data_7AKI # _entry.id 7AKI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7AKI pdb_00007aki 10.2210/pdb7aki/pdb WWPDB D_1292111542 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-11-25 2 'Structure model' 1 1 2020-12-02 3 'Structure model' 1 2 2021-02-10 4 'Structure model' 1 3 2021-02-17 5 'Structure model' 1 4 2022-10-26 6 'Structure model' 1 5 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' Advisory 5 5 'Structure model' 'Database references' 6 6 'Structure model' 'Data collection' 7 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' citation 6 4 'Structure model' citation_author 7 5 'Structure model' citation_author 8 5 'Structure model' database_2 9 5 'Structure model' pdbx_unobs_or_zero_occ_atoms 10 6 'Structure model' chem_comp_atom 11 6 'Structure model' chem_comp_bond 12 6 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 3 'Structure model' '_citation.pdbx_database_id_PubMed' 9 3 'Structure model' '_citation.title' 10 4 'Structure model' '_citation.journal_volume' 11 4 'Structure model' '_citation.page_first' 12 4 'Structure model' '_citation.page_last' 13 4 'Structure model' '_citation.pdbx_database_id_PubMed' 14 4 'Structure model' '_citation.title' 15 5 'Structure model' '_citation_author.identifier_ORCID' 16 5 'Structure model' '_database_2.pdbx_DOI' 17 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7AKI _pdbx_database_status.recvd_initial_deposition_date 2020-10-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'same inhibitor composition but with amidated C-terminus' _pdbx_database_related.db_id 4MY6 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Barone, M.' 1 0000-0002-6554-6464 'Roske, Y.' 2 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary Proc.Natl.Acad.Sci.USA PNASA6 0040 1091-6490 ? ? 117 ? 29684 29690 'Designed nanomolar small-molecule inhibitors of Ena/VASP EVH1 interaction impair invasion and extravasation of breast cancer cells.' 2020 ? 10.1073/pnas.2007213117 33184177 ? ? ? ? ? ? ? ? US ? ? 1 'Proc. Natl. Acad. Sci. U.S.A.' PNASA6 0040 1091-6490 ? ? 112 ? 5011 5016 'A modular toolkit to inhibit proline-rich motif-mediated protein-protein interactions.' 2015 ? 10.1073/pnas.1422054112 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Barone, M.' 1 0000-0002-6554-6464 primary 'Muller, M.' 2 ? primary 'Chiha, S.' 3 ? primary 'Ren, J.' 4 ? primary 'Albat, D.' 5 ? primary 'Soicke, A.' 6 ? primary 'Dohmen, S.' 7 ? primary 'Klein, M.' 8 ? primary 'Bruns, J.' 9 ? primary 'van Dinther, M.' 10 ? primary 'Opitz, R.' 11 ? primary 'Lindemann, P.' 12 ? primary 'Beerbaum, M.' 13 ? primary 'Motzny, K.' 14 ? primary 'Roske, Y.' 15 ? primary 'Schmieder, P.' 16 0000-0001-9968-9327 primary 'Volkmer, R.' 17 ? primary 'Nazare, M.' 18 0000-0002-1602-2330 primary 'Heinemann, U.' 19 0000-0002-8191-3850 primary 'Oschkinat, H.' 20 ? primary 'Ten Dijke, P.' 21 ? primary 'Schmalz, H.G.' 22 0000-0003-0489-1827 primary 'Kuhne, R.' 23 ? 1 'Opitz, R.' 24 ? 1 'Muller, M.' 25 ? 1 'Reuter, C.' 26 ? 1 'Barone, M.' 27 ? 1 'Soicke, A.' 28 ? 1 'Roske, Y.' 29 ? 1 'Piotukh, K.' 30 ? 1 'Huy, P.' 31 ? 1 'Beerbaum, M.' 32 ? 1 'Wiesner, B.' 33 ? 1 'Beyermann, M.' 34 ? 1 'Schmieder, P.' 35 ? 1 'Freund, C.' 36 ? 1 'Volkmer, R.' 37 ? 1 'Oschkinat, H.' 38 ? 1 'Schmalz, H.G.' 39 ? 1 'Kuhne, R.' 40 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein enabled homolog' 12628.273 1 ? ? ? 'M1A Q11A K21A are mutated for modelling as only the backbone was visible' 2 non-polymer syn 'NITRATE ION' 62.005 1 ? ? ? ? 3 non-polymer syn ;(3~{S},7~{R},10~{R},13~{S})-4-[(3~{S},6~{R},8~{a}~{S})-1'-[(2~{S})-2-acetamido-3-(2-chlorophenyl)propanoyl]-5-oxidanylidene-spiro[1,2,3,8~{a}-tetrahydroindolizine-6,2'-pyrrolidine]-3-yl]carbonyl-2-oxidanylidene-1,4-diazatricyclo[8.3.0.0^{3,7}]tridec-8-ene-13-carboxamide ; 677.190 2 ? ? ? ? 4 water nat water 18.015 62 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFH QWRDARQVYGLNFGSKEDANVFASAMMHALEVL ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFH QWRDARQVYGLNFGSKEDANVFASAMMHALEVL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'NITRATE ION' NO3 3 ;(3~{S},7~{R},10~{R},13~{S})-4-[(3~{S},6~{R},8~{a}~{S})-1'-[(2~{S})-2-acetamido-3-(2-chlorophenyl)propanoyl]-5-oxidanylidene-spiro[1,2,3,8~{a}-tetrahydroindolizine-6,2'-pyrrolidine]-3-yl]carbonyl-2-oxidanylidene-1,4-diazatricyclo[8.3.0.0^{3,7}]tridec-8-ene-13-carboxamide ; RJQ 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 SER n 1 5 GLU n 1 6 GLN n 1 7 SER n 1 8 ILE n 1 9 CYS n 1 10 GLN n 1 11 ALA n 1 12 ARG n 1 13 ALA n 1 14 ALA n 1 15 VAL n 1 16 MET n 1 17 VAL n 1 18 TYR n 1 19 ASP n 1 20 ASP n 1 21 ALA n 1 22 ASN n 1 23 LYS n 1 24 LYS n 1 25 TRP n 1 26 VAL n 1 27 PRO n 1 28 ALA n 1 29 GLY n 1 30 GLY n 1 31 SER n 1 32 THR n 1 33 GLY n 1 34 PHE n 1 35 SER n 1 36 ARG n 1 37 VAL n 1 38 HIS n 1 39 ILE n 1 40 TYR n 1 41 HIS n 1 42 HIS n 1 43 THR n 1 44 GLY n 1 45 ASN n 1 46 ASN n 1 47 THR n 1 48 PHE n 1 49 ARG n 1 50 VAL n 1 51 VAL n 1 52 GLY n 1 53 ARG n 1 54 LYS n 1 55 ILE n 1 56 GLN n 1 57 ASP n 1 58 HIS n 1 59 GLN n 1 60 VAL n 1 61 VAL n 1 62 ILE n 1 63 ASN n 1 64 CYS n 1 65 ALA n 1 66 ILE n 1 67 PRO n 1 68 LYS n 1 69 GLY n 1 70 LEU n 1 71 LYS n 1 72 TYR n 1 73 ASN n 1 74 GLN n 1 75 ALA n 1 76 THR n 1 77 GLN n 1 78 THR n 1 79 PHE n 1 80 HIS n 1 81 GLN n 1 82 TRP n 1 83 ARG n 1 84 ASP n 1 85 ALA n 1 86 ARG n 1 87 GLN n 1 88 VAL n 1 89 TYR n 1 90 GLY n 1 91 LEU n 1 92 ASN n 1 93 PHE n 1 94 GLY n 1 95 SER n 1 96 LYS n 1 97 GLU n 1 98 ASP n 1 99 ALA n 1 100 ASN n 1 101 VAL n 1 102 PHE n 1 103 ALA n 1 104 SER n 1 105 ALA n 1 106 MET n 1 107 MET n 1 108 HIS n 1 109 ALA n 1 110 LEU n 1 111 GLU n 1 112 VAL n 1 113 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 113 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ENAH, MENA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pGEX-4T-1 _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NO3 non-polymer . 'NITRATE ION' ? 'N O3 -1' 62.005 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RJQ non-polymer . ;(3~{S},7~{R},10~{R},13~{S})-4-[(3~{S},6~{R},8~{a}~{S})-1'-[(2~{S})-2-acetamido-3-(2-chlorophenyl)propanoyl]-5-oxidanylidene-spiro[1,2,3,8~{a}-tetrahydroindolizine-6,2'-pyrrolidine]-3-yl]carbonyl-2-oxidanylidene-1,4-diazatricyclo[8.3.0.0^{3,7}]tridec-8-ene-13-carboxamide ; ? 'C35 H41 Cl N6 O6' 677.190 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 -1 GLY GLY A . n A 1 2 SER 2 0 0 SER SER A . n A 1 3 MET 3 1 1 MET ALA A . n A 1 4 SER 4 2 2 SER SER A . n A 1 5 GLU 5 3 3 GLU GLU A . n A 1 6 GLN 6 4 4 GLN GLN A . n A 1 7 SER 7 5 5 SER SER A . n A 1 8 ILE 8 6 6 ILE ILE A . n A 1 9 CYS 9 7 7 CYS CYS A . n A 1 10 GLN 10 8 8 GLN ALA A . n A 1 11 ALA 11 9 9 ALA ALA A . n A 1 12 ARG 12 10 10 ARG ARG A . n A 1 13 ALA 13 11 11 ALA ALA A . n A 1 14 ALA 14 12 12 ALA ALA A . n A 1 15 VAL 15 13 13 VAL VAL A . n A 1 16 MET 16 14 14 MET MET A . n A 1 17 VAL 17 15 15 VAL VAL A . n A 1 18 TYR 18 16 16 TYR TYR A . n A 1 19 ASP 19 17 17 ASP ASP A . n A 1 20 ASP 20 18 18 ASP ASP A . n A 1 21 ALA 21 19 19 ALA ALA A . n A 1 22 ASN 22 20 20 ASN ASN A . n A 1 23 LYS 23 21 21 LYS ALA A . n A 1 24 LYS 24 22 22 LYS LYS A . n A 1 25 TRP 25 23 23 TRP TRP A . n A 1 26 VAL 26 24 24 VAL VAL A . n A 1 27 PRO 27 25 25 PRO PRO A . n A 1 28 ALA 28 26 26 ALA ALA A . n A 1 29 GLY 29 27 27 GLY GLY A . n A 1 30 GLY 30 28 28 GLY GLY A . n A 1 31 SER 31 29 29 SER SER A . n A 1 32 THR 32 30 30 THR THR A . n A 1 33 GLY 33 31 31 GLY GLY A . n A 1 34 PHE 34 32 32 PHE PHE A . n A 1 35 SER 35 33 33 SER SER A . n A 1 36 ARG 36 34 34 ARG ARG A . n A 1 37 VAL 37 35 35 VAL VAL A . n A 1 38 HIS 38 36 36 HIS HIS A . n A 1 39 ILE 39 37 37 ILE ILE A . n A 1 40 TYR 40 38 38 TYR TYR A . n A 1 41 HIS 41 39 39 HIS HIS A . n A 1 42 HIS 42 40 40 HIS HIS A . n A 1 43 THR 43 41 41 THR THR A . n A 1 44 GLY 44 42 42 GLY GLY A . n A 1 45 ASN 45 43 43 ASN ASN A . n A 1 46 ASN 46 44 44 ASN ASN A . n A 1 47 THR 47 45 45 THR THR A . n A 1 48 PHE 48 46 46 PHE PHE A . n A 1 49 ARG 49 47 47 ARG ARG A . n A 1 50 VAL 50 48 48 VAL VAL A . n A 1 51 VAL 51 49 49 VAL VAL A . n A 1 52 GLY 52 50 50 GLY GLY A . n A 1 53 ARG 53 51 51 ARG ARG A . n A 1 54 LYS 54 52 52 LYS LYS A . n A 1 55 ILE 55 53 53 ILE ILE A . n A 1 56 GLN 56 54 54 GLN GLN A . n A 1 57 ASP 57 55 55 ASP ASP A . n A 1 58 HIS 58 56 56 HIS HIS A . n A 1 59 GLN 59 57 57 GLN GLN A . n A 1 60 VAL 60 58 58 VAL VAL A . n A 1 61 VAL 61 59 59 VAL VAL A . n A 1 62 ILE 62 60 60 ILE ILE A . n A 1 63 ASN 63 61 61 ASN ASN A . n A 1 64 CYS 64 62 62 CYS CYS A . n A 1 65 ALA 65 63 63 ALA ALA A . n A 1 66 ILE 66 64 64 ILE ILE A . n A 1 67 PRO 67 65 65 PRO PRO A . n A 1 68 LYS 68 66 66 LYS LYS A . n A 1 69 GLY 69 67 67 GLY GLY A . n A 1 70 LEU 70 68 68 LEU LEU A . n A 1 71 LYS 71 69 69 LYS LYS A . n A 1 72 TYR 72 70 70 TYR TYR A . n A 1 73 ASN 73 71 71 ASN ASN A . n A 1 74 GLN 74 72 72 GLN GLN A . n A 1 75 ALA 75 73 73 ALA ALA A . n A 1 76 THR 76 74 74 THR THR A . n A 1 77 GLN 77 75 75 GLN GLN A . n A 1 78 THR 78 76 76 THR THR A . n A 1 79 PHE 79 77 77 PHE PHE A . n A 1 80 HIS 80 78 78 HIS HIS A . n A 1 81 GLN 81 79 79 GLN GLN A . n A 1 82 TRP 82 80 80 TRP TRP A . n A 1 83 ARG 83 81 81 ARG ARG A . n A 1 84 ASP 84 82 82 ASP ASP A . n A 1 85 ALA 85 83 83 ALA ALA A . n A 1 86 ARG 86 84 84 ARG ARG A . n A 1 87 GLN 87 85 85 GLN GLN A . n A 1 88 VAL 88 86 86 VAL VAL A . n A 1 89 TYR 89 87 87 TYR TYR A . n A 1 90 GLY 90 88 88 GLY GLY A . n A 1 91 LEU 91 89 89 LEU LEU A . n A 1 92 ASN 92 90 90 ASN ASN A . n A 1 93 PHE 93 91 91 PHE PHE A . n A 1 94 GLY 94 92 92 GLY GLY A . n A 1 95 SER 95 93 93 SER SER A . n A 1 96 LYS 96 94 94 LYS LYS A . n A 1 97 GLU 97 95 95 GLU GLU A . n A 1 98 ASP 98 96 96 ASP ASP A . n A 1 99 ALA 99 97 97 ALA ALA A . n A 1 100 ASN 100 98 98 ASN ASN A . n A 1 101 VAL 101 99 99 VAL VAL A . n A 1 102 PHE 102 100 100 PHE PHE A . n A 1 103 ALA 103 101 101 ALA ALA A . n A 1 104 SER 104 102 102 SER SER A . n A 1 105 ALA 105 103 103 ALA ALA A . n A 1 106 MET 106 104 104 MET MET A . n A 1 107 MET 107 105 105 MET MET A . n A 1 108 HIS 108 106 106 HIS HIS A . n A 1 109 ALA 109 107 107 ALA ALA A . n A 1 110 LEU 110 108 108 LEU LEU A . n A 1 111 GLU 111 109 109 GLU GLU A . n A 1 112 VAL 112 110 110 VAL VAL A . n A 1 113 LEU 113 111 111 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NO3 1 201 201 NO3 NO3 A . C 3 RJQ 1 202 1 RJQ DRG A . D 3 RJQ 1 203 2 RJQ DRG A . E 4 HOH 1 301 19 HOH HOH A . E 4 HOH 2 302 45 HOH HOH A . E 4 HOH 3 303 13 HOH HOH A . E 4 HOH 4 304 20 HOH HOH A . E 4 HOH 5 305 55 HOH HOH A . E 4 HOH 6 306 33 HOH HOH A . E 4 HOH 7 307 7 HOH HOH A . E 4 HOH 8 308 37 HOH HOH A . E 4 HOH 9 309 34 HOH HOH A . E 4 HOH 10 310 14 HOH HOH A . E 4 HOH 11 311 44 HOH HOH A . E 4 HOH 12 312 58 HOH HOH A . E 4 HOH 13 313 38 HOH HOH A . E 4 HOH 14 314 12 HOH HOH A . E 4 HOH 15 315 53 HOH HOH A . E 4 HOH 16 316 40 HOH HOH A . E 4 HOH 17 317 2 HOH HOH A . E 4 HOH 18 318 8 HOH HOH A . E 4 HOH 19 319 67 HOH HOH A . E 4 HOH 20 320 6 HOH HOH A . E 4 HOH 21 321 39 HOH HOH A . E 4 HOH 22 322 36 HOH HOH A . E 4 HOH 23 323 9 HOH HOH A . E 4 HOH 24 324 3 HOH HOH A . E 4 HOH 25 325 52 HOH HOH A . E 4 HOH 26 326 5 HOH HOH A . E 4 HOH 27 327 10 HOH HOH A . E 4 HOH 28 328 31 HOH HOH A . E 4 HOH 29 329 56 HOH HOH A . E 4 HOH 30 330 48 HOH HOH A . E 4 HOH 31 331 49 HOH HOH A . E 4 HOH 32 332 29 HOH HOH A . E 4 HOH 33 333 41 HOH HOH A . E 4 HOH 34 334 15 HOH HOH A . E 4 HOH 35 335 32 HOH HOH A . E 4 HOH 36 336 11 HOH HOH A . E 4 HOH 37 337 26 HOH HOH A . E 4 HOH 38 338 65 HOH HOH A . E 4 HOH 39 339 46 HOH HOH A . E 4 HOH 40 340 57 HOH HOH A . E 4 HOH 41 341 23 HOH HOH A . E 4 HOH 42 342 24 HOH HOH A . E 4 HOH 43 343 35 HOH HOH A . E 4 HOH 44 344 50 HOH HOH A . E 4 HOH 45 345 60 HOH HOH A . E 4 HOH 46 346 21 HOH HOH A . E 4 HOH 47 347 42 HOH HOH A . E 4 HOH 48 348 30 HOH HOH A . E 4 HOH 49 349 62 HOH HOH A . E 4 HOH 50 350 4 HOH HOH A . E 4 HOH 51 351 43 HOH HOH A . E 4 HOH 52 352 28 HOH HOH A . E 4 HOH 53 353 17 HOH HOH A . E 4 HOH 54 354 64 HOH HOH A . E 4 HOH 55 355 18 HOH HOH A . E 4 HOH 56 356 22 HOH HOH A . E 4 HOH 57 357 66 HOH HOH A . E 4 HOH 58 358 61 HOH HOH A . E 4 HOH 59 359 51 HOH HOH A . E 4 HOH 60 360 47 HOH HOH A . E 4 HOH 61 361 54 HOH HOH A . E 4 HOH 62 362 59 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 1 ? CG ? A MET 3 CG 2 1 Y 1 A MET 1 ? SD ? A MET 3 SD 3 1 Y 1 A MET 1 ? CE ? A MET 3 CE 4 1 Y 1 A GLN 8 ? CG ? A GLN 10 CG 5 1 Y 1 A GLN 8 ? CD ? A GLN 10 CD 6 1 Y 1 A GLN 8 ? OE1 ? A GLN 10 OE1 7 1 Y 1 A GLN 8 ? NE2 ? A GLN 10 NE2 8 1 Y 1 A LYS 21 ? CG ? A LYS 23 CG 9 1 Y 1 A LYS 21 ? CD ? A LYS 23 CD 10 1 Y 1 A LYS 21 ? CE ? A LYS 23 CE 11 1 Y 1 A LYS 21 ? NZ ? A LYS 23 NZ 12 1 N 0 A HOH 301 ? O A E HOH ? O # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7AKI _cell.details ? _cell.formula_units_Z ? _cell.length_a 34.700 _cell.length_a_esd ? _cell.length_b 60.690 _cell.length_b_esd ? _cell.length_c 89.060 _cell.length_c_esd ? _cell.volume 187555.284 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7AKI _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall 'C 2c 2' _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7AKI _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.84 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 33.3 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 300.15 _exptl_crystal_grow.temp_details incubator _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.541M ammonium sulfate, 564mM potassium bromide' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-12-14 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.2 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 22.73 _reflns.entry_id 7AKI _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.36 _reflns.d_resolution_low 44.53 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20643 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.48 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.131 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.36 _reflns_shell.d_res_low 1.47 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 4246 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 14.5 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.273 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 34.80 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7AKI _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.36 _refine.ls_d_res_low 44.53 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20639 _refine.ls_number_reflns_R_free 1033 _refine.ls_number_reflns_R_work 19606 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.96 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2030 _refine.ls_R_factor_R_free 0.2360 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2012 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5N91 _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.9997 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2564 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.36 _refine_hist.d_res_low 44.53 _refine_hist.number_atoms_solvent 62 _refine_hist.number_atoms_total 1038 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 876 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 100 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0115 ? 1112 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.6435 ? 1539 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0852 ? 160 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0075 ? 201 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.7708 ? 462 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.36 1.43 . . 146 2755 99.90 . . . 0.3990 . 0.4480 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.43 1.52 . . 145 2771 99.90 . . . 0.3474 . 0.3389 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.52 1.64 . . 145 2749 99.97 . . . 0.3587 . 0.2905 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.64 1.80 . . 146 2776 99.97 . . . 0.2841 . 0.2230 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.80 2.06 . . 148 2805 100.00 . . . 0.2212 . 0.1915 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.06 2.60 . . 147 2801 100.00 . . . 0.2156 . 0.1979 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.60 44.53 . . 156 2949 100.00 . . . 0.2179 . 0.1759 . . . . . . . . . . . # _struct.entry_id 7AKI _struct.title 'ENAH EVH1 in complex with Ac-[2-Cl-F]-[ProM-2]-[ProM-1]-NH2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7AKI _struct_keywords.text 'proline-rich motif, Ena/VASP inhibitor, actin, protein-protein interaction, CELL INVASION' _struct_keywords.pdbx_keywords 'CELL INVASION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ENAH_HUMAN _struct_ref.pdbx_db_accession Q8N8S7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQW RDARQVYGLNFGSKEDANVFASAMMHALEVL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7AKI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 113 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8N8S7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 111 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 111 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7AKI GLY A 1 ? UNP Q8N8S7 ? ? 'expression tag' -1 1 1 7AKI SER A 2 ? UNP Q8N8S7 ? ? 'expression tag' 0 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 130 ? 1 MORE 1 ? 1 'SSA (A^2)' 6620 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 29 ? SER A 31 ? GLY A 27 SER A 29 5 ? 3 HELX_P HELX_P2 AA2 SER A 95 ? LEU A 113 ? SER A 93 LEU A 111 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 24 ? PRO A 27 ? LYS A 22 PRO A 25 AA1 2 GLU A 5 ? ASP A 19 ? GLU A 3 ASP A 17 AA1 3 PHE A 34 ? HIS A 42 ? PHE A 32 HIS A 40 AA1 4 THR A 47 ? LYS A 54 ? THR A 45 LYS A 52 AA1 5 VAL A 60 ? ILE A 66 ? VAL A 58 ILE A 64 AA2 1 LYS A 24 ? PRO A 27 ? LYS A 22 PRO A 25 AA2 2 GLU A 5 ? ASP A 19 ? GLU A 3 ASP A 17 AA2 3 VAL A 88 ? PHE A 93 ? VAL A 86 PHE A 91 AA2 4 PHE A 79 ? ARG A 83 ? PHE A 77 ARG A 81 AA2 5 ASN A 73 ? GLN A 74 ? ASN A 71 GLN A 72 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LYS A 24 ? O LYS A 22 N ASP A 19 ? N ASP A 17 AA1 2 3 N ALA A 11 ? N ALA A 9 O VAL A 37 ? O VAL A 35 AA1 3 4 N TYR A 40 ? N TYR A 38 O ARG A 49 ? O ARG A 47 AA1 4 5 N VAL A 50 ? N VAL A 48 O CYS A 64 ? O CYS A 62 AA2 1 2 O LYS A 24 ? O LYS A 22 N ASP A 19 ? N ASP A 17 AA2 2 3 N MET A 16 ? N MET A 14 O GLY A 90 ? O GLY A 88 AA2 3 4 O TYR A 89 ? O TYR A 87 N TRP A 82 ? N TRP A 80 AA2 4 5 O GLN A 81 ? O GLN A 79 N ASN A 73 ? N ASN A 71 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A NO3 201 ? 5 'binding site for residue NO3 A 201' AC2 Software A RJQ 202 ? 10 'binding site for residue RJQ A 202' AC3 Software A RJQ 203 ? 14 'binding site for residue RJQ A 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ARG A 12 ? ARG A 10 . ? 1_555 ? 2 AC1 5 PHE A 34 ? PHE A 32 . ? 1_555 ? 3 AC1 5 ILE A 55 ? ILE A 53 . ? 1_555 ? 4 AC1 5 GLU A 97 ? GLU A 95 . ? 8_555 ? 5 AC1 5 ASN A 100 ? ASN A 98 . ? 8_555 ? 6 AC2 10 TYR A 18 ? TYR A 16 . ? 3_555 ? 7 AC2 10 ASP A 20 ? ASP A 18 . ? 3_555 ? 8 AC2 10 LYS A 24 ? LYS A 22 . ? 1_555 ? 9 AC2 10 TRP A 25 ? TRP A 23 . ? 1_555 ? 10 AC2 10 LYS A 68 ? LYS A 66 . ? 5_555 ? 11 AC2 10 ASN A 73 ? ASN A 71 . ? 1_555 ? 12 AC2 10 GLN A 81 ? GLN A 79 . ? 1_555 ? 13 AC2 10 ARG A 83 ? ARG A 81 . ? 1_555 ? 14 AC2 10 VAL A 88 ? VAL A 86 . ? 1_555 ? 15 AC2 10 HOH E . ? HOH A 334 . ? 1_555 ? 16 AC3 14 GLY A 1 ? GLY A -1 . ? 1_555 ? 17 AC3 14 SER A 2 ? SER A 0 . ? 1_555 ? 18 AC3 14 GLU A 5 ? GLU A 3 . ? 1_555 ? 19 AC3 14 GLN A 6 ? GLN A 4 . ? 1_555 ? 20 AC3 14 GLN A 10 ? GLN A 8 . ? 4_555 ? 21 AC3 14 ARG A 36 ? ARG A 34 . ? 4_555 ? 22 AC3 14 TYR A 40 ? TYR A 38 . ? 1_555 ? 23 AC3 14 ARG A 49 ? ARG A 47 . ? 1_555 ? 24 AC3 14 VAL A 60 ? VAL A 58 . ? 1_555 ? 25 AC3 14 ASN A 63 ? ASN A 61 . ? 1_555 ? 26 AC3 14 GLN A 74 ? GLN A 72 . ? 5_545 ? 27 AC3 14 ALA A 75 ? ALA A 73 . ? 5_545 ? 28 AC3 14 GLN A 77 ? GLN A 75 . ? 5_545 ? 29 AC3 14 HOH E . ? HOH A 322 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ2 A LYS 22 ? ? O A HOH 301 ? B 1.29 2 1 HZ3 A LYS 22 ? ? O A HOH 301 ? B 1.33 3 1 HH21 A ARG 10 ? ? O2 A NO3 201 ? ? 1.56 4 1 NZ A LYS 22 ? ? O A HOH 301 ? B 1.57 5 1 O A LEU 111 ? ? O A HOH 302 ? ? 2.10 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 362 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 362 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_555 _pdbx_validate_symm_contact.dist 1.75 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 7 ? A -170.04 145.63 2 1 ASN A 61 ? ? -152.82 88.10 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 ARG _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 81 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ASP _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 82 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 144.82 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 357 ? E HOH . 2 1 A HOH 359 ? E HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z+1/2 4 -x,-y,z+1/2 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 10.07908511 8.11019716408 9.76539321368 0.229469758067 ? -0.00740401327819 ? 0.0135789687351 ? 0.179896313298 ? 0.0151380575543 ? 0.204790207369 ? 1.70714934814 ? -0.417558836961 ? 0.41954143031 ? 1.56308231804 ? 1.6933943644 ? 2.29217779876 ? 0.0267004599511 ? -0.116614824666 ? -0.115125245636 ? 0.268678434247 ? -0.00875816223225 ? 0.0821092130237 ? 0.509168275081 ? 0.0710363088956 ? -0.0498109236036 ? 2 'X-RAY DIFFRACTION' ? refined 14.6313715691 18.2202166332 19.3336452109 0.184129228767 ? 0.0281930114236 ? -0.0462518929238 ? 0.292709684312 ? -0.0462063032198 ? 0.233973751257 ? 5.48738559702 ? -0.621533656637 ? 0.226792288415 ? 4.3280183849 ? 2.93186291483 ? 2.06246577289 ? -0.13215829816 ? -0.53666989635 ? 0.48844356488 ? 0.0313528108118 ? 0.0593966502828 ? -0.149565185897 ? -0.254222879065 ? -0.098932256005 ? 0.0801996325866 ? 3 'X-RAY DIFFRACTION' ? refined 8.61138814159 1.28173459373 9.10515051072 0.252449787701 ? 0.0209168625902 ? 0.0410045654887 ? 0.186081643806 ? -0.00106458521734 ? 0.19394681725 ? 5.89704777554 ? 3.38073316718 ? 1.68663398569 ? 5.86827712712 ? 1.22346390669 ? 3.58547448764 ? -0.28971745473 ? -0.194753105221 ? -0.566200506354 ? -0.225310879214 ? 0.143156438421 ? -0.140886169405 ? 0.562086248055 ? -0.125778857236 ? 0.143871307453 ? 4 'X-RAY DIFFRACTION' ? refined 16.6501701047 6.14587486994 13.0743062652 0.241978437771 ? 0.0278842900595 ? -0.0108931810023 ? 0.285860572312 ? 0.0154431531171 ? 0.204137301313 ? 2.35117754303 ? -0.911781319448 ? -2.09669164342 ? 4.10841913709 ? 0.0570465709764 ? 3.07156512621 ? 0.296700987772 ? -0.0342050854126 ? 0.370489019636 ? 0.13077918754 ? -0.180832602381 ? -0.442484862508 ? 0.196501886648 ? 0.387902788215 ? 0.0419379180579 ? 5 'X-RAY DIFFRACTION' ? refined 3.51657513684 13.3395332419 13.1656133873 0.0997125526851 ? 0.010741795218 ? -0.00502945869618 ? 0.155048038091 ? -0.0312298424531 ? 0.15010319239 ? 5.03016274921 ? 1.44777291697 ? -2.52091194103 ? 3.5859182202 ? -2.19372352486 ? 6.25678770695 ? -0.00990998454742 ? -0.0703401470799 ? 0.0306137277249 ? -0.0279084563469 ? -0.0380239896132 ? 0.138854506525 ? -0.0907890905066 ? -0.199540758079 ? -0.04450335236 ? 6 'X-RAY DIFFRACTION' ? refined 0.39031027601 9.24757859304 3.7336703291 0.29962171753 ? -0.0148003677604 ? 0.0197142414322 ? 0.342295113293 ? -0.049685911352 ? 0.340291600029 ? 4.88569675394 ? 4.06626691622 ? -4.34509158014 ? 4.37650138141 ? -4.06591613041 ? 4.07331560881 ? -0.291524064798 ? 0.633245373733 ? -0.43156941915 ? 0.0340657803748 ? 0.133603475022 ? 0.515405732494 ? 0.19437992253 ? -0.845771649193 ? 0.0738155292586 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 1 through 17 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 18 through 32 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 33 through 52 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 53 through 63 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 64 through 93 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 94 through 111 ) ; # _pdbx_entry_details.entry_id 7AKI _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 NO3 N N N N 250 NO3 O1 O N N 251 NO3 O2 O N N 252 NO3 O3 O N N 253 PHE N N N N 254 PHE CA C N S 255 PHE C C N N 256 PHE O O N N 257 PHE CB C N N 258 PHE CG C Y N 259 PHE CD1 C Y N 260 PHE CD2 C Y N 261 PHE CE1 C Y N 262 PHE CE2 C Y N 263 PHE CZ C Y N 264 PHE OXT O N N 265 PHE H H N N 266 PHE H2 H N N 267 PHE HA H N N 268 PHE HB2 H N N 269 PHE HB3 H N N 270 PHE HD1 H N N 271 PHE HD2 H N N 272 PHE HE1 H N N 273 PHE HE2 H N N 274 PHE HZ H N N 275 PHE HXT H N N 276 PRO N N N N 277 PRO CA C N S 278 PRO C C N N 279 PRO O O N N 280 PRO CB C N N 281 PRO CG C N N 282 PRO CD C N N 283 PRO OXT O N N 284 PRO H H N N 285 PRO HA H N N 286 PRO HB2 H N N 287 PRO HB3 H N N 288 PRO HG2 H N N 289 PRO HG3 H N N 290 PRO HD2 H N N 291 PRO HD3 H N N 292 PRO HXT H N N 293 RJQ N N N N 294 RJQ CA C N S 295 RJQ C C N N 296 RJQ O O N N 297 RJQ CB C N N 298 RJQ CG C Y N 299 RJQ CD1 C Y N 300 RJQ CD2 C Y N 301 RJQ CE1 C Y N 302 RJQ CE2 C Y N 303 RJQ CZ C Y N 304 RJQ CAK C N N 305 RJQ CAM C N N 306 RJQ CAQ C N N 307 RJQ CAR C N N 308 RJQ CAS C N N 309 RJQ CAT C N R 310 RJQ CAU C N N 311 RJQ CAX C N N 312 RJQ CAY C N N 313 RJQ CAZ C N S 314 RJQ CBA C N N 315 RJQ CBB C N N 316 RJQ CBC C N S 317 RJQ CBD C N N 318 RJQ CBG C N S 319 RJQ CBH C N N 320 RJQ CBK C N S 321 RJQ CBL C N N 322 RJQ CBN C N N 323 RJQ CBO C N N 324 RJQ CBP C N R 325 RJQ CBQ C N N 326 RJQ CBR C N N 327 RJQ CBS C N R 328 RJQ CBT C N N 329 RJQ CBU C N N 330 RJQ NAP N N N 331 RJQ NAW N N N 332 RJQ NBF N N N 333 RJQ NBJ N N N 334 RJQ NBV N N N 335 RJQ OAL O N N 336 RJQ OAV O N N 337 RJQ OBE O N N 338 RJQ OBI O N N 339 RJQ OBM O N N 340 RJQ CL1 CL N N 341 RJQ H H N N 342 RJQ HA H N N 343 RJQ HB1 H N N 344 RJQ HB2 H N N 345 RJQ HD2 H N N 346 RJQ HE1 H N N 347 RJQ HE2 H N N 348 RJQ HZ H N N 349 RJQ HAM H N N 350 RJQ HZL H N N 351 RJQ HZM H N N 352 RJQ HAQ H N N 353 RJQ HZN H N N 354 RJQ HAR H N N 355 RJQ HZO H N N 356 RJQ HAS H N N 357 RJQ HZP H N N 358 RJQ HAX H N N 359 RJQ HAY H N N 360 RJQ HAZ H N N 361 RJQ HZQ H N N 362 RJQ HBA H N N 363 RJQ HZR H N N 364 RJQ HBB H N N 365 RJQ HBC H N N 366 RJQ HBG H N N 367 RJQ HBK H N N 368 RJQ HBN H N N 369 RJQ HZV H N N 370 RJQ HBO H N N 371 RJQ HZU H N N 372 RJQ HBP H N N 373 RJQ HBQ H N N 374 RJQ HBR H N N 375 RJQ HBS H N N 376 RJQ HZT H N N 377 RJQ HBT H N N 378 RJQ HZS H N N 379 RJQ HBU H N N 380 RJQ HZW H N N 381 RJQ HBV H N N 382 SER N N N N 383 SER CA C N S 384 SER C C N N 385 SER O O N N 386 SER CB C N N 387 SER OG O N N 388 SER OXT O N N 389 SER H H N N 390 SER H2 H N N 391 SER HA H N N 392 SER HB2 H N N 393 SER HB3 H N N 394 SER HG H N N 395 SER HXT H N N 396 THR N N N N 397 THR CA C N S 398 THR C C N N 399 THR O O N N 400 THR CB C N R 401 THR OG1 O N N 402 THR CG2 C N N 403 THR OXT O N N 404 THR H H N N 405 THR H2 H N N 406 THR HA H N N 407 THR HB H N N 408 THR HG1 H N N 409 THR HG21 H N N 410 THR HG22 H N N 411 THR HG23 H N N 412 THR HXT H N N 413 TRP N N N N 414 TRP CA C N S 415 TRP C C N N 416 TRP O O N N 417 TRP CB C N N 418 TRP CG C Y N 419 TRP CD1 C Y N 420 TRP CD2 C Y N 421 TRP NE1 N Y N 422 TRP CE2 C Y N 423 TRP CE3 C Y N 424 TRP CZ2 C Y N 425 TRP CZ3 C Y N 426 TRP CH2 C Y N 427 TRP OXT O N N 428 TRP H H N N 429 TRP H2 H N N 430 TRP HA H N N 431 TRP HB2 H N N 432 TRP HB3 H N N 433 TRP HD1 H N N 434 TRP HE1 H N N 435 TRP HE3 H N N 436 TRP HZ2 H N N 437 TRP HZ3 H N N 438 TRP HH2 H N N 439 TRP HXT H N N 440 TYR N N N N 441 TYR CA C N S 442 TYR C C N N 443 TYR O O N N 444 TYR CB C N N 445 TYR CG C Y N 446 TYR CD1 C Y N 447 TYR CD2 C Y N 448 TYR CE1 C Y N 449 TYR CE2 C Y N 450 TYR CZ C Y N 451 TYR OH O N N 452 TYR OXT O N N 453 TYR H H N N 454 TYR H2 H N N 455 TYR HA H N N 456 TYR HB2 H N N 457 TYR HB3 H N N 458 TYR HD1 H N N 459 TYR HD2 H N N 460 TYR HE1 H N N 461 TYR HE2 H N N 462 TYR HH H N N 463 TYR HXT H N N 464 VAL N N N N 465 VAL CA C N S 466 VAL C C N N 467 VAL O O N N 468 VAL CB C N N 469 VAL CG1 C N N 470 VAL CG2 C N N 471 VAL OXT O N N 472 VAL H H N N 473 VAL H2 H N N 474 VAL HA H N N 475 VAL HB H N N 476 VAL HG11 H N N 477 VAL HG12 H N N 478 VAL HG13 H N N 479 VAL HG21 H N N 480 VAL HG22 H N N 481 VAL HG23 H N N 482 VAL HXT H N N 483 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 NO3 N O1 doub N N 237 NO3 N O2 sing N N 238 NO3 N O3 sing N N 239 PHE N CA sing N N 240 PHE N H sing N N 241 PHE N H2 sing N N 242 PHE CA C sing N N 243 PHE CA CB sing N N 244 PHE CA HA sing N N 245 PHE C O doub N N 246 PHE C OXT sing N N 247 PHE CB CG sing N N 248 PHE CB HB2 sing N N 249 PHE CB HB3 sing N N 250 PHE CG CD1 doub Y N 251 PHE CG CD2 sing Y N 252 PHE CD1 CE1 sing Y N 253 PHE CD1 HD1 sing N N 254 PHE CD2 CE2 doub Y N 255 PHE CD2 HD2 sing N N 256 PHE CE1 CZ doub Y N 257 PHE CE1 HE1 sing N N 258 PHE CE2 CZ sing Y N 259 PHE CE2 HE2 sing N N 260 PHE CZ HZ sing N N 261 PHE OXT HXT sing N N 262 PRO N CA sing N N 263 PRO N CD sing N N 264 PRO N H sing N N 265 PRO CA C sing N N 266 PRO CA CB sing N N 267 PRO CA HA sing N N 268 PRO C O doub N N 269 PRO C OXT sing N N 270 PRO CB CG sing N N 271 PRO CB HB2 sing N N 272 PRO CB HB3 sing N N 273 PRO CG CD sing N N 274 PRO CG HG2 sing N N 275 PRO CG HG3 sing N N 276 PRO CD HD2 sing N N 277 PRO CD HD3 sing N N 278 PRO OXT HXT sing N N 279 RJQ CBR CBQ doub N N 280 RJQ CBR CBS sing N N 281 RJQ CBQ CBP sing N N 282 RJQ CBO CBP sing N N 283 RJQ CBO CBN sing N N 284 RJQ CBT CBS sing N N 285 RJQ CBT CBU sing N N 286 RJQ CBS CBG sing N N 287 RJQ CBP NBJ sing N N 288 RJQ OBM CBL doub N N 289 RJQ CBU NBF sing N N 290 RJQ CBN CBK sing N N 291 RJQ CBG CBH sing N N 292 RJQ CBG NBF sing N N 293 RJQ NBJ CBK sing N N 294 RJQ NBJ CBH sing N N 295 RJQ CBL CBK sing N N 296 RJQ CBL NBV sing N N 297 RJQ CBH OBI doub N N 298 RJQ CE2 CZ doub Y N 299 RJQ CE2 CD2 sing Y N 300 RJQ CZ CE1 sing Y N 301 RJQ NBF CBD sing N N 302 RJQ CE1 CD1 doub Y N 303 RJQ CD2 CG doub Y N 304 RJQ CG CD1 sing Y N 305 RJQ CG CB sing N N 306 RJQ CD1 CL1 sing N N 307 RJQ CBD CBC sing N N 308 RJQ CBD OBE doub N N 309 RJQ CB CA sing N N 310 RJQ CBC CBB sing N N 311 RJQ CBC NAW sing N N 312 RJQ OAV CAU doub N N 313 RJQ CBB CBA sing N N 314 RJQ NAW CAU sing N N 315 RJQ NAW CAZ sing N N 316 RJQ CA N sing N N 317 RJQ CA C sing N N 318 RJQ CAU CAT sing N N 319 RJQ O C doub N N 320 RJQ N CAK sing N N 321 RJQ C NAP sing N N 322 RJQ CBA CAZ sing N N 323 RJQ CAK OAL doub N N 324 RJQ CAK CAM sing N N 325 RJQ NAP CAQ sing N N 326 RJQ NAP CAT sing N N 327 RJQ CAR CAQ sing N N 328 RJQ CAR CAS sing N N 329 RJQ CAZ CAY sing N N 330 RJQ CAT CAS sing N N 331 RJQ CAT CAX sing N N 332 RJQ CAY CAX doub N N 333 RJQ N H sing N N 334 RJQ CA HA sing N N 335 RJQ CB HB1 sing N N 336 RJQ CB HB2 sing N N 337 RJQ CD2 HD2 sing N N 338 RJQ CE1 HE1 sing N N 339 RJQ CE2 HE2 sing N N 340 RJQ CZ HZ sing N N 341 RJQ CAM HAM sing N N 342 RJQ CAM HZL sing N N 343 RJQ CAM HZM sing N N 344 RJQ CAQ HAQ sing N N 345 RJQ CAQ HZN sing N N 346 RJQ CAR HAR sing N N 347 RJQ CAR HZO sing N N 348 RJQ CAS HAS sing N N 349 RJQ CAS HZP sing N N 350 RJQ CAX HAX sing N N 351 RJQ CAY HAY sing N N 352 RJQ CAZ HAZ sing N N 353 RJQ CBA HZQ sing N N 354 RJQ CBA HBA sing N N 355 RJQ CBB HZR sing N N 356 RJQ CBB HBB sing N N 357 RJQ CBC HBC sing N N 358 RJQ CBG HBG sing N N 359 RJQ CBK HBK sing N N 360 RJQ CBN HBN sing N N 361 RJQ CBN HZV sing N N 362 RJQ CBO HBO sing N N 363 RJQ CBO HZU sing N N 364 RJQ CBP HBP sing N N 365 RJQ CBQ HBQ sing N N 366 RJQ CBR HBR sing N N 367 RJQ CBS HBS sing N N 368 RJQ CBT HZT sing N N 369 RJQ CBT HBT sing N N 370 RJQ CBU HZS sing N N 371 RJQ CBU HBU sing N N 372 RJQ NBV HZW sing N N 373 RJQ NBV HBV sing N N 374 SER N CA sing N N 375 SER N H sing N N 376 SER N H2 sing N N 377 SER CA C sing N N 378 SER CA CB sing N N 379 SER CA HA sing N N 380 SER C O doub N N 381 SER C OXT sing N N 382 SER CB OG sing N N 383 SER CB HB2 sing N N 384 SER CB HB3 sing N N 385 SER OG HG sing N N 386 SER OXT HXT sing N N 387 THR N CA sing N N 388 THR N H sing N N 389 THR N H2 sing N N 390 THR CA C sing N N 391 THR CA CB sing N N 392 THR CA HA sing N N 393 THR C O doub N N 394 THR C OXT sing N N 395 THR CB OG1 sing N N 396 THR CB CG2 sing N N 397 THR CB HB sing N N 398 THR OG1 HG1 sing N N 399 THR CG2 HG21 sing N N 400 THR CG2 HG22 sing N N 401 THR CG2 HG23 sing N N 402 THR OXT HXT sing N N 403 TRP N CA sing N N 404 TRP N H sing N N 405 TRP N H2 sing N N 406 TRP CA C sing N N 407 TRP CA CB sing N N 408 TRP CA HA sing N N 409 TRP C O doub N N 410 TRP C OXT sing N N 411 TRP CB CG sing N N 412 TRP CB HB2 sing N N 413 TRP CB HB3 sing N N 414 TRP CG CD1 doub Y N 415 TRP CG CD2 sing Y N 416 TRP CD1 NE1 sing Y N 417 TRP CD1 HD1 sing N N 418 TRP CD2 CE2 doub Y N 419 TRP CD2 CE3 sing Y N 420 TRP NE1 CE2 sing Y N 421 TRP NE1 HE1 sing N N 422 TRP CE2 CZ2 sing Y N 423 TRP CE3 CZ3 doub Y N 424 TRP CE3 HE3 sing N N 425 TRP CZ2 CH2 doub Y N 426 TRP CZ2 HZ2 sing N N 427 TRP CZ3 CH2 sing Y N 428 TRP CZ3 HZ3 sing N N 429 TRP CH2 HH2 sing N N 430 TRP OXT HXT sing N N 431 TYR N CA sing N N 432 TYR N H sing N N 433 TYR N H2 sing N N 434 TYR CA C sing N N 435 TYR CA CB sing N N 436 TYR CA HA sing N N 437 TYR C O doub N N 438 TYR C OXT sing N N 439 TYR CB CG sing N N 440 TYR CB HB2 sing N N 441 TYR CB HB3 sing N N 442 TYR CG CD1 doub Y N 443 TYR CG CD2 sing Y N 444 TYR CD1 CE1 sing Y N 445 TYR CD1 HD1 sing N N 446 TYR CD2 CE2 doub Y N 447 TYR CD2 HD2 sing N N 448 TYR CE1 CZ doub Y N 449 TYR CE1 HE1 sing N N 450 TYR CE2 CZ sing Y N 451 TYR CE2 HE2 sing N N 452 TYR CZ OH sing N N 453 TYR OH HH sing N N 454 TYR OXT HXT sing N N 455 VAL N CA sing N N 456 VAL N H sing N N 457 VAL N H2 sing N N 458 VAL CA C sing N N 459 VAL CA CB sing N N 460 VAL CA HA sing N N 461 VAL C O doub N N 462 VAL C OXT sing N N 463 VAL CB CG1 sing N N 464 VAL CB CG2 sing N N 465 VAL CB HB sing N N 466 VAL CG1 HG11 sing N N 467 VAL CG1 HG12 sing N N 468 VAL CG1 HG13 sing N N 469 VAL CG2 HG21 sing N N 470 VAL CG2 HG22 sing N N 471 VAL CG2 HG23 sing N N 472 VAL OXT HXT sing N N 473 # _pdbx_audit_support.funding_organization 'German Federal Ministry for Education and Research' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number 16GW0186K _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id RJQ _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id RJQ _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5N91 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'C 2 2 21' _space_group.name_Hall 'C 2c 2' _space_group.IT_number 20 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 7AKI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.028818 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016477 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011228 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_