data_7AVB # _entry.id 7AVB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7AVB pdb_00007avb 10.2210/pdb7avb/pdb WWPDB D_1292112135 ? ? BMRB 34573 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of the fluorogen-activating protein FAST in the apo state' _pdbx_database_related.db_id 34573 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7AVB _pdbx_database_status.recvd_initial_deposition_date 2020-11-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mineev, K.S.' 1 0000-0002-2418-9421 'Goncharuk, S.A.' 2 0000-0002-0263-6462 'Baranov, M.S.' 3 0000-0002-9339-7603 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Chem Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-6520 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 6719 _citation.page_last 6725 _citation.title 'NanoFAST: structure-based design of a small fluorogen-activating protein with only 98 amino acids.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/d1sc01454d _citation.pdbx_database_id_PubMed 34040747 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mineev, K.S.' 1 0000-0002-2418-9421 primary 'Goncharuk, S.A.' 2 ? primary 'Goncharuk, M.V.' 3 ? primary 'Povarova, N.V.' 4 ? primary 'Sokolov, A.I.' 5 ? primary 'Baleeva, N.S.' 6 ? primary 'Smirnov, A.Y.' 7 0000-0002-1545-6604 primary 'Myasnyanko, I.N.' 8 0000-0002-2168-3555 primary 'Ruchkin, D.A.' 9 ? primary 'Bukhdruker, S.' 10 ? primary 'Remeeva, A.' 11 ? primary 'Mishin, A.' 12 0000-0003-3759-380X primary 'Borshchevskiy, V.' 13 ? primary 'Gordeliy, V.' 14 ? primary 'Arseniev, A.S.' 15 ? primary 'Gorbachev, D.A.' 16 ? primary 'Gavrikov, A.S.' 17 ? primary 'Mishin, A.S.' 18 0000-0002-4935-7030 primary 'Baranov, M.S.' 19 0000-0002-9339-7603 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7AVB _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7AVB _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description FAST _entity.formula_weight 15249.174 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPGTDSPEFYGKFK EGVASGNLNTMFEWMIPTSRGPTKVKVHMKKALSGDSYWVFVKRVKLAAALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPGTDSPEFYGKFK EGVASGNLNTMFEWMIPTSRGPTKVKVHMKKALSGDSYWVFVKRVKLAAALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 HIS n 1 4 VAL n 1 5 ALA n 1 6 PHE n 1 7 GLY n 1 8 SER n 1 9 GLU n 1 10 ASP n 1 11 ILE n 1 12 GLU n 1 13 ASN n 1 14 THR n 1 15 LEU n 1 16 ALA n 1 17 LYS n 1 18 MET n 1 19 ASP n 1 20 ASP n 1 21 GLY n 1 22 GLN n 1 23 LEU n 1 24 ASP n 1 25 GLY n 1 26 LEU n 1 27 ALA n 1 28 PHE n 1 29 GLY n 1 30 ALA n 1 31 ILE n 1 32 GLN n 1 33 LEU n 1 34 ASP n 1 35 GLY n 1 36 ASP n 1 37 GLY n 1 38 ASN n 1 39 ILE n 1 40 LEU n 1 41 GLN n 1 42 TYR n 1 43 ASN n 1 44 ALA n 1 45 ALA n 1 46 GLU n 1 47 GLY n 1 48 ASP n 1 49 ILE n 1 50 THR n 1 51 GLY n 1 52 ARG n 1 53 ASP n 1 54 PRO n 1 55 LYS n 1 56 GLN n 1 57 VAL n 1 58 ILE n 1 59 GLY n 1 60 LYS n 1 61 ASN n 1 62 PHE n 1 63 PHE n 1 64 LYS n 1 65 ASP n 1 66 VAL n 1 67 ALA n 1 68 PRO n 1 69 GLY n 1 70 THR n 1 71 ASP n 1 72 SER n 1 73 PRO n 1 74 GLU n 1 75 PHE n 1 76 TYR n 1 77 GLY n 1 78 LYS n 1 79 PHE n 1 80 LYS n 1 81 GLU n 1 82 GLY n 1 83 VAL n 1 84 ALA n 1 85 SER n 1 86 GLY n 1 87 ASN n 1 88 LEU n 1 89 ASN n 1 90 THR n 1 91 MET n 1 92 PHE n 1 93 GLU n 1 94 TRP n 1 95 MET n 1 96 ILE n 1 97 PRO n 1 98 THR n 1 99 SER n 1 100 ARG n 1 101 GLY n 1 102 PRO n 1 103 THR n 1 104 LYS n 1 105 VAL n 1 106 LYS n 1 107 VAL n 1 108 HIS n 1 109 MET n 1 110 LYS n 1 111 LYS n 1 112 ALA n 1 113 LEU n 1 114 SER n 1 115 GLY n 1 116 ASP n 1 117 SER n 1 118 TYR n 1 119 TRP n 1 120 VAL n 1 121 PHE n 1 122 VAL n 1 123 LYS n 1 124 ARG n 1 125 VAL n 1 126 LYS n 1 127 LEU n 1 128 ALA n 1 129 ALA n 1 130 ALA n 1 131 LEU n 1 132 GLU n 1 133 HIS n 1 134 HIS n 1 135 HIS n 1 136 HIS n 1 137 HIS n 1 138 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 138 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7AVB _struct_ref.pdbx_db_accession 7AVB _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7AVB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 138 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7AVB _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 138 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 138 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 2 1 1 '2D 1H-15N HSQC' 1 isotropic 3 1 1 '3D HNCO' 1 isotropic 4 1 1 '3D HNCACB' 1 isotropic 5 1 1 '3D HNCA' 1 isotropic 6 1 1 '3D HN(CO)CA' 1 isotropic 7 1 1 '3D 1H-15N NOESY' 1 isotropic 8 1 2 '3D 1H-13C NOESY aliphatic' 1 isotropic 9 1 2 '3D 1H-13C NOESY aromatic' 1 isotropic 10 1 1 '3D HNHA' 1 isotropic 11 1 2 '3D HCCH-TOCSY' 1 isotropic 12 1 2 '3D HCCH-COSY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 318 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 40 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.02 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '1 mM [U-13C; U-15N] FAST, 20 mM sodium phosphate, 20 mM sodium chloride, 0.1 % sodium azide, 95% H2O/5% D2O' '95% H2O/5% D2O' H2O solution ? 2 '1 mM [U-13C; U-15N] FAST, 20 mM sodium phosphate, 20 mM sodium chloride, 0.1 % sodium azide, 100% D2O' '100% D2O' D2O solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 7AVB _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 7AVB _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7AVB _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA 3.98.13 'Guntert, Mumenthaler and Wuthrich' 2 'chemical shift assignment' CARA 3.98.13 'Keller and Wuthrich' 3 processing TopSpin ? 'Bruker Biospin' 4 'data analysis' TALOS-N ? Bax 5 processing qMDD ? 'Orekhov, Mayzel' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7AVB _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7AVB _struct.title 'Solution structure of the fluorogen-activating protein FAST in the apo state' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7AVB _struct_keywords.text 'Fluorogen-activating protein PAS domain, FLUORESCENT PROTEIN' _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 10 ? LEU A 15 ? ASP A 10 LEU A 15 1 ? 6 HELX_P HELX_P2 AA2 ASP A 53 ? ILE A 58 ? ASP A 53 ILE A 58 1 ? 6 HELX_P HELX_P3 AA3 PHE A 75 ? GLY A 86 ? PHE A 75 GLY A 86 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 39 ? ALA A 44 ? ILE A 39 ALA A 44 AA1 2 GLY A 29 ? LEU A 33 ? GLY A 29 LEU A 33 AA1 3 TYR A 118 ? ARG A 124 ? TYR A 118 ARG A 124 AA1 4 GLY A 101 ? LYS A 111 ? GLY A 101 LYS A 111 AA1 5 THR A 90 ? THR A 98 ? THR A 90 THR A 98 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 40 ? O LEU A 40 N GLN A 32 ? N GLN A 32 AA1 2 3 N LEU A 33 ? N LEU A 33 O TYR A 118 ? O TYR A 118 AA1 3 4 O PHE A 121 ? O PHE A 121 N HIS A 108 ? N HIS A 108 AA1 4 5 O VAL A 105 ? O VAL A 105 N TRP A 94 ? N TRP A 94 # _database_PDB_matrix.entry_id 7AVB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 7AVB _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 MET 91 91 91 MET MET A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 TRP 94 94 94 TRP TRP A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 TRP 119 119 119 TRP TRP A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 HIS 134 134 134 HIS HIS A . n A 1 135 HIS 135 135 135 HIS HIS A . n A 1 136 HIS 136 136 136 HIS HIS A . n A 1 137 HIS 137 137 137 HIS HIS A . n A 1 138 HIS 138 138 138 HIS HIS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 11510 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-04-28 2 'Structure model' 1 1 2021-06-09 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_id_ISSN' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation_author.identifier_ORCID' 9 3 'Structure model' '_database_2.pdbx_DOI' 10 3 'Structure model' '_database_2.pdbx_database_accession' 11 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 FAST 1 ? mM '[U-13C; U-15N]' 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 'sodium chloride' 20 ? mM 'natural abundance' 1 'sodium azide' 0.1 ? % 'natural abundance' 2 FAST 1 ? mM '[U-13C; U-15N]' 2 'sodium phosphate' 20 ? mM 'natural abundance' 2 'sodium chloride' 20 ? mM 'natural abundance' 2 'sodium azide' 0.1 ? % 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 27 ? ? -174.98 148.91 2 1 GLU A 46 ? ? -108.77 41.39 3 1 ASP A 65 ? ? -129.37 -69.79 4 1 ALA A 67 ? ? -114.54 76.65 5 1 ASP A 71 ? ? -69.61 80.96 6 1 ASN A 87 ? ? -174.22 89.70 7 1 VAL A 125 ? ? -60.63 98.01 8 1 LYS A 126 ? ? -173.01 132.40 9 1 ALA A 128 ? ? -122.68 -62.89 10 1 ALA A 130 ? ? -134.98 -46.71 11 2 MET A 18 ? ? -107.08 -70.15 12 2 ASP A 65 ? ? -126.90 -68.96 13 2 ASN A 87 ? ? -178.85 103.29 14 2 ASP A 116 ? ? -69.69 84.82 15 2 LEU A 127 ? ? -52.67 103.27 16 2 HIS A 133 ? ? -61.86 -176.40 17 3 GLU A 2 ? ? -128.52 -54.17 18 3 VAL A 4 ? ? -174.74 127.39 19 3 SER A 8 ? ? -171.22 134.12 20 3 LEU A 23 ? ? -175.19 112.89 21 3 ASP A 65 ? ? -126.74 -68.82 22 3 ASP A 71 ? ? -69.41 83.36 23 3 ASN A 87 ? ? -178.43 87.86 24 3 LEU A 127 ? ? -65.50 -179.06 25 4 GLU A 46 ? ? -58.36 105.06 26 4 ILE A 49 ? ? -59.07 176.10 27 4 ASP A 65 ? ? -129.29 -70.79 28 4 ALA A 67 ? ? -114.73 76.98 29 4 ASN A 87 ? ? -177.83 98.69 30 4 ASP A 116 ? ? -60.25 96.93 31 5 HIS A 3 ? ? -169.89 115.64 32 5 ASP A 10 ? ? -116.79 55.88 33 5 GLN A 22 ? ? -59.17 -176.43 34 5 THR A 50 ? ? -109.08 -61.09 35 5 ASP A 65 ? ? -127.13 -68.72 36 5 ASN A 87 ? ? -179.28 82.14 37 5 ALA A 112 ? ? -57.16 177.06 38 5 VAL A 125 ? ? -57.74 104.79 39 5 ALA A 128 ? ? -131.74 -55.94 40 6 LEU A 23 ? ? 63.15 76.87 41 6 ALA A 27 ? ? -171.18 -179.87 42 6 ASP A 65 ? ? -126.73 -68.79 43 6 ASN A 87 ? ? -169.37 81.86 44 6 LYS A 126 ? ? -124.67 -54.33 45 6 LEU A 127 ? ? -171.66 -179.81 46 6 ALA A 129 ? ? -172.22 140.25 47 7 GLU A 46 ? ? -101.71 50.33 48 7 THR A 50 ? ? -67.96 -177.22 49 7 ASP A 65 ? ? -126.70 -68.73 50 7 ASN A 87 ? ? -179.65 95.98 51 7 ALA A 129 ? ? -129.10 -72.04 52 7 HIS A 133 ? ? -109.43 68.24 53 8 LEU A 15 ? ? -53.92 106.83 54 8 GLU A 46 ? ? -100.35 59.85 55 8 THR A 50 ? ? -173.09 140.59 56 8 ASP A 65 ? ? -129.29 -69.96 57 8 ALA A 67 ? ? -114.56 77.32 58 8 ASP A 71 ? ? -68.36 84.04 59 8 ASN A 87 ? ? -175.87 83.29 60 8 HIS A 133 ? ? -98.28 -65.47 61 8 HIS A 134 ? ? -174.60 144.12 62 8 HIS A 136 ? ? -105.08 77.55 63 9 ASP A 24 ? ? -60.76 99.06 64 9 GLN A 41 ? ? -172.08 131.51 65 9 ASP A 65 ? ? -127.05 -68.74 66 9 ASP A 71 ? ? -68.26 83.27 67 9 ASN A 87 ? ? -175.98 91.97 68 10 LEU A 15 ? ? 53.13 88.75 69 10 ALA A 16 ? ? 62.18 93.14 70 10 ALA A 27 ? ? -58.41 -177.57 71 10 ALA A 44 ? ? -111.18 -73.10 72 10 ASP A 65 ? ? -129.30 -70.67 73 10 ALA A 67 ? ? -114.05 76.59 74 10 ASN A 87 ? ? -178.71 95.01 75 10 VAL A 125 ? ? -57.25 100.59 76 10 ALA A 130 ? ? -106.49 43.22 77 10 GLU A 132 ? ? -107.60 68.76 78 11 LEU A 15 ? ? -61.66 99.95 79 11 ALA A 27 ? ? -84.31 -70.65 80 11 ASP A 65 ? ? -127.10 -70.81 81 11 ASP A 71 ? ? -69.63 81.29 82 11 ASN A 87 ? ? -179.06 101.32 83 11 HIS A 134 ? ? -93.44 -62.94 84 12 SER A 8 ? ? -160.25 109.07 85 12 THR A 50 ? ? -73.03 -73.79 86 12 ASP A 65 ? ? -126.13 -68.25 87 12 ASN A 87 ? ? -179.34 97.90 88 13 ALA A 5 ? ? -172.94 142.33 89 13 ALA A 16 ? ? -63.41 -75.39 90 13 GLN A 22 ? ? -67.64 -177.15 91 13 ASP A 65 ? ? -126.81 -69.62 92 13 ALA A 67 ? ? -114.20 77.22 93 13 ASN A 87 ? ? -175.18 94.95 94 13 ASP A 116 ? ? -60.58 96.25 95 13 ALA A 128 ? ? -62.89 94.06 96 13 LEU A 131 ? ? -109.56 78.59 97 14 ASP A 10 ? ? -106.59 44.35 98 14 GLN A 41 ? ? -176.13 138.34 99 14 ASP A 65 ? ? -126.85 -69.08 100 14 ASP A 71 ? ? -69.00 83.66 101 14 ASN A 87 ? ? -176.51 86.13 102 14 ARG A 124 ? ? -49.96 153.77 103 15 PHE A 6 ? ? -172.83 140.47 104 15 ARG A 52 ? ? -52.96 171.23 105 15 ASP A 65 ? ? -129.52 -71.46 106 15 ALA A 67 ? ? -114.52 76.44 107 15 ASN A 87 ? ? -178.87 99.16 108 15 ASP A 116 ? ? -56.89 102.78 109 15 LEU A 127 ? ? -52.78 103.23 110 16 GLN A 22 ? ? -63.62 -178.33 111 16 ALA A 45 ? ? -51.90 103.85 112 16 ILE A 49 ? ? -54.68 170.23 113 16 ASP A 65 ? ? -129.33 -70.26 114 16 ALA A 67 ? ? -114.00 76.37 115 16 ASP A 71 ? ? -68.21 84.22 116 16 ASN A 87 ? ? -171.07 80.45 117 16 HIS A 135 ? ? -115.06 73.53 118 17 PHE A 6 ? ? -165.36 118.56 119 17 SER A 8 ? ? -172.34 127.61 120 17 LEU A 15 ? ? -56.29 101.81 121 17 ASP A 65 ? ? -126.87 -68.87 122 17 ASN A 87 ? ? -179.73 107.30 123 17 ASP A 116 ? ? -58.15 101.38 124 17 LYS A 126 ? ? -52.14 -74.41 125 17 ALA A 128 ? ? -176.80 138.13 126 17 HIS A 135 ? ? -110.59 56.68 127 18 ALA A 5 ? ? -170.64 149.60 128 18 LEU A 15 ? ? -61.06 96.85 129 18 LEU A 23 ? ? -173.68 143.76 130 18 ASP A 24 ? ? -59.49 104.93 131 18 ALA A 27 ? ? 65.44 114.45 132 18 THR A 50 ? ? -177.45 120.40 133 18 ASP A 65 ? ? -129.47 -68.66 134 18 ASN A 87 ? ? -169.41 82.13 135 18 ALA A 112 ? ? -55.09 173.47 136 18 LEU A 131 ? ? -108.39 75.99 137 18 HIS A 135 ? ? -120.13 -54.52 138 19 ALA A 44 ? ? -171.31 147.48 139 19 ASP A 65 ? ? -126.97 -69.24 140 19 ASN A 87 ? ? -178.32 91.77 141 19 ASP A 116 ? ? -54.89 101.13 142 19 HIS A 133 ? ? -171.11 146.19 143 19 HIS A 136 ? ? -173.40 145.93 144 20 ASP A 65 ? ? -126.68 -69.56 145 20 ASN A 87 ? ? -178.95 97.35 146 20 ASP A 116 ? ? -56.97 102.48 147 20 ALA A 128 ? ? -58.79 -178.18 148 20 HIS A 136 ? ? -106.05 64.72 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR relaxation study' _pdbx_struct_assembly_auth_evidence.details ? #