucleotide Reductase R2 protein from Aquifex aeolicus' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7AIK 
_struct_keywords.text            'allosteric regulation, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RIR2_AQUAE O67475 ? 1 
;NELVRKLIFNPQGDREASKRKIIKGNPTNIFELNEIKYSWAFDLYKLMGFTNFWIPEEIQMLEDRKQYETVLSDYEKRAY
ELVLSFLIALDSFQVDMLKEFGRMITAPEVEMAITAQEFQESVHAYSYQFILESVVDPVKADEIYNYWREDERLLERNKV
IAELYNEFIRKPNEENFIKATIGNYILESLYFYSGFAFFYTLGRQGKMRNTVQQIKYINRDELC
;
7   
2 UNP RIR2_AQUAE O67475 ? 1 
;HVTLFRNIINTLRKENPELFTPEIEKWIVEYFKYAVNEEIKWGQYVTQNQILGINDVLIERYIKYLGNLRITQIGFDPIY
PEVTENPLKWIDEFRKI
;
577 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 7AIK A 1   ? 224 ? O67475 7   ? 230 ? 7   230 
2 2 7AIK A 225 ? 321 ? O67475 577 ? 673 ? 231 327 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6050  ? 
1 MORE         -65   ? 
1 'SSA (A^2)'  23410 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 8_555 -y,-x,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 88.8990000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLU A 16  ? ARG A 20  ? GLU A 22  ARG A 26  5 ? 5  
HELX_P HELX_P2  AA2 TYR A 38  ? PHE A 50  ? TYR A 44  PHE A 56  1 ? 13 
HELX_P HELX_P3  AA3 ILE A 55  ? ILE A 59  ? ILE A 61  ILE A 65  5 ? 5  
HELX_P HELX_P4  AA4 GLU A 63  ? VAL A 71  ? GLU A 69  VAL A 77  1 ? 9  
HELX_P HELX_P5  AA5 SER A 73  ? ILE A 105 ? SER A 79  ILE A 111 1 ? 33 
HELX_P HELX_P6  AA6 ALA A 107 ? VAL A 136 ? ALA A 113 VAL A 142 1 ? 30 
HELX_P HELX_P7  AA7 ASP A 137 ? ASN A 146 ? ASP A 143 ASN A 152 1 ? 10 
HELX_P HELX_P8  AA8 TYR A 147 ? GLU A 150 ? TYR A 153 GLU A 156 5 ? 4  
HELX_P HELX_P9  AA9 ASP A 151 ? LYS A 171 ? ASP A 157 LYS A 177 1 ? 21 
HELX_P HELX_P10 AB1 ASN A 173 ? TYR A 191 ? ASN A 179 TYR A 197 1 ? 19 
HELX_P HELX_P11 AB2 PHE A 192 ? GLN A 205 ? PHE A 198 GLN A 211 1 ? 14 
HELX_P HELX_P12 AB3 MET A 208 ? ASN A 240 ? MET A 214 ASN A 246 1 ? 33 
HELX_P HELX_P13 AB4 PRO A 241 ? PHE A 244 ? PRO A 247 PHE A 250 5 ? 4  
HELX_P HELX_P14 AB5 THR A 245 ? GLN A 272 ? THR A 251 GLN A 278 1 ? 28 
HELX_P HELX_P15 AB6 ASN A 279 ? ILE A 298 ? ASN A 285 ILE A 304 1 ? 20 
HELX_P HELX_P16 AB7 TRP A 314 ? ARG A 319 ? TRP A 320 ARG A 325 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A ASP 91  OD1 ? ? ? 1_555 C FE2 . FE ? ? A ASP 97  A FE2 402 1_555 ? ? ? ? ? ? ? 1.997 ? ? 
metalc2 metalc ? ? A ASP 91  OD2 ? ? ? 1_555 C FE2 . FE ? ? A ASP 97  A FE2 402 1_555 ? ? ? ? ? ? ? 2.074 ? ? 
metalc3 metalc ? ? A GLU 121 OE2 ? ? ? 1_555 B FE2 . FE ? ? A GLU 127 A FE2 401 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
metalc4 metalc ? ? A HIS 124 ND1 ? ? ? 1_555 C FE2 . FE ? ? A HIS 130 A FE2 402 1_555 ? ? ? ? ? ? ? 1.946 ? ? 
metalc5 metalc ? ? A GLU 188 OE2 ? ? ? 1_555 B FE2 . FE ? ? A GLU 194 A FE2 401 1_555 ? ? ? ? ? ? ? 2.298 ? ? 
metalc6 metalc ? ? A GLU 222 OE1 ? ? ? 1_555 B FE2 . FE ? ? A GLU 228 A FE2 401 1_555 ? ? ? ? ? ? ? 2.164 ? ? 
metalc7 metalc ? ? A GLU 222 OE2 ? ? ? 1_555 B FE2 . FE ? ? A GLU 228 A FE2 401 1_555 ? ? ? ? ? ? ? 2.369 ? ? 
metalc8 metalc ? ? A GLU 222 OE2 ? ? ? 1_555 C FE2 . FE ? ? A GLU 228 A FE2 402 1_555 ? ? ? ? ? ? ? 2.759 ? ? 
metalc9 metalc ? ? A HIS 225 ND1 ? ? ? 1_555 B FE2 . FE ? ? A HIS 231 A FE2 401 1_555 ? ? ? ? ? ? ? 2.423 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 91  ? A ASP 97  ? 1_555 FE ? C FE2 . ? A FE2 402 ? 1_555 OD2 ? A ASP 91  ? A ASP 97  ? 1_555 65.9  ? 
2  OD1 ? A ASP 91  ? A ASP 97  ? 1_555 FE ? C FE2 . ? A FE2 402 ? 1_555 ND1 ? A HIS 124 ? A HIS 130 ? 1_555 141.3 ? 
3  OD2 ? A ASP 91  ? A ASP 97  ? 1_555 FE ? C FE2 . ? A FE2 402 ? 1_555 ND1 ? A HIS 124 ? A HIS 130 ? 1_555 119.7 ? 
4  OD1 ? A ASP 91  ? A ASP 97  ? 1_555 FE ? C FE2 . ? A FE2 402 ? 1_555 OE2 ? A GLU 222 ? A GLU 228 ? 1_555 105.6 ? 
5  OD2 ? A ASP 91  ? A ASP 97  ? 1_555 FE ? C FE2 . ? A FE2 402 ? 1_555 OE2 ? A GLU 222 ? A GLU 228 ? 1_555 146.4 ? 
6  ND1 ? A HIS 124 ? A HIS 130 ? 1_555 FE ? C FE2 . ? A FE2 402 ? 1_555 OE2 ? A GLU 222 ? A GLU 228 ? 1_555 87.9  ? 
7  OE2 ? A GLU 121 ? A GLU 127 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 OE2 ? A GLU 188 ? A GLU 194 ? 1_555 80.7  ? 
8  OE2 ? A GLU 121 ? A GLU 127 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 OE1 ? A GLU 222 ? A GLU 228 ? 1_555 169.3 ? 
9  OE2 ? A GLU 188 ? A GLU 194 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 OE1 ? A GLU 222 ? A GLU 228 ? 1_555 102.7 ? 
10 OE2 ? A GLU 121 ? A GLU 127 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 OE2 ? A GLU 222 ? A GLU 228 ? 1_555 116.5 ? 
11 OE2 ? A GLU 188 ? A GLU 194 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 OE2 ? A GLU 222 ? A GLU 228 ? 1_555 162.0 ? 
12 OE1 ? A GLU 222 ? A GLU 228 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 OE2 ? A GLU 222 ? A GLU 228 ? 1_555 59.4  ? 
13 OE2 ? A GLU 121 ? A GLU 127 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 ND1 ? A HIS 225 ? A HIS 231 ? 1_555 76.7  ? 
14 OE2 ? A GLU 188 ? A GLU 194 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 ND1 ? A HIS 225 ? A HIS 231 ? 1_555 86.7  ? 
15 OE1 ? A GLU 222 ? A GLU 228 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 ND1 ? A HIS 225 ? A HIS 231 ? 1_555 93.2  ? 
16 OE2 ? A GLU 222 ? A GLU 228 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 ND1 ? A HIS 225 ? A HIS 231 ? 1_555 92.0  ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 529 ? ? O A HOH 598 ? ? 2.08 
2 1 OD2 A ASP 20  ? ? O A HOH 501 ? ? 2.10 
3 1 OD1 A ASN 216 ? ? O A HOH 502 ? ? 2.11 
4 1 OE1 A GLU 106 ? ? O A HOH 503 ? ? 2.16 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     570 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     599 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   6_455 
_pdbx_validate_symm_contact.dist              1.94 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_1             194 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OE2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             194 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.356 
_pdbx_validate_rmsd_bond.bond_target_value         1.252 
_pdbx_validate_rmsd_bond.bond_deviation            0.104 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.011 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 9   ? ? -55.32  103.86 
2  1 MET A 67  ? ? -118.99 53.95  
3  1 THR A 76  ? ? -138.54 -38.71 
4  1 PRO A 178 ? ? -77.41  49.62  
5  1 LEU A 196 ? ? -122.93 -51.92 
6  1 PHE A 250 ? ? -90.07  51.42  
7  1 THR A 251 ? ? -41.30  159.81 
8  1 ASN A 279 ? ? 54.64   12.51  
9  1 THR A 314 ? ? -143.30 -32.27 
10 1 LYS A 326 ? ? -48.10  150.10 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   PHE 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    198 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   TYR 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    199 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -147.47 
# 
_pdbx_entry_details.entry_id                 7AIK 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.has_ligand_of_interest   Y 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CYS N    N  N N 74  
CYS CA   C  N R 75  
CYS C    C  N N 76  
CYS O    O  N N 77  
CYS CB   C  N N 78  
CYS SG   S  N N 79  
CYS OXT  O  N N 80  
CYS H    H  N N 81  
CYS H2   H  N N 82  
CYS HA   H  N N 83  
CYS HB2  H  N N 84  
CYS HB3  H  N N 85  
CYS HG   H  N N 86  
CYS HXT  H  N N 87  
FE2 FE   FE N N 88  
GLN N    N  N N 89  
GLN CA   C  N S 90  
GLN C    C  N N 91  
GLN O    O  N N 92  
GLN CB   C  N N 93  
GLN CG   C  N N 94  
GLN CD   C  N N 95  
GLN OE1  O  N N 96  
GLN NE2  N  N N 97  
GLN OXT  O  N N 98  
GLN H    H  N N 99  
GLN H2   H  N N 100 
GLN HA   H  N N 101 
GLN HB2  H  N N 102 
GLN HB3  H  N N 103 
GLN HG2  H  N N 104 
GLN HG3  H  N N 105 
GLN HE21 H  N N 106 
GLN HE22 H  N N 107 
GLN HXT  H  N N 108 
GLU N    N  N N 109 
GLU CA   C  N S 110 
GLU C    C  N N 111 
GLU O    O  N N 112 
GLU CB   C  N N 113 
GLU CG   C  N N 114 
GLU CD   C  N N 115 
GLU OE1  O  N N 116 
GLU OE2  O  N N 117 
GLU OXT  O  N N 118 
GLU H    H  N N 119 
GLU H2   H  N N 120 
GLU HA   H  N N 121 
GLU HB2  H  N N 122 
GLU HB3  H  N N 123 
GLU HG2  H  N N 124 
GLU HG3  H  N N 125 
GLU HE2  H  N N 126 
GLU HXT  H  N N 127 
GLY N    N  N N 128 
GLY CA   C  N N 129 
GLY C    C  N N 130 
GLY O    O  N N 131 
GLY OXT  O  N N 132 
GLY H    H  N N 133 
GLY H2   H  N N 134 
GLY HA2  H  N N 135 
GLY HA3  H  N N 136 
GLY HXT  H  N N 137 
HIS N    N  N N 138 
HIS CA   C  N S 139 
HIS C    C  N N 140 
HIS O    O  N N 141 
HIS CB   C  N N 142 
HIS CG   C  Y N 143 
HIS ND1  N  Y N 144 
HIS CD2  C  Y N 145 
HIS CE1  C  Y N 146 
HIS NE2  N  Y N 147 
HIS OXT  O  N N 148 
HIS H    H  N N 149 
HIS H2   H  N N 150 
HIS HA   H  N N 151 
HIS HB2  H  N N 152 
HIS HB3  H  N N 153 
HIS HD1  H  N N 154 
HIS HD2  H  N N 155 
HIS HE1  H  N N 156 
HIS HE2  H  N N 157 
HIS HXT  H  N N 158 
HOH O    O  N N 159 
HOH H1   H  N N 160 
HOH H2   H  N N 161 
ILE N    N  N N 162 
ILE CA   C  N S 163 
ILE C    C  N N 164 
ILE O    O  N N 165 
ILE CB   C  N S 166 
ILE CG1  C  N N 167 
ILE CG2  C  N N 168 
ILE CD1  C  N N 169 
ILE OXT  O  N N 170 
ILE H    H  N N 171 
ILE H2   H  N N 172 
ILE HA   H  N N 173 
ILE HB   H  N N 174 
ILE HG12 H  N N 175 
ILE HG13 H  N N 176 
ILE HG21 H  N N 177 
ILE HG22 H  N N 178 
ILE HG23 H  N N 179 
ILE HD11 H  N N 180 
ILE HD12 H  N N 181 
ILE HD13 H  N N 182 
ILE HXT  H  N N 183 
LEU N    N  N N 184 
LEU CA   C  N S 185 
LEU C    C  N N 186 
LEU O    O  N N 187 
LEU CB   C  N N 188 
LEU CG   C  N N 189 
LEU CD1  C  N N 190 
LEU CD2  C  N N 191 
LEU OXT  O  N N 192 
LEU H    H  N N 193 
LEU H2   H  N N 194 
LEU HA   H  N N 195 
LEU HB2  H  N N 196 
LEU HB3  H  N N 197 
LEU HG   H  N N 198 
LEU HD11 H  N N 199 
LEU HD12 H  N N 200 
LEU HD13 H  N N 201 
LEU HD21 H  N N 202 
LEU HD22 H  N N 203 
LEU HD23 H  N N 204 
LEU HXT  H  N N 205 
LYS N    N  N N 206 
LYS CA   C  N S 207 
LYS C    C  N N 208 
LYS O    O  N N 209 
LYS CB   C  N N 210 
LYS CG   C  N N 211 
LYS CD   C  N N 212 
LYS CE   C  N N 213 
LYS NZ   N  N N 214 
LYS OXT  O  N N 215 
LYS H    H  N N 216 
LYS H2   H  N N 217 
LYS HA   H  N N 218 
LYS HB2  H  N N 219 
LYS HB3  H  N N 220 
LYS HG2  H  N N 221 
LYS HG3  H  N N 222 
LYS HD2  H  N N 223 
LYS HD3  H  N N 224 
LYS HE2  H  N N 225 
LYS HE3  H  N N 226 
LYS HZ1  H  N N 227 
LYS HZ2  H  N N 228 
LYS HZ3  H  N N 229 
LYS HXT  H  N N 230 
MET N    N  N N 231 
MET CA   C  N S 232 
MET C    C  N N 233 
MET O    O  N N 234 
MET CB   C  N N 235 
MET CG   C  N N 236 
MET SD   S  N N 237 
MET CE   C  N N 238 
MET OXT  O  N N 239 
MET H    H  N N 240 
MET H2   H  N N 241 
MET HA   H  N N 242 
MET HB2  H  N N 243 
MET HB3  H  N N 244 
MET HG2  H  N N 245 
MET HG3  H  N N 246 
MET HE1  H  N N 247 
MET HE2  H  N N 248 
MET HE3  H  N N 249 
MET HXT  H  N N 250 
PHE N    N  N N 251 
PHE CA   C  N S 252 
PHE C    C  N N 253 
PHE O    O  N N 254 
PHE CB   C  N N 255 
PHE CG   C  Y N 256 
PHE CD1  C  Y N 257 
PHE CD2  C  Y N 258 
PHE CE1  C  Y N 259 
PHE CE2  C  Y N 260 
PHE CZ   C  Y N 261 
PHE OXT  O  N N 262 
PHE H    H  N N 263 
PHE H2   H  N N 264 
PHE HA   H  N N 265 
PHE HB2  H  N N 266 
PHE HB3  H  N N 267 
PHE HD1  H  N N 268 
PHE HD2  H  N N 269 
PHE HE1  H  N N 270 
PHE HE2  H  N N 271 
PHE HZ   H  N N 272 
PHE HXT  H  N N 273 
PRO N    N  N N 274 
PRO CA   C  N S 275 
PRO C    C  N N 276 
PRO O    O  N N 277 
PRO CB   C  N N 278 
PRO CG   C  N N 279 
PRO CD   C  N N 280 
PRO OXT  O  N N 281 
PRO H    H  N N 282 
PRO HA   H  N N 283 
PRO HB2  H  N N 284 
PRO HB3  H  N N 285 
PRO HG2  H  N N 286 
PRO HG3  H  N N 287 
PRO HD2  H  N N 288 
PRO HD3  H  N N 289 
PRO HXT  H  N N 290 
SER N    N  N N 291 
SER CA   C  N S 292 
SER C    C  N N 293 
SER O    O  N N 294 
SER CB   C  N N 295 
SER OG   O  N N 296 
SER OXT  O  N N 297 
SER H    H  N N 298 
SER H2   H  N N 299 
SER HA   H  N N 300 
SER HB2  H  N N 301 
SER HB3  H  N N 302 
SER HG   H  N N 303 
SER HXT  H  N N 304 
THR N    N  N N 305 
THR CA   C  N S 306 
THR C    C  N N 307 
THR O    O  N N 308 
THR CB   C  N R 309 
THR OG1  O  N N 310 
THR CG2  C  N N 311 
THR OXT  O  N N 312 
THR H    H  N N 313 
THR H2   H  N N 314 
THR HA   H  N N 315 
THR HB   H  N N 316 
THR HG1  H  N N 317 
THR HG21 H  N N 318 
THR HG22 H  N N 319 
THR HG23 H  N N 320 
THR HXT  H  N N 321 
TRP N    N  N N 322 
TRP CA   C  N S 323 
TRP C    C  N N 324 
TRP O    O  N N 325 
TRP CB   C  N N 326 
TRP CG   C  Y N 327 
TRP CD1  C  Y N 328 
TRP CD2  C  Y N 329 
TRP NE1  N  Y N 330 
TRP CE2  C  Y N 331 
TRP CE3  C  Y N 332 
TRP CZ2  C  Y N 333 
TRP CZ3  C  Y N 334 
TRP CH2  C  Y N 335 
TRP OXT  O  N N 336 
TRP H    H  N N 337 
TRP H2   H  N N 338 
TRP HA   H  N N 339 
TRP HB2  H  N N 340 
TRP HB3  H  N N 341 
TRP HD1  H  N N 342 
TRP HE1  H  N N 343 
TRP HE3  H  N N 344 
TRP HZ2  H  N N 345 
TRP HZ3  H  N N 346 
TRP HH2  H  N N 347 
TRP HXT  H  N N 348 
TYR N    N  N N 349 
TYR CA   C  N S 350 
TYR C    C  N N 351 
TYR O    O  N N 352 
TYR CB   C  N N 353 
TYR CG   C  Y N 354 
TYR CD1  C  Y N 355 
TYR CD2  C  Y N 356 
TYR CE1  C  Y N 357 
TYR CE2  C  Y N 358 
TYR CZ   C  Y N 359 
TYR OH   O  N N 360 
TYR OXT  O  N N 361 
TYR H    H  N N 362 
TYR H2   H  N N 363 
TYR HA   H  N N 364 
TYR HB2  H  N N 365 
TYR HB3  H  N N 366 
TYR HD1  H  N N 367 
TYR HD2  H  N N 368 
TYR HE1  H  N N 369 
TYR HE2  H  N N 370 
TYR HH   H  N N 371 
TYR HXT  H  N N 372 
VAL N    N  N N 373 
VAL CA   C  N S 374 
VAL C    C  N N 375 
VAL O    O  N N 376 
VAL CB   C  N N 377 
VAL CG1  C  N N 378 
VAL CG2  C  N N 379 
VAL OXT  O  N N 380 
VAL H    H  N N 381 
VAL H2   H  N N 382 
VAL HA   H  N N 383 
VAL HB   H  N N 384 
VAL HG11 H  N N 385 
VAL HG12 H  N N 386 
VAL HG13 H  N N 387 
VAL HG21 H  N N 388 
VAL HG22 H  N N 389 
VAL HG23 H  N N 390 
VAL HXT  H  N N 391 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
HOH O   H1   sing N N 150 
HOH O   H2   sing N N 151 
ILE N   CA   sing N N 152 
ILE N   H    sing N N 153 
ILE N   H2   sing N N 154 
ILE CA  C    sing N N 155 
ILE CA  CB   sing N N 156 
ILE CA  HA   sing N N 157 
ILE C   O    doub N N 158 
ILE C   OXT  sing N N 159 
ILE CB  CG1  sing N N 160 
ILE CB  CG2  sing N N 161 
ILE CB  HB   sing N N 162 
ILE CG1 CD1  sing N N 163 
ILE CG1 HG12 sing N N 164 
ILE CG1 HG13 sing N N 165 
ILE CG2 HG21 sing N N 166 
ILE CG2 HG22 sing N N 167 
ILE CG2 HG23 sing N N 168 
ILE CD1 HD11 sing N N 169 
ILE CD1 HD12 sing N N 170 
ILE CD1 HD13 sing N N 171 
ILE OXT HXT  sing N N 172 
LEU N   CA   sing N N 173 
LEU N   H    sing N N 174 
LEU N   H2   sing N N 175 
LEU CA  C    sing N N 176 
LEU CA  CB   sing N N 177 
LEU CA  HA   sing N N 178 
LEU C   O    doub N N 179 
LEU C   OXT  sing N N 180 
LEU CB  CG   sing N N 181 
LEU CB  HB2  sing N N 182 
LEU CB  HB3  sing N N 183 
LEU CG  CD1  sing N N 184 
LEU CG  CD2  sing N N 185 
LEU CG  HG   sing N N 186 
LEU CD1 HD11 sing N N 187 
LEU CD1 HD12 sing N N 188 
LEU CD1 HD13 sing N N 189 
LEU CD2 HD21 sing N N 190 
LEU CD2 HD22 sing N N 191 
LEU CD2 HD23 sing N N 192 
LEU OXT HXT  sing N N 193 
LYS N   CA   sing N N 194 
LYS N   H    sing N N 195 
LYS N   H2   sing N N 196 
LYS CA  C    sing N N 197 
LYS CA  CB   sing N N 198 
LYS CA  HA   sing N N 199 
LYS C   O    doub N N 200 
LYS C   OXT  sing N N 201 
LYS CB  CG   sing N N 202 
LYS CB  HB2  sing N N 203 
LYS CB  HB3  sing N N 204 
LYS CG  CD   sing N N 205 
LYS CG  HG2  sing N N 206 
LYS CG  HG3  sing N N 207 
LYS CD  CE   sing N N 208 
LYS CD  HD2  sing N N 209 
LYS CD  HD3  sing N N 210 
LYS CE  NZ   sing N N 211 
LYS CE  HE2  sing N N 212 
LYS CE  HE3  sing N N 213 
LYS NZ  HZ1  sing N N 214 
LYS NZ  HZ2  sing N N 215 
LYS NZ  HZ3  sing N N 216 
LYS OXT HXT  sing N N 217 
MET N   CA   sing N N 218 
MET N   H    sing N N 219 
MET N   H2   sing N N 220 
MET CA  C    sing N N 221 
MET CA  CB   sing N N 222 
MET CA  HA   sing N N 223 
MET C   O    doub N N 224 
MET C   OXT  sing N N 225 
MET CB  CG   sing N N 226 
MET CB  HB2  sing N N 227 
MET CB  HB3  sing N N 228 
MET CG  SD   sing N N 229 
MET CG  HG2  sing N N 230 
MET CG  HG3  sing N N 231 
MET SD  CE   sing N N 232 
MET CE  HE1  sing N N 233 
MET CE  HE2  sing N N 234 
MET CE  HE3  sing N N 235 
MET OXT HXT  sing N N 236 
PHE N   CA   sing N N 237 
PHE N   H    sing N N 238 
PHE N   H2   sing N N 239 
PHE CA  C    sing N N 240 
PHE CA  CB   sing N N 241 
PHE CA  HA   sing N N 242 
PHE C   O    doub N N 243 
PHE C   OXT  sing N N 244 
PHE CB  CG   sing N N 245 
PHE CB  HB2  sing N N 246 
PHE CB  HB3  sing N N 247 
PHE CG  CD1  doub Y N 248 
PHE CG  CD2  sing Y N 249 
PHE CD1 CE1  sing Y N 250 
PHE CD1 HD1  sing N N 251 
PHE CD2 CE2  doub Y N 252 
PHE CD2 HD2  sing N N 253 
PHE CE1 CZ   doub Y N 254 
PHE CE1 HE1  sing N N 255 
PHE CE2 CZ   sing Y N 256 
PHE CE2 HE2  sing N N 257 
PHE CZ  HZ   sing N N 258 
PHE OXT HXT  sing N N 259 
PRO N   CA   sing N N 260 
PRO N   CD   sing N N 261 
PRO N   H    sing N N 262 
PRO CA  C    sing N N 263 
PRO CA  CB   sing N N 264 
PRO CA  HA   sing N N 265 
PRO C   O    doub N N 266 
PRO C   OXT  sing N N 267 
PRO CB  CG   sing N N 268 
PRO CB  HB2  sing N N 269 
PRO CB  HB3  sing N N 270 
PRO CG  CD   sing N N 271 
PRO CG  HG2  sing N N 272 
PRO CG  HG3  sing N N 273 
PRO CD  HD2  sing N N 274 
PRO CD  HD3  sing N N 275 
PRO OXT HXT  sing N N 276 
SER N   CA   sing N N 277 
SER N   H    sing N N 278 
SER N   H2   sing N N 279 
SER CA  C    sing N N 280 
SER CA  CB   sing N N 281 
SER CA  HA   sing N N 282 
SER C   O    doub N N 283 
SER C   OXT  sing N N 284 
SER CB  OG   sing N N 285 
SER CB  HB2  sing N N 286 
SER CB  HB3  sing N N 287 
SER OG  HG   sing N N 288 
SER OXT HXT  sing N N 289 
THR N   CA   sing N N 290 
THR N   H    sing N N 291 
THR N   H2   sing N N 292 
THR CA  C    sing N N 293 
THR CA  CB   sing N N 294 
THR CA  HA   sing N N 295 
THR C   O    doub N N 296 
THR C   OXT  sing N N 297 
THR CB  OG1  sing N N 298 
THR CB  CG2  sing N N 299 
THR CB  HB   sing N N 300 
THR OG1 HG1  sing N N 301 
THR CG2 HG21 sing N N 302 
THR CG2 HG22 sing N N 303 
THR CG2 HG23 sing N N 304 
THR OXT HXT  sing N N 305 
TRP N   CA   sing N N 306 
TRP N   H    sing N N 307 
TRP N   H2   sing N N 308 
TRP CA  C    sing N N 309 
TRP CA  CB   sing N N 310 
TRP CA  HA   sing N N 311 
TRP C   O    doub N N 312 
TRP C   OXT  sing N N 313 
TRP CB  CG   sing N N 314 
TRP CB  HB2  sing N N 315 
TRP CB  HB3  sing N N 316 
TRP CG  CD1  doub Y N 317 
TRP CG  CD2  sing Y N 318 
TRP CD1 NE1  sing Y N 319 
TRP CD1 HD1  sing N N 320 
TRP CD2 CE2  doub Y N 321 
TRP CD2 CE3  sing Y N 322 
TRP NE1 CE2  sing Y N 323 
TRP NE1 HE1  sing N N 324 
TRP CE2 CZ2  sing Y N 325 
TRP CE3 CZ3  doub Y N 326 
TRP CE3 HE3  sing N N 327 
TRP CZ2 CH2  doub Y N 328 
TRP CZ2 HZ2  sing N N 329 
TRP CZ3 CH2  sing Y N 330 
TRP CZ3 HZ3  sing N N 331 
TRP CH2 HH2  sing N N 332 
TRP OXT HXT  sing N N 333 
TYR N   CA   sing N N 334 
TYR N   H    sing N N 335 
TYR N   H2   sing N N 336 
TYR CA  C    sing N N 337 
TYR CA  CB   sing N N 338 
TYR CA  HA   sing N N 339 
TYR C   O    doub N N 340 
TYR C   OXT  sing N N 341 
TYR CB  CG   sing N N 342 
TYR CB  HB2  sing N N 343 
TYR CB  HB3  sing N N 344 
TYR CG  CD1  doub Y N 345 
TYR CG  CD2  sing Y N 346 
TYR CD1 CE1  sing Y N 347 
TYR CD1 HD1  sing N N 348 
TYR CD2 CE2  doub Y N 349 
TYR CD2 HD2  sing N N 350 
TYR CE1 CZ   doub Y N 351 
TYR CE1 HE1  sing N N 352 
TYR CE2 CZ   sing Y N 353 
TYR CE2 HE2  sing N N 354 
TYR CZ  OH   sing N N 355 
TYR OH  HH   sing N N 356 
TYR OXT HXT  sing N N 357 
VAL N   CA   sing N N 358 
VAL N   H    sing N N 359 
VAL N   H2   sing N N 360 
VAL CA  C    sing N N 361 
VAL CA  CB   sing N N 362 
VAL CA  HA   sing N N 363 
VAL C   O    doub N N 364 
VAL C   OXT  sing N N 365 
VAL CB  CG1  sing N N 366 
VAL CB  CG2  sing N N 367 
VAL CB  HB   sing N N 368 
VAL CG1 HG11 sing N N 369 
VAL CG1 HG12 sing N N 370 
VAL CG1 HG13 sing N N 371 
VAL CG2 HG21 sing N N 372 
VAL CG2 HG22 sing N N 373 
VAL CG2 HG23 sing N N 374 
VAL OXT HXT  sing N N 375 
# 
_pdbx_audit_support.funding_organization   'Swedish Research Council' 
_pdbx_audit_support.country                Sweden 
_pdbx_audit_support.grant_number           2018-03406 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        FE2 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   FE2 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   5CI4 
_pdbx_initial_refinement_model.details          ? 
# 
_atom_sites.entry_id                    7AIK 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.014405 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014405 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005619 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_