data_7AWL # _entry.id 7AWL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7AWL pdb_00007awl 10.2210/pdb7awl/pdb WWPDB D_1292112223 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-10-13 2 'Structure model' 1 1 2021-12-01 3 'Structure model' 1 2 2022-01-12 4 'Structure model' 1 3 2022-01-19 5 'Structure model' 1 4 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' citation 6 4 'Structure model' citation_author 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' 13 2 'Structure model' '_citation_author.name' 14 3 'Structure model' '_citation.journal_volume' 15 3 'Structure model' '_citation.page_first' 16 3 'Structure model' '_citation.page_last' 17 3 'Structure model' '_citation.year' 18 3 'Structure model' '_citation_author.identifier_ORCID' 19 4 'Structure model' '_citation.page_first' 20 4 'Structure model' '_citation.page_last' 21 4 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7AWL _pdbx_database_status.recvd_initial_deposition_date 2020-11-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Canul-Tec, J.C.' 1 0000-0003-0513-545X 'Legrand, P.' 2 0000-0003-2431-2255 'Reyes, N.' 3 0000-0001-6618-8307 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Embo J.' _citation.journal_id_ASTM EMJODG _citation.journal_id_CSD 0897 _citation.journal_id_ISSN 1460-2075 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 41 _citation.language ? _citation.page_first e108341 _citation.page_last e108341 _citation.title 'The ion-coupling mechanism of human excitatory amino acid transporters.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.15252/embj.2021108341 _citation.pdbx_database_id_PubMed 34747040 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Canul-Tec, J.C.' 1 0000-0003-0513-545X primary 'Kumar, A.' 2 0000-0002-2997-9959 primary 'Dhenin, J.' 3 0000-0001-6615-2363 primary 'Assal, R.' 4 ? primary 'Legrand, P.' 5 0000-0003-2431-2255 primary 'Rey, M.' 6 ? primary 'Chamot-Rooke, J.' 7 ? primary 'Reyes, N.' 8 0000-0001-6618-8307 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Excitatory amino acid transporter 1, Neutral amino acid transporter, Excitatory amino acid transporter, Transporter protein' 56460.324 1 ? ? ? 'Barium and inhibitor UCPH101' 2 non-polymer syn '2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile' 422.475 1 ? ? ? ? 3 non-polymer syn 'BARIUM ION' 137.327 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTKSNGEEPKMGGRMERFQQGVSKRTLLAKKKVQNITKEDVKSFLRRNALLLLTVLAVILGVVLGFLLRPYPLSPREVKY FAFPGELLMRMLKMLILPLIVSSLITGLASLDAKASGRLGMRAVVYYMSTTIIAVVLGIILVLIIHPGAASAAITASVGA AGSAENAPSKEVLDCFLDLARNIFPSNLVSAAFRSYSTTYEERTITGTRVKVPVGQEVEGMNILGLVVFSIVFGIALGKM GEQGQLLVDFFNSLNEATMKLVAIIMWYAPLGILFLIAGKIVEMEDLEVLGGQLGMYMVTVIVGLVIHGLIVLPLIYFLI TRKNPFVFIAGILQALITALGTSSSSATLPITFKCLEENNGVDKRITRFVLPVGATINMDGTALYEAVAAIFIAQVNNYE LDFGQIITISITATAASIGAAGIPQAGLVTMVIVLTAVGLPTDDITLIIAVDWLLDRFRTMVNVLGDALGAGIVEHLSRK ELEKQDAELGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM ; _entity_poly.pdbx_seq_one_letter_code_can ;MTKSNGEEPKMGGRMERFQQGVSKRTLLAKKKVQNITKEDVKSFLRRNALLLLTVLAVILGVVLGFLLRPYPLSPREVKY FAFPGELLMRMLKMLILPLIVSSLITGLASLDAKASGRLGMRAVVYYMSTTIIAVVLGIILVLIIHPGAASAAITASVGA AGSAENAPSKEVLDCFLDLARNIFPSNLVSAAFRSYSTTYEERTITGTRVKVPVGQEVEGMNILGLVVFSIVFGIALGKM GEQGQLLVDFFNSLNEATMKLVAIIMWYAPLGILFLIAGKIVEMEDLEVLGGQLGMYMVTVIVGLVIHGLIVLPLIYFLI TRKNPFVFIAGILQALITALGTSSSSATLPITFKCLEENNGVDKRITRFVLPVGATINMDGTALYEAVAAIFIAQVNNYE LDFGQIITISITATAASIGAAGIPQAGLVTMVIVLTAVGLPTDDITLIIAVDWLLDRFRTMVNVLGDALGAGIVEHLSRK ELEKQDAELGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile' 6Z6 3 'BARIUM ION' BA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 LYS n 1 4 SER n 1 5 ASN n 1 6 GLY n 1 7 GLU n 1 8 GLU n 1 9 PRO n 1 10 LYS n 1 11 MET n 1 12 GLY n 1 13 GLY n 1 14 ARG n 1 15 MET n 1 16 GLU n 1 17 ARG n 1 18 PHE n 1 19 GLN n 1 20 GLN n 1 21 GLY n 1 22 VAL n 1 23 SER n 1 24 LYS n 1 25 ARG n 1 26 THR n 1 27 LEU n 1 28 LEU n 1 29 ALA n 1 30 LYS n 1 31 LYS n 1 32 LYS n 1 33 VAL n 1 34 GLN n 1 35 ASN n 1 36 ILE n 1 37 THR n 1 38 LYS n 1 39 GLU n 1 40 ASP n 1 41 VAL n 1 42 LYS n 1 43 SER n 1 44 PHE n 1 45 LEU n 1 46 ARG n 1 47 ARG n 1 48 ASN n 1 49 ALA n 1 50 LEU n 1 51 LEU n 1 52 LEU n 1 53 LEU n 1 54 THR n 1 55 VAL n 1 56 LEU n 1 57 ALA n 1 58 VAL n 1 59 ILE n 1 60 LEU n 1 61 GLY n 1 62 VAL n 1 63 VAL n 1 64 LEU n 1 65 GLY n 1 66 PHE n 1 67 LEU n 1 68 LEU n 1 69 ARG n 1 70 PRO n 1 71 TYR n 1 72 PRO n 1 73 LEU n 1 74 SER n 1 75 PRO n 1 76 ARG n 1 77 GLU n 1 78 VAL n 1 79 LYS n 1 80 TYR n 1 81 PHE n 1 82 ALA n 1 83 PHE n 1 84 PRO n 1 85 GLY n 1 86 GLU n 1 87 LEU n 1 88 LEU n 1 89 MET n 1 90 ARG n 1 91 MET n 1 92 LEU n 1 93 LYS n 1 94 MET n 1 95 LEU n 1 96 ILE n 1 97 LEU n 1 98 PRO n 1 99 LEU n 1 100 ILE n 1 101 VAL n 1 102 SER n 1 103 SER n 1 104 LEU n 1 105 ILE n 1 106 THR n 1 107 GLY n 1 108 LEU n 1 109 ALA n 1 110 SER n 1 111 LEU n 1 112 ASP n 1 113 ALA n 1 114 LYS n 1 115 ALA n 1 116 SER n 1 117 GLY n 1 118 ARG n 1 119 LEU n 1 120 GLY n 1 121 MET n 1 122 ARG n 1 123 ALA n 1 124 VAL n 1 125 VAL n 1 126 TYR n 1 127 TYR n 1 128 MET n 1 129 SER n 1 130 THR n 1 131 THR n 1 132 ILE n 1 133 ILE n 1 134 ALA n 1 135 VAL n 1 136 VAL n 1 137 LEU n 1 138 GLY n 1 139 ILE n 1 140 ILE n 1 141 LEU n 1 142 VAL n 1 143 LEU n 1 144 ILE n 1 145 ILE n 1 146 HIS n 1 147 PRO n 1 148 GLY n 1 149 ALA n 1 150 ALA n 1 151 SER n 1 152 ALA n 1 153 ALA n 1 154 ILE n 1 155 THR n 1 156 ALA n 1 157 SER n 1 158 VAL n 1 159 GLY n 1 160 ALA n 1 161 ALA n 1 162 GLY n 1 163 SER n 1 164 ALA n 1 165 GLU n 1 166 ASN n 1 167 ALA n 1 168 PRO n 1 169 SER n 1 170 LYS n 1 171 GLU n 1 172 VAL n 1 173 LEU n 1 174 ASP n 1 175 CYS n 1 176 PHE n 1 177 LEU n 1 178 ASP n 1 179 LEU n 1 180 ALA n 1 181 ARG n 1 182 ASN n 1 183 ILE n 1 184 PHE n 1 185 PRO n 1 186 SER n 1 187 ASN n 1 188 LEU n 1 189 VAL n 1 190 SER n 1 191 ALA n 1 192 ALA n 1 193 PHE n 1 194 ARG n 1 195 SER n 1 196 TYR n 1 197 SER n 1 198 THR n 1 199 THR n 1 200 TYR n 1 201 GLU n 1 202 GLU n 1 203 ARG n 1 204 THR n 1 205 ILE n 1 206 THR n 1 207 GLY n 1 208 THR n 1 209 ARG n 1 210 VAL n 1 211 LYS n 1 212 VAL n 1 213 PRO n 1 214 VAL n 1 215 GLY n 1 216 GLN n 1 217 GLU n 1 218 VAL n 1 219 GLU n 1 220 GLY n 1 221 MET n 1 222 ASN n 1 223 ILE n 1 224 LEU n 1 225 GLY n 1 226 LEU n 1 227 VAL n 1 228 VAL n 1 229 PHE n 1 230 SER n 1 231 ILE n 1 232 VAL n 1 233 PHE n 1 234 GLY n 1 235 ILE n 1 236 ALA n 1 237 LEU n 1 238 GLY n 1 239 LYS n 1 240 MET n 1 241 GLY n 1 242 GLU n 1 243 GLN n 1 244 GLY n 1 245 GLN n 1 246 LEU n 1 247 LEU n 1 248 VAL n 1 249 ASP n 1 250 PHE n 1 251 PHE n 1 252 ASN n 1 253 SER n 1 254 LEU n 1 255 ASN n 1 256 GLU n 1 257 ALA n 1 258 THR n 1 259 MET n 1 260 LYS n 1 261 LEU n 1 262 VAL n 1 263 ALA n 1 264 ILE n 1 265 ILE n 1 266 MET n 1 267 TRP n 1 268 TYR n 1 269 ALA n 1 270 PRO n 1 271 LEU n 1 272 GLY n 1 273 ILE n 1 274 LEU n 1 275 PHE n 1 276 LEU n 1 277 ILE n 1 278 ALA n 1 279 GLY n 1 280 LYS n 1 281 ILE n 1 282 VAL n 1 283 GLU n 1 284 MET n 1 285 GLU n 1 286 ASP n 1 287 LEU n 1 288 GLU n 1 289 VAL n 1 290 LEU n 1 291 GLY n 1 292 GLY n 1 293 GLN n 1 294 LEU n 1 295 GLY n 1 296 MET n 1 297 TYR n 1 298 MET n 1 299 VAL n 1 300 THR n 1 301 VAL n 1 302 ILE n 1 303 VAL n 1 304 GLY n 1 305 LEU n 1 306 VAL n 1 307 ILE n 1 308 HIS n 1 309 GLY n 1 310 LEU n 1 311 ILE n 1 312 VAL n 1 313 LEU n 1 314 PRO n 1 315 LEU n 1 316 ILE n 1 317 TYR n 1 318 PHE n 1 319 LEU n 1 320 ILE n 1 321 THR n 1 322 ARG n 1 323 LYS n 1 324 ASN n 1 325 PRO n 1 326 PHE n 1 327 VAL n 1 328 PHE n 1 329 ILE n 1 330 ALA n 1 331 GLY n 1 332 ILE n 1 333 LEU n 1 334 GLN n 1 335 ALA n 1 336 LEU n 1 337 ILE n 1 338 THR n 1 339 ALA n 1 340 LEU n 1 341 GLY n 1 342 THR n 1 343 SER n 1 344 SER n 1 345 SER n 1 346 SER n 1 347 ALA n 1 348 THR n 1 349 LEU n 1 350 PRO n 1 351 ILE n 1 352 THR n 1 353 PHE n 1 354 LYS n 1 355 CYS n 1 356 LEU n 1 357 GLU n 1 358 GLU n 1 359 ASN n 1 360 ASN n 1 361 GLY n 1 362 VAL n 1 363 ASP n 1 364 LYS n 1 365 ARG n 1 366 ILE n 1 367 THR n 1 368 ARG n 1 369 PHE n 1 370 VAL n 1 371 LEU n 1 372 PRO n 1 373 VAL n 1 374 GLY n 1 375 ALA n 1 376 THR n 1 377 ILE n 1 378 ASN n 1 379 MET n 1 380 ASP n 1 381 GLY n 1 382 THR n 1 383 ALA n 1 384 LEU n 1 385 TYR n 1 386 GLU n 1 387 ALA n 1 388 VAL n 1 389 ALA n 1 390 ALA n 1 391 ILE n 1 392 PHE n 1 393 ILE n 1 394 ALA n 1 395 GLN n 1 396 VAL n 1 397 ASN n 1 398 ASN n 1 399 TYR n 1 400 GLU n 1 401 LEU n 1 402 ASP n 1 403 PHE n 1 404 GLY n 1 405 GLN n 1 406 ILE n 1 407 ILE n 1 408 THR n 1 409 ILE n 1 410 SER n 1 411 ILE n 1 412 THR n 1 413 ALA n 1 414 THR n 1 415 ALA n 1 416 ALA n 1 417 SER n 1 418 ILE n 1 419 GLY n 1 420 ALA n 1 421 ALA n 1 422 GLY n 1 423 ILE n 1 424 PRO n 1 425 GLN n 1 426 ALA n 1 427 GLY n 1 428 LEU n 1 429 VAL n 1 430 THR n 1 431 MET n 1 432 VAL n 1 433 ILE n 1 434 VAL n 1 435 LEU n 1 436 THR n 1 437 ALA n 1 438 VAL n 1 439 GLY n 1 440 LEU n 1 441 PRO n 1 442 THR n 1 443 ASP n 1 444 ASP n 1 445 ILE n 1 446 THR n 1 447 LEU n 1 448 ILE n 1 449 ILE n 1 450 ALA n 1 451 VAL n 1 452 ASP n 1 453 TRP n 1 454 LEU n 1 455 LEU n 1 456 ASP n 1 457 ARG n 1 458 PHE n 1 459 ARG n 1 460 THR n 1 461 MET n 1 462 VAL n 1 463 ASN n 1 464 VAL n 1 465 LEU n 1 466 GLY n 1 467 ASP n 1 468 ALA n 1 469 LEU n 1 470 GLY n 1 471 ALA n 1 472 GLY n 1 473 ILE n 1 474 VAL n 1 475 GLU n 1 476 HIS n 1 477 LEU n 1 478 SER n 1 479 ARG n 1 480 LYS n 1 481 GLU n 1 482 LEU n 1 483 GLU n 1 484 LYS n 1 485 GLN n 1 486 ASP n 1 487 ALA n 1 488 GLU n 1 489 LEU n 1 490 GLY n 1 491 ASN n 1 492 SER n 1 493 VAL n 1 494 ILE n 1 495 GLU n 1 496 GLU n 1 497 ASN n 1 498 GLU n 1 499 MET n 1 500 LYS n 1 501 LYS n 1 502 PRO n 1 503 TYR n 1 504 GLN n 1 505 LEU n 1 506 ILE n 1 507 ALA n 1 508 GLN n 1 509 ASP n 1 510 ASN n 1 511 GLU n 1 512 THR n 1 513 GLU n 1 514 LYS n 1 515 PRO n 1 516 ILE n 1 517 ASP n 1 518 SER n 1 519 GLU n 1 520 THR n 1 521 LYS n 1 522 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 522 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SLC1A3, EAAT1, GLAST' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name Human _entity_src_gen.pdbx_host_org_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 9606 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue 'embrionic kidney' _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line HEK-293F _entity_src_gen.pdbx_host_org_atcc CRL-1573 _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell embrionic _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pcDNA3.1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 6Z6 non-polymer . '2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile' ? 'C27 H22 N2 O3' 422.475 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BA non-polymer . 'BARIUM ION' ? 'Ba 2' 137.327 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 ASN 5 5 ? ? ? A . n A 1 6 GLY 6 6 ? ? ? A . n A 1 7 GLU 7 7 ? ? ? A . n A 1 8 GLU 8 8 ? ? ? A . n A 1 9 PRO 9 9 ? ? ? A . n A 1 10 LYS 10 10 ? ? ? A . n A 1 11 MET 11 11 ? ? ? A . n A 1 12 GLY 12 12 ? ? ? A . n A 1 13 GLY 13 13 ? ? ? A . n A 1 14 ARG 14 14 ? ? ? A . n A 1 15 MET 15 15 ? ? ? A . n A 1 16 GLU 16 16 ? ? ? A . n A 1 17 ARG 17 17 ? ? ? A . n A 1 18 PHE 18 18 ? ? ? A . n A 1 19 GLN 19 19 ? ? ? A . n A 1 20 GLN 20 20 ? ? ? A . n A 1 21 GLY 21 21 ? ? ? A . n A 1 22 VAL 22 22 ? ? ? A . n A 1 23 SER 23 23 ? ? ? A . n A 1 24 LYS 24 24 ? ? ? A . n A 1 25 ARG 25 25 ? ? ? A . n A 1 26 THR 26 26 ? ? ? A . n A 1 27 LEU 27 27 ? ? ? A . n A 1 28 LEU 28 28 ? ? ? A . n A 1 29 ALA 29 29 ? ? ? A . n A 1 30 LYS 30 30 ? ? ? A . n A 1 31 LYS 31 31 ? ? ? A . n A 1 32 LYS 32 32 ? ? ? A . n A 1 33 VAL 33 33 ? ? ? A . n A 1 34 GLN 34 34 ? ? ? A . n A 1 35 ASN 35 35 ? ? ? A . n A 1 36 ILE 36 36 ? ? ? A . n A 1 37 THR 37 37 ? ? ? A . n A 1 38 LYS 38 38 ? ? ? A . n A 1 39 GLU 39 39 ? ? ? A . n A 1 40 ASP 40 40 ? ? ? A . n A 1 41 VAL 41 41 ? ? ? A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 MET 89 89 89 MET MET A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 MET 91 91 91 MET MET A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 MET 94 94 94 MET MET A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 MET 121 121 121 MET MET A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 TYR 126 126 126 TYR TYR A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 MET 128 128 128 MET MET A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 HIS 146 146 146 HIS HIS A . n A 1 147 PRO 147 147 147 PRO PRO A . n A 1 148 GLY 148 148 ? ? ? A . n A 1 149 ALA 149 149 ? ? ? A . n A 1 150 ALA 150 150 ? ? ? A . n A 1 151 SER 151 151 ? ? ? A . n A 1 152 ALA 152 152 ? ? ? A . n A 1 153 ALA 153 153 ? ? ? A . n A 1 154 ILE 154 154 ? ? ? A . n A 1 155 THR 155 155 ? ? ? A . n A 1 156 ALA 156 156 ? ? ? A . n A 1 157 SER 157 157 ? ? ? A . n A 1 158 VAL 158 158 ? ? ? A . n A 1 159 GLY 159 159 ? ? ? A . n A 1 160 ALA 160 160 ? ? ? A . n A 1 161 ALA 161 161 ? ? ? A . n A 1 162 GLY 162 162 ? ? ? A . n A 1 163 SER 163 163 ? ? ? A . n A 1 164 ALA 164 164 ? ? ? A . n A 1 165 GLU 165 165 ? ? ? A . n A 1 166 ASN 166 166 ? ? ? A . n A 1 167 ALA 167 167 ? ? ? A . n A 1 168 PRO 168 168 ? ? ? A . n A 1 169 SER 169 169 ? ? ? A . n A 1 170 LYS 170 170 170 LYS LYS A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 CYS 175 175 175 CYS CYS A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 ASP 178 178 178 ASP ASP A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 ARG 181 181 181 ARG ARG A . n A 1 182 ASN 182 182 182 ASN ASN A . n A 1 183 ILE 183 183 183 ILE ILE A . n A 1 184 PHE 184 184 184 PHE PHE A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 SER 186 186 186 SER SER A . n A 1 187 ASN 187 187 187 ASN ASN A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 PHE 193 193 193 PHE PHE A . n A 1 194 ARG 194 194 194 ARG ARG A . n A 1 195 SER 195 195 195 SER SER A . n A 1 196 TYR 196 196 196 TYR TYR A . n A 1 197 SER 197 197 197 SER SER A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 TYR 200 200 200 TYR TYR A . n A 1 201 GLU 201 201 ? ? ? A . n A 1 202 GLU 202 202 ? ? ? A . n A 1 203 ARG 203 203 ? ? ? A . n A 1 204 THR 204 204 ? ? ? A . n A 1 205 ILE 205 205 ? ? ? A . n A 1 206 THR 206 206 ? ? ? A . n A 1 207 GLY 207 207 ? ? ? A . n A 1 208 THR 208 208 ? ? ? A . n A 1 209 ARG 209 209 ? ? ? A . n A 1 210 VAL 210 210 ? ? ? A . n A 1 211 LYS 211 211 ? ? ? A . n A 1 212 VAL 212 212 ? ? ? A . n A 1 213 PRO 213 213 ? ? ? A . n A 1 214 VAL 214 214 ? ? ? A . n A 1 215 GLY 215 215 215 GLY GLY A . n A 1 216 GLN 216 216 216 GLN GLN A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 VAL 218 218 218 VAL VAL A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 MET 221 221 221 MET MET A . n A 1 222 ASN 222 222 222 ASN ASN A . n A 1 223 ILE 223 223 223 ILE ILE A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 GLY 225 225 225 GLY GLY A . n A 1 226 LEU 226 226 226 LEU LEU A . n A 1 227 VAL 227 227 227 VAL VAL A . n A 1 228 VAL 228 228 228 VAL VAL A . n A 1 229 PHE 229 229 229 PHE PHE A . n A 1 230 SER 230 230 230 SER SER A . n A 1 231 ILE 231 231 231 ILE ILE A . n A 1 232 VAL 232 232 232 VAL VAL A . n A 1 233 PHE 233 233 233 PHE PHE A . n A 1 234 GLY 234 234 234 GLY GLY A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 ALA 236 236 236 ALA ALA A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 GLY 238 238 238 GLY GLY A . n A 1 239 LYS 239 239 239 LYS LYS A . n A 1 240 MET 240 240 240 MET MET A . n A 1 241 GLY 241 241 241 GLY GLY A . n A 1 242 GLU 242 242 242 GLU GLU A . n A 1 243 GLN 243 243 243 GLN GLN A . n A 1 244 GLY 244 244 244 GLY GLY A . n A 1 245 GLN 245 245 245 GLN GLN A . n A 1 246 LEU 246 246 246 LEU LEU A . n A 1 247 LEU 247 247 247 LEU LEU A . n A 1 248 VAL 248 248 248 VAL VAL A . n A 1 249 ASP 249 249 249 ASP ASP A . n A 1 250 PHE 250 250 250 PHE PHE A . n A 1 251 PHE 251 251 251 PHE PHE A . n A 1 252 ASN 252 252 252 ASN ASN A . n A 1 253 SER 253 253 253 SER SER A . n A 1 254 LEU 254 254 254 LEU LEU A . n A 1 255 ASN 255 255 255 ASN ASN A . n A 1 256 GLU 256 256 256 GLU GLU A . n A 1 257 ALA 257 257 257 ALA ALA A . n A 1 258 THR 258 258 258 THR THR A . n A 1 259 MET 259 259 259 MET MET A . n A 1 260 LYS 260 260 260 LYS LYS A . n A 1 261 LEU 261 261 261 LEU LEU A . n A 1 262 VAL 262 262 262 VAL VAL A . n A 1 263 ALA 263 263 263 ALA ALA A . n A 1 264 ILE 264 264 264 ILE ILE A . n A 1 265 ILE 265 265 265 ILE ILE A . n A 1 266 MET 266 266 266 MET MET A . n A 1 267 TRP 267 267 267 TRP TRP A . n A 1 268 TYR 268 268 268 TYR TYR A . n A 1 269 ALA 269 269 269 ALA ALA A . n A 1 270 PRO 270 270 270 PRO PRO A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 GLY 272 272 272 GLY GLY A . n A 1 273 ILE 273 273 273 ILE ILE A . n A 1 274 LEU 274 274 274 LEU LEU A . n A 1 275 PHE 275 275 275 PHE PHE A . n A 1 276 LEU 276 276 276 LEU LEU A . n A 1 277 ILE 277 277 277 ILE ILE A . n A 1 278 ALA 278 278 278 ALA ALA A . n A 1 279 GLY 279 279 279 GLY GLY A . n A 1 280 LYS 280 280 280 LYS LYS A . n A 1 281 ILE 281 281 281 ILE ILE A . n A 1 282 VAL 282 282 282 VAL VAL A . n A 1 283 GLU 283 283 283 GLU GLU A . n A 1 284 MET 284 284 ? ? ? A . n A 1 285 GLU 285 285 ? ? ? A . n A 1 286 ASP 286 286 ? ? ? A . n A 1 287 LEU 287 287 ? ? ? A . n A 1 288 GLU 288 288 ? ? ? A . n A 1 289 VAL 289 289 ? ? ? A . n A 1 290 LEU 290 290 ? ? ? A . n A 1 291 GLY 291 291 ? ? ? A . n A 1 292 GLY 292 292 ? ? ? A . n A 1 293 GLN 293 293 ? ? ? A . n A 1 294 LEU 294 294 ? ? ? A . n A 1 295 GLY 295 295 295 GLY GLY A . n A 1 296 MET 296 296 296 MET MET A . n A 1 297 TYR 297 297 297 TYR TYR A . n A 1 298 MET 298 298 298 MET MET A . n A 1 299 VAL 299 299 299 VAL VAL A . n A 1 300 THR 300 300 300 THR THR A . n A 1 301 VAL 301 301 301 VAL VAL A . n A 1 302 ILE 302 302 302 ILE ILE A . n A 1 303 VAL 303 303 303 VAL VAL A . n A 1 304 GLY 304 304 304 GLY GLY A . n A 1 305 LEU 305 305 305 LEU LEU A . n A 1 306 VAL 306 306 306 VAL VAL A . n A 1 307 ILE 307 307 307 ILE ILE A . n A 1 308 HIS 308 308 308 HIS HIS A . n A 1 309 GLY 309 309 309 GLY GLY A . n A 1 310 LEU 310 310 310 LEU LEU A . n A 1 311 ILE 311 311 311 ILE ILE A . n A 1 312 VAL 312 312 312 VAL VAL A . n A 1 313 LEU 313 313 313 LEU LEU A . n A 1 314 PRO 314 314 314 PRO PRO A . n A 1 315 LEU 315 315 315 LEU LEU A . n A 1 316 ILE 316 316 316 ILE ILE A . n A 1 317 TYR 317 317 317 TYR TYR A . n A 1 318 PHE 318 318 318 PHE PHE A . n A 1 319 LEU 319 319 319 LEU LEU A . n A 1 320 ILE 320 320 320 ILE ILE A . n A 1 321 THR 321 321 321 THR THR A . n A 1 322 ARG 322 322 322 ARG ARG A . n A 1 323 LYS 323 323 323 LYS LYS A . n A 1 324 ASN 324 324 324 ASN ASN A . n A 1 325 PRO 325 325 325 PRO PRO A . n A 1 326 PHE 326 326 326 PHE PHE A . n A 1 327 VAL 327 327 327 VAL VAL A . n A 1 328 PHE 328 328 328 PHE PHE A . n A 1 329 ILE 329 329 329 ILE ILE A . n A 1 330 ALA 330 330 330 ALA ALA A . n A 1 331 GLY 331 331 331 GLY GLY A . n A 1 332 ILE 332 332 332 ILE ILE A . n A 1 333 LEU 333 333 333 LEU LEU A . n A 1 334 GLN 334 334 334 GLN GLN A . n A 1 335 ALA 335 335 335 ALA ALA A . n A 1 336 LEU 336 336 336 LEU LEU A . n A 1 337 ILE 337 337 337 ILE ILE A . n A 1 338 THR 338 338 338 THR THR A . n A 1 339 ALA 339 339 339 ALA ALA A . n A 1 340 LEU 340 340 340 LEU LEU A . n A 1 341 GLY 341 341 341 GLY GLY A . n A 1 342 THR 342 342 342 THR THR A . n A 1 343 SER 343 343 343 SER SER A . n A 1 344 SER 344 344 344 SER SER A . n A 1 345 SER 345 345 345 SER SER A . n A 1 346 SER 346 346 346 SER SER A . n A 1 347 ALA 347 347 347 ALA ALA A . n A 1 348 THR 348 348 348 THR THR A . n A 1 349 LEU 349 349 349 LEU LEU A . n A 1 350 PRO 350 350 350 PRO PRO A . n A 1 351 ILE 351 351 351 ILE ILE A . n A 1 352 THR 352 352 352 THR THR A . n A 1 353 PHE 353 353 353 PHE PHE A . n A 1 354 LYS 354 354 354 LYS LYS A . n A 1 355 CYS 355 355 355 CYS CYS A . n A 1 356 LEU 356 356 356 LEU LEU A . n A 1 357 GLU 357 357 357 GLU GLU A . n A 1 358 GLU 358 358 358 GLU GLU A . n A 1 359 ASN 359 359 359 ASN ASN A . n A 1 360 ASN 360 360 360 ASN ASN A . n A 1 361 GLY 361 361 361 GLY GLY A . n A 1 362 VAL 362 362 362 VAL VAL A . n A 1 363 ASP 363 363 363 ASP ASP A . n A 1 364 LYS 364 364 364 LYS LYS A . n A 1 365 ARG 365 365 365 ARG ARG A . n A 1 366 ILE 366 366 366 ILE ILE A . n A 1 367 THR 367 367 367 THR THR A . n A 1 368 ARG 368 368 368 ARG ARG A . n A 1 369 PHE 369 369 369 PHE PHE A . n A 1 370 VAL 370 370 370 VAL VAL A . n A 1 371 LEU 371 371 371 LEU LEU A . n A 1 372 PRO 372 372 372 PRO PRO A . n A 1 373 VAL 373 373 373 VAL VAL A . n A 1 374 GLY 374 374 374 GLY GLY A . n A 1 375 ALA 375 375 375 ALA ALA A . n A 1 376 THR 376 376 376 THR THR A . n A 1 377 ILE 377 377 377 ILE ILE A . n A 1 378 ASN 378 378 378 ASN ASN A . n A 1 379 MET 379 379 379 MET MET A . n A 1 380 ASP 380 380 380 ASP ASP A . n A 1 381 GLY 381 381 381 GLY GLY A . n A 1 382 THR 382 382 382 THR THR A . n A 1 383 ALA 383 383 383 ALA ALA A . n A 1 384 LEU 384 384 384 LEU LEU A . n A 1 385 TYR 385 385 385 TYR TYR A . n A 1 386 GLU 386 386 386 GLU GLU A . n A 1 387 ALA 387 387 387 ALA ALA A . n A 1 388 VAL 388 388 388 VAL VAL A . n A 1 389 ALA 389 389 389 ALA ALA A . n A 1 390 ALA 390 390 390 ALA ALA A . n A 1 391 ILE 391 391 391 ILE ILE A . n A 1 392 PHE 392 392 392 PHE PHE A . n A 1 393 ILE 393 393 393 ILE ILE A . n A 1 394 ALA 394 394 394 ALA ALA A . n A 1 395 GLN 395 395 395 GLN GLN A . n A 1 396 VAL 396 396 396 VAL VAL A . n A 1 397 ASN 397 397 ? ? ? A . n A 1 398 ASN 398 398 ? ? ? A . n A 1 399 TYR 399 399 ? ? ? A . n A 1 400 GLU 400 400 ? ? ? A . n A 1 401 LEU 401 401 ? ? ? A . n A 1 402 ASP 402 402 ? ? ? A . n A 1 403 PHE 403 403 ? ? ? A . n A 1 404 GLY 404 404 ? ? ? A . n A 1 405 GLN 405 405 ? ? ? A . n A 1 406 ILE 406 406 406 ILE ILE A . n A 1 407 ILE 407 407 407 ILE ILE A . n A 1 408 THR 408 408 408 THR THR A . n A 1 409 ILE 409 409 409 ILE ILE A . n A 1 410 SER 410 410 410 SER SER A . n A 1 411 ILE 411 411 411 ILE ILE A . n A 1 412 THR 412 412 412 THR THR A . n A 1 413 ALA 413 413 413 ALA ALA A . n A 1 414 THR 414 414 414 THR THR A . n A 1 415 ALA 415 415 415 ALA ALA A . n A 1 416 ALA 416 416 416 ALA ALA A . n A 1 417 SER 417 417 417 SER SER A . n A 1 418 ILE 418 418 418 ILE ILE A . n A 1 419 GLY 419 419 419 GLY GLY A . n A 1 420 ALA 420 420 420 ALA ALA A . n A 1 421 ALA 421 421 421 ALA ALA A . n A 1 422 GLY 422 422 422 GLY GLY A . n A 1 423 ILE 423 423 423 ILE ILE A . n A 1 424 PRO 424 424 424 PRO PRO A . n A 1 425 GLN 425 425 425 GLN GLN A . n A 1 426 ALA 426 426 426 ALA ALA A . n A 1 427 GLY 427 427 427 GLY GLY A . n A 1 428 LEU 428 428 428 LEU LEU A . n A 1 429 VAL 429 429 429 VAL VAL A . n A 1 430 THR 430 430 430 THR THR A . n A 1 431 MET 431 431 431 MET MET A . n A 1 432 VAL 432 432 432 VAL VAL A . n A 1 433 ILE 433 433 433 ILE ILE A . n A 1 434 VAL 434 434 434 VAL VAL A . n A 1 435 LEU 435 435 435 LEU LEU A . n A 1 436 THR 436 436 436 THR THR A . n A 1 437 ALA 437 437 437 ALA ALA A . n A 1 438 VAL 438 438 438 VAL VAL A . n A 1 439 GLY 439 439 439 GLY GLY A . n A 1 440 LEU 440 440 440 LEU LEU A . n A 1 441 PRO 441 441 441 PRO PRO A . n A 1 442 THR 442 442 442 THR THR A . n A 1 443 ASP 443 443 443 ASP ASP A . n A 1 444 ASP 444 444 444 ASP ASP A . n A 1 445 ILE 445 445 445 ILE ILE A . n A 1 446 THR 446 446 446 THR THR A . n A 1 447 LEU 447 447 447 LEU LEU A . n A 1 448 ILE 448 448 448 ILE ILE A . n A 1 449 ILE 449 449 449 ILE ILE A . n A 1 450 ALA 450 450 450 ALA ALA A . n A 1 451 VAL 451 451 451 VAL VAL A . n A 1 452 ASP 452 452 452 ASP ASP A . n A 1 453 TRP 453 453 453 TRP TRP A . n A 1 454 LEU 454 454 454 LEU LEU A . n A 1 455 LEU 455 455 455 LEU LEU A . n A 1 456 ASP 456 456 456 ASP ASP A . n A 1 457 ARG 457 457 457 ARG ARG A . n A 1 458 PHE 458 458 458 PHE PHE A . n A 1 459 ARG 459 459 459 ARG ARG A . n A 1 460 THR 460 460 460 THR THR A . n A 1 461 MET 461 461 461 MET MET A . n A 1 462 VAL 462 462 462 VAL VAL A . n A 1 463 ASN 463 463 463 ASN ASN A . n A 1 464 VAL 464 464 464 VAL VAL A . n A 1 465 LEU 465 465 465 LEU LEU A . n A 1 466 GLY 466 466 466 GLY GLY A . n A 1 467 ASP 467 467 467 ASP ASP A . n A 1 468 ALA 468 468 468 ALA ALA A . n A 1 469 LEU 469 469 469 LEU LEU A . n A 1 470 GLY 470 470 470 GLY GLY A . n A 1 471 ALA 471 471 471 ALA ALA A . n A 1 472 GLY 472 472 472 GLY GLY A . n A 1 473 ILE 473 473 473 ILE ILE A . n A 1 474 VAL 474 474 474 VAL VAL A . n A 1 475 GLU 475 475 475 GLU GLU A . n A 1 476 HIS 476 476 476 HIS HIS A . n A 1 477 LEU 477 477 477 LEU LEU A . n A 1 478 SER 478 478 478 SER SER A . n A 1 479 ARG 479 479 479 ARG ARG A . n A 1 480 LYS 480 480 480 LYS LYS A . n A 1 481 GLU 481 481 481 GLU GLU A . n A 1 482 LEU 482 482 482 LEU LEU A . n A 1 483 GLU 483 483 483 GLU GLU A . n A 1 484 LYS 484 484 484 LYS LYS A . n A 1 485 GLN 485 485 485 GLN GLN A . n A 1 486 ASP 486 486 486 ASP ASP A . n A 1 487 ALA 487 487 ? ? ? A . n A 1 488 GLU 488 488 ? ? ? A . n A 1 489 LEU 489 489 ? ? ? A . n A 1 490 GLY 490 490 ? ? ? A . n A 1 491 ASN 491 491 ? ? ? A . n A 1 492 SER 492 492 ? ? ? A . n A 1 493 VAL 493 493 ? ? ? A . n A 1 494 ILE 494 494 ? ? ? A . n A 1 495 GLU 495 495 ? ? ? A . n A 1 496 GLU 496 496 ? ? ? A . n A 1 497 ASN 497 497 ? ? ? A . n A 1 498 GLU 498 498 ? ? ? A . n A 1 499 MET 499 499 ? ? ? A . n A 1 500 LYS 500 500 ? ? ? A . n A 1 501 LYS 501 501 ? ? ? A . n A 1 502 PRO 502 502 ? ? ? A . n A 1 503 TYR 503 503 ? ? ? A . n A 1 504 GLN 504 504 ? ? ? A . n A 1 505 LEU 505 505 ? ? ? A . n A 1 506 ILE 506 506 ? ? ? A . n A 1 507 ALA 507 507 ? ? ? A . n A 1 508 GLN 508 508 ? ? ? A . n A 1 509 ASP 509 509 ? ? ? A . n A 1 510 ASN 510 510 ? ? ? A . n A 1 511 GLU 511 511 ? ? ? A . n A 1 512 THR 512 512 ? ? ? A . n A 1 513 GLU 513 513 ? ? ? A . n A 1 514 LYS 514 514 ? ? ? A . n A 1 515 PRO 515 515 ? ? ? A . n A 1 516 ILE 516 516 ? ? ? A . n A 1 517 ASP 517 517 ? ? ? A . n A 1 518 SER 518 518 ? ? ? A . n A 1 519 GLU 519 519 ? ? ? A . n A 1 520 THR 520 520 ? ? ? A . n A 1 521 LYS 521 521 ? ? ? A . n A 1 522 MET 522 522 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 6Z6 1 601 503 6Z6 UCP A . C 3 BA 1 602 504 BA BA A . D 3 BA 1 603 505 BA BA A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'Jan 31, 2020 Built=20200417' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? 'Jan 31, 2020 Buit=2020417' 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.7.17 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.3 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7AWL _cell.details ? _cell.formula_units_Z ? _cell.length_a 124.940 _cell.length_a_esd ? _cell.length_b 124.940 _cell.length_b_esd ? _cell.length_c 92.020 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7AWL _symmetry.cell_setting ? _symmetry.Int_Tables_number 173 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 63' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7AWL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.67 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 66.50 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '32% PEG400, 100 mM Tris pH 8.2, 50 mM Calcium chloride, 50 mM Barium chloride' _exptl_crystal_grow.pdbx_pH_range 8-8.4 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-09-23 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'channel cut monochromator' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9786 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9786 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 1' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate 120.500 _reflns.entry_id 7AWL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.700 _reflns.d_resolution_low 22.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8827 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20.546 _reflns.pdbx_Rmerge_I_obs 0.125 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.760 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.823 _reflns.pdbx_scaling_rejects 172 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.129 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 181357 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 3.700 3.800 ? 0.550 ? 13338 658 ? 657 99.800 ? ? ? ? 6.785 ? ? ? ? ? ? ? ? 20.301 ? ? ? ? 6.958 ? ? 1 1 0.401 ? ? ? ? ? ? ? ? ? ? 3.800 3.900 ? 0.930 ? 12740 633 ? 632 99.800 ? ? ? ? 4.227 ? ? ? ? ? ? ? ? 20.158 ? ? ? ? 4.337 ? ? 2 1 0.648 ? ? ? ? ? ? ? ? ? ? 3.900 4.010 ? 1.920 ? 12565 598 ? 597 99.800 ? ? ? ? 2.223 ? ? ? ? ? ? ? ? 21.047 ? ? ? ? 2.278 ? ? 3 1 0.873 ? ? ? ? ? ? ? ? ? ? 4.010 4.140 ? 2.360 ? 12638 605 ? 605 100.000 ? ? ? ? 1.719 ? ? ? ? ? ? ? ? 20.889 ? ? ? ? 1.761 ? ? 4 1 0.921 ? ? ? ? ? ? ? ? ? ? 4.140 4.270 ? 3.000 ? 11864 580 ? 580 100.000 ? ? ? ? 1.268 ? ? ? ? ? ? ? ? 20.455 ? ? ? ? 1.300 ? ? 5 1 0.925 ? ? ? ? ? ? ? ? ? ? 4.270 4.420 ? 4.370 ? 12013 565 ? 564 99.800 ? ? ? ? 0.913 ? ? ? ? ? ? ? ? 21.300 ? ? ? ? 0.935 ? ? 6 1 0.957 ? ? ? ? ? ? ? ? ? ? 4.420 4.590 ? 6.200 ? 11426 542 ? 542 100.000 ? ? ? ? 0.581 ? ? ? ? ? ? ? ? 21.081 ? ? ? ? 0.595 ? ? 7 1 0.986 ? ? ? ? ? ? ? ? ? ? 4.590 4.780 ? 7.100 ? 10057 500 ? 500 100.000 ? ? ? ? 0.442 ? ? ? ? ? ? ? ? 20.114 ? ? ? ? 0.454 ? ? 8 1 0.988 ? ? ? ? ? ? ? ? ? ? 4.780 4.990 ? 9.010 ? 10839 520 ? 520 100.000 ? ? ? ? 0.329 ? ? ? ? ? ? ? ? 20.844 ? ? ? ? 0.337 ? ? 9 1 0.996 ? ? ? ? ? ? ? ? ? ? 4.990 5.230 ? 8.970 ? 9612 474 ? 472 99.600 ? ? ? ? 0.298 ? ? ? ? ? ? ? ? 20.364 ? ? ? ? 0.305 ? ? 10 1 0.997 ? ? ? ? ? ? ? ? ? ? 5.230 5.520 ? 9.910 ? 9565 456 ? 456 100.000 ? ? ? ? 0.273 ? ? ? ? ? ? ? ? 20.976 ? ? ? ? 0.280 ? ? 11 1 0.998 ? ? ? ? ? ? ? ? ? ? 5.520 5.850 ? 11.630 ? 9037 428 ? 428 100.000 ? ? ? ? 0.269 ? ? ? ? ? ? ? ? 21.114 ? ? ? ? 0.276 ? ? 12 1 0.997 ? ? ? ? ? ? ? ? ? ? 5.850 6.260 ? 12.410 ? 8219 412 ? 412 100.000 ? ? ? ? 0.239 ? ? ? ? ? ? ? ? 19.949 ? ? ? ? 0.245 ? ? 13 1 0.995 ? ? ? ? ? ? ? ? ? ? 6.260 6.760 ? 18.340 ? 8113 386 ? 386 100.000 ? ? ? ? 0.170 ? ? ? ? ? ? ? ? 21.018 ? ? ? ? 0.174 ? ? 14 1 0.998 ? ? ? ? ? ? ? ? ? ? 6.760 7.400 ? 25.500 ? 7010 346 ? 346 100.000 ? ? ? ? 0.114 ? ? ? ? ? ? ? ? 20.260 ? ? ? ? 0.117 ? ? 15 1 0.997 ? ? ? ? ? ? ? ? ? ? 7.400 8.280 ? 37.790 ? 6568 314 ? 314 100.000 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 20.917 ? ? ? ? 0.080 ? ? 16 1 0.998 ? ? ? ? ? ? ? ? ? ? 8.280 9.560 ? 44.620 ? 5648 285 ? 285 100.000 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 19.818 ? ? ? ? 0.069 ? ? 17 1 0.999 ? ? ? ? ? ? ? ? ? ? 9.560 11.700 ? 46.980 ? 4628 237 ? 237 100.000 ? ? ? ? 0.063 ? ? ? ? ? ? ? ? 19.527 ? ? ? ? 0.064 ? ? 18 1 0.997 ? ? ? ? ? ? ? ? ? ? 11.700 16.550 ? 47.930 ? 3700 190 ? 190 100.000 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 19.474 ? ? ? ? 0.064 ? ? 19 1 0.999 ? ? ? ? ? ? ? ? ? ? 16.550 22.000 ? 47.110 ? 1777 110 ? 104 94.500 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 17.087 ? ? ? ? 0.071 ? ? 20 1 0.998 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] 8.6227 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 8.6227 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -17.2454 _refine.B_iso_max 288.760 _refine.B_iso_mean 164.8600 _refine.B_iso_min 54.560 _refine.correlation_coeff_Fo_to_Fc 0.8900 _refine.correlation_coeff_Fo_to_Fc_free 0.8510 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7AWL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.7000 _refine.ls_d_res_low 22.0000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6520 _refine.ls_number_reflns_R_free 319 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 74.2000 _refine.ls_percent_reflns_R_free 4.8900 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2400 _refine.ls_R_factor_R_free 0.2850 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2370 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5LM4 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI 0.7530 _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 7AWL _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.610 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 3.7000 _refine_hist.d_res_low 22.0000 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2987 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 389 _refine_hist.pdbx_B_iso_mean_ligand 157.77 _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2953 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 34 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? ? ? 1036 ? t_dihedral_angle_d 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 44 ? t_trig_c_planes 2.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 467 ? t_gen_planes 5.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 3034 ? t_it 20.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1 ? t_nbd 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 427 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 3785 ? t_ideal_dist_contact 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 0.009 ? 3034 ? t_bond_d 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 1.040 ? 4124 ? t_angle_deg 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 1.950 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 21.550 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.7000 _refine_ls_shell.d_res_low 4.1400 _refine_ls_shell.number_reflns_all 901 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 46 _refine_ls_shell.number_reflns_R_work 855 _refine_ls_shell.percent_reflns_obs 36.1800 _refine_ls_shell.percent_reflns_R_free 5.1100 _refine_ls_shell.R_factor_all 0.2203 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2275 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2200 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7AWL _struct.title 'Structure of the thermostabilized EAAT1 cryst-II mutant in complex with barium and the allosteric inhibitor UCPH101' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7AWL _struct_keywords.text 'excitatory amino acid transporter 1, human glutamate transporter, SLC1A3, ion-coupling mechanism, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7AWL _struct_ref.pdbx_db_accession 7AWL _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7AWL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 522 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7AWL _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 522 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 522 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 8590 ? 1 MORE -108 ? 1 'SSA (A^2)' 47700 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_545 -y,x-y-1,z -0.5000000000 -0.8660254038 0.0000000000 62.4700000000 0.8660254038 -0.5000000000 0.0000000000 -108.2012139488 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_655 -x+y+1,-x,z -0.5000000000 0.8660254038 0.0000000000 124.9400000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 42 ? ASN A 48 ? LYS A 42 ASN A 48 1 ? 7 HELX_P HELX_P2 AA2 ASN A 48 ? LEU A 68 ? ASN A 48 LEU A 68 1 ? 21 HELX_P HELX_P3 AA3 SER A 74 ? ALA A 82 ? SER A 74 ALA A 82 1 ? 9 HELX_P HELX_P4 AA4 ALA A 82 ? LEU A 111 ? ALA A 82 LEU A 111 1 ? 30 HELX_P HELX_P5 AA5 LYS A 114 ? LEU A 141 ? LYS A 114 LEU A 141 1 ? 28 HELX_P HELX_P6 AA6 LEU A 173 ? PHE A 184 ? LEU A 173 PHE A 184 1 ? 12 HELX_P HELX_P7 AA7 ASN A 187 ? ALA A 192 ? ASN A 187 ALA A 192 1 ? 6 HELX_P HELX_P8 AA8 ASN A 222 ? LYS A 239 ? ASN A 222 LYS A 239 1 ? 18 HELX_P HELX_P9 AA9 GLY A 244 ? VAL A 282 ? GLY A 244 VAL A 282 1 ? 39 HELX_P HELX_P10 AB1 MET A 296 ? ILE A 311 ? MET A 296 ILE A 311 1 ? 16 HELX_P HELX_P11 AB2 ILE A 311 ? THR A 321 ? ILE A 311 THR A 321 1 ? 11 HELX_P HELX_P12 AB3 ASN A 324 ? ILE A 332 ? ASN A 324 ILE A 332 1 ? 9 HELX_P HELX_P13 AB4 ILE A 332 ? SER A 343 ? ILE A 332 SER A 343 1 ? 12 HELX_P HELX_P14 AB5 SER A 344 ? GLU A 358 ? SER A 344 GLU A 358 1 ? 15 HELX_P HELX_P15 AB6 ASP A 363 ? ASN A 378 ? ASP A 363 ASN A 378 1 ? 16 HELX_P HELX_P16 AB7 THR A 382 ? ILE A 393 ? THR A 382 ILE A 393 1 ? 12 HELX_P HELX_P17 AB8 ILE A 407 ? GLY A 419 ? ILE A 407 GLY A 419 1 ? 13 HELX_P HELX_P18 AB9 GLN A 425 ? GLY A 439 ? GLN A 425 GLY A 439 1 ? 15 HELX_P HELX_P19 AC1 ASP A 444 ? LEU A 477 ? ASP A 444 LEU A 477 1 ? 34 HELX_P HELX_P20 AC2 SER A 478 ? ASP A 486 ? SER A 478 ASP A 486 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A TYR 127 O ? ? ? 1_555 D BA . BA ? ? A TYR 127 A BA 603 1_555 ? ? ? ? ? ? ? 2.723 ? ? metalc2 metalc ? ? A THR 130 OG1 ? ? ? 1_555 D BA . BA ? ? A THR 130 A BA 603 1_555 ? ? ? ? ? ? ? 3.359 ? ? metalc3 metalc ? ? A THR 131 OG1 ? ? ? 1_555 D BA . BA ? ? A THR 131 A BA 603 1_555 ? ? ? ? ? ? ? 2.807 ? ? metalc4 metalc ? ? A ASN 378 OD1 ? ? ? 1_555 D BA . BA ? ? A ASN 378 A BA 603 1_555 ? ? ? ? ? ? ? 2.784 ? ? metalc5 metalc ? ? A ASP 380 OD1 ? ? ? 1_555 D BA . BA ? ? A ASP 380 A BA 603 1_555 ? ? ? ? ? ? ? 2.649 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A TYR 127 ? A TYR 127 ? 1_555 BA ? D BA . ? A BA 603 ? 1_555 OG1 ? A THR 130 ? A THR 130 ? 1_555 63.4 ? 2 O ? A TYR 127 ? A TYR 127 ? 1_555 BA ? D BA . ? A BA 603 ? 1_555 OG1 ? A THR 131 ? A THR 131 ? 1_555 62.0 ? 3 OG1 ? A THR 130 ? A THR 130 ? 1_555 BA ? D BA . ? A BA 603 ? 1_555 OG1 ? A THR 131 ? A THR 131 ? 1_555 94.5 ? 4 O ? A TYR 127 ? A TYR 127 ? 1_555 BA ? D BA . ? A BA 603 ? 1_555 OD1 ? A ASN 378 ? A ASN 378 ? 1_555 157.5 ? 5 OG1 ? A THR 130 ? A THR 130 ? 1_555 BA ? D BA . ? A BA 603 ? 1_555 OD1 ? A ASN 378 ? A ASN 378 ? 1_555 99.8 ? 6 OG1 ? A THR 131 ? A THR 131 ? 1_555 BA ? D BA . ? A BA 603 ? 1_555 OD1 ? A ASN 378 ? A ASN 378 ? 1_555 138.0 ? 7 O ? A TYR 127 ? A TYR 127 ? 1_555 BA ? D BA . ? A BA 603 ? 1_555 OD1 ? A ASP 380 ? A ASP 380 ? 1_555 100.8 ? 8 OG1 ? A THR 130 ? A THR 130 ? 1_555 BA ? D BA . ? A BA 603 ? 1_555 OD1 ? A ASP 380 ? A ASP 380 ? 1_555 54.9 ? 9 OG1 ? A THR 131 ? A THR 131 ? 1_555 BA ? D BA . ? A BA 603 ? 1_555 OD1 ? A ASP 380 ? A ASP 380 ? 1_555 78.0 ? 10 OD1 ? A ASN 378 ? A ASN 378 ? 1_555 BA ? D BA . ? A BA 603 ? 1_555 OD1 ? A ASP 380 ? A ASP 380 ? 1_555 78.6 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 194 ? TYR A 196 ? ARG A 194 TYR A 196 AA1 2 GLU A 217 ? GLU A 219 ? GLU A 217 GLU A 219 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id SER _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 195 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id SER _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 195 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 218 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 218 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 146 ? ? 53.70 82.22 2 1 PHE A 193 ? ? -155.18 -9.34 3 1 SER A 197 ? ? -162.09 111.22 4 1 ASN A 222 ? ? -92.07 58.68 5 1 ILE A 311 ? ? -121.40 -68.12 6 1 ARG A 479 ? ? -38.43 -33.31 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 45.1987 -38.0364 1.5606 0.1607 0.4180 -0.4468 -0.0373 0.0084 0.0860 -0.5448 0.5448 0.0000 0.3145 0.1962 0.2373 -0.2117 0.1553 0.0564 -0.0647 0.0247 -0.3204 -0.1212 -0.2189 -0.3784 'X-RAY DIFFRACTION' 2 ? refined 33.3603 -26.8595 2.0839 -0.3962 0.5290 -0.4486 0.1107 -0.0325 0.0421 2.5486 -0.0852 2.1089 0.0603 -2.3772 -0.4696 -0.0910 -0.4723 0.5633 0.1671 -0.1674 0.0029 -0.0469 -0.6114 0.2055 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 42 A 111 '{ A|42 - A|111 A|170 - A|283 }' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 1 A 170 A 283 '{ A|42 - A|111 A|170 - A|283 }' ? ? ? ? ? 'X-RAY DIFFRACTION' 3 2 A 112 A 147 '{ A|112 - A|147 A|295 - A|486 }' ? ? ? ? ? 'X-RAY DIFFRACTION' 4 2 A 295 A 486 '{ A|112 - A|147 A|295 - A|486 }' ? ? ? ? ? # _pdbx_phasing_MR.entry_id 7AWL _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 3.700 _pdbx_phasing_MR.d_res_low_rotation 46.640 _pdbx_phasing_MR.d_res_high_translation 3.700 _pdbx_phasing_MR.d_res_low_translation 46.640 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # _pdbx_entry_details.entry_id 7AWL _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A ASN 5 ? A ASN 5 6 1 Y 1 A GLY 6 ? A GLY 6 7 1 Y 1 A GLU 7 ? A GLU 7 8 1 Y 1 A GLU 8 ? A GLU 8 9 1 Y 1 A PRO 9 ? A PRO 9 10 1 Y 1 A LYS 10 ? A LYS 10 11 1 Y 1 A MET 11 ? A MET 11 12 1 Y 1 A GLY 12 ? A GLY 12 13 1 Y 1 A GLY 13 ? A GLY 13 14 1 Y 1 A ARG 14 ? A ARG 14 15 1 Y 1 A MET 15 ? A MET 15 16 1 Y 1 A GLU 16 ? A GLU 16 17 1 Y 1 A ARG 17 ? A ARG 17 18 1 Y 1 A PHE 18 ? A PHE 18 19 1 Y 1 A GLN 19 ? A GLN 19 20 1 Y 1 A GLN 20 ? A GLN 20 21 1 Y 1 A GLY 21 ? A GLY 21 22 1 Y 1 A VAL 22 ? A VAL 22 23 1 Y 1 A SER 23 ? A SER 23 24 1 Y 1 A LYS 24 ? A LYS 24 25 1 Y 1 A ARG 25 ? A ARG 25 26 1 Y 1 A THR 26 ? A THR 26 27 1 Y 1 A LEU 27 ? A LEU 27 28 1 Y 1 A LEU 28 ? A LEU 28 29 1 Y 1 A ALA 29 ? A ALA 29 30 1 Y 1 A LYS 30 ? A LYS 30 31 1 Y 1 A LYS 31 ? A LYS 31 32 1 Y 1 A LYS 32 ? A LYS 32 33 1 Y 1 A VAL 33 ? A VAL 33 34 1 Y 1 A GLN 34 ? A GLN 34 35 1 Y 1 A ASN 35 ? A ASN 35 36 1 Y 1 A ILE 36 ? A ILE 36 37 1 Y 1 A THR 37 ? A THR 37 38 1 Y 1 A LYS 38 ? A LYS 38 39 1 Y 1 A GLU 39 ? A GLU 39 40 1 Y 1 A ASP 40 ? A ASP 40 41 1 Y 1 A VAL 41 ? A VAL 41 42 1 Y 1 A GLY 148 ? A GLY 148 43 1 Y 1 A ALA 149 ? A ALA 149 44 1 Y 1 A ALA 150 ? A ALA 150 45 1 Y 1 A SER 151 ? A SER 151 46 1 Y 1 A ALA 152 ? A ALA 152 47 1 Y 1 A ALA 153 ? A ALA 153 48 1 Y 1 A ILE 154 ? A ILE 154 49 1 Y 1 A THR 155 ? A THR 155 50 1 Y 1 A ALA 156 ? A ALA 156 51 1 Y 1 A SER 157 ? A SER 157 52 1 Y 1 A VAL 158 ? A VAL 158 53 1 Y 1 A GLY 159 ? A GLY 159 54 1 Y 1 A ALA 160 ? A ALA 160 55 1 Y 1 A ALA 161 ? A ALA 161 56 1 Y 1 A GLY 162 ? A GLY 162 57 1 Y 1 A SER 163 ? A SER 163 58 1 Y 1 A ALA 164 ? A ALA 164 59 1 Y 1 A GLU 165 ? A GLU 165 60 1 Y 1 A ASN 166 ? A ASN 166 61 1 Y 1 A ALA 167 ? A ALA 167 62 1 Y 1 A PRO 168 ? A PRO 168 63 1 Y 1 A SER 169 ? A SER 169 64 1 Y 1 A GLU 201 ? A GLU 201 65 1 Y 1 A GLU 202 ? A GLU 202 66 1 Y 1 A ARG 203 ? A ARG 203 67 1 Y 1 A THR 204 ? A THR 204 68 1 Y 1 A ILE 205 ? A ILE 205 69 1 Y 1 A THR 206 ? A THR 206 70 1 Y 1 A GLY 207 ? A GLY 207 71 1 Y 1 A THR 208 ? A THR 208 72 1 Y 1 A ARG 209 ? A ARG 209 73 1 Y 1 A VAL 210 ? A VAL 210 74 1 Y 1 A LYS 211 ? A LYS 211 75 1 Y 1 A VAL 212 ? A VAL 212 76 1 Y 1 A PRO 213 ? A PRO 213 77 1 Y 1 A VAL 214 ? A VAL 214 78 1 Y 1 A MET 284 ? A MET 284 79 1 Y 1 A GLU 285 ? A GLU 285 80 1 Y 1 A ASP 286 ? A ASP 286 81 1 Y 1 A LEU 287 ? A LEU 287 82 1 Y 1 A GLU 288 ? A GLU 288 83 1 Y 1 A VAL 289 ? A VAL 289 84 1 Y 1 A LEU 290 ? A LEU 290 85 1 Y 1 A GLY 291 ? A GLY 291 86 1 Y 1 A GLY 292 ? A GLY 292 87 1 Y 1 A GLN 293 ? A GLN 293 88 1 Y 1 A LEU 294 ? A LEU 294 89 1 Y 1 A ASN 397 ? A ASN 397 90 1 Y 1 A ASN 398 ? A ASN 398 91 1 Y 1 A TYR 399 ? A TYR 399 92 1 Y 1 A GLU 400 ? A GLU 400 93 1 Y 1 A LEU 401 ? A LEU 401 94 1 Y 1 A ASP 402 ? A ASP 402 95 1 Y 1 A PHE 403 ? A PHE 403 96 1 Y 1 A GLY 404 ? A GLY 404 97 1 Y 1 A GLN 405 ? A GLN 405 98 1 Y 1 A ALA 487 ? A ALA 487 99 1 Y 1 A GLU 488 ? A GLU 488 100 1 Y 1 A LEU 489 ? A LEU 489 101 1 Y 1 A GLY 490 ? A GLY 490 102 1 Y 1 A ASN 491 ? A ASN 491 103 1 Y 1 A SER 492 ? A SER 492 104 1 Y 1 A VAL 493 ? A VAL 493 105 1 Y 1 A ILE 494 ? A ILE 494 106 1 Y 1 A GLU 495 ? A GLU 495 107 1 Y 1 A GLU 496 ? A GLU 496 108 1 Y 1 A ASN 497 ? A ASN 497 109 1 Y 1 A GLU 498 ? A GLU 498 110 1 Y 1 A MET 499 ? A MET 499 111 1 Y 1 A LYS 500 ? A LYS 500 112 1 Y 1 A LYS 501 ? A LYS 501 113 1 Y 1 A PRO 502 ? A PRO 502 114 1 Y 1 A TYR 503 ? A TYR 503 115 1 Y 1 A GLN 504 ? A GLN 504 116 1 Y 1 A LEU 505 ? A LEU 505 117 1 Y 1 A ILE 506 ? A ILE 506 118 1 Y 1 A ALA 507 ? A ALA 507 119 1 Y 1 A GLN 508 ? A GLN 508 120 1 Y 1 A ASP 509 ? A ASP 509 121 1 Y 1 A ASN 510 ? A ASN 510 122 1 Y 1 A GLU 511 ? A GLU 511 123 1 Y 1 A THR 512 ? A THR 512 124 1 Y 1 A GLU 513 ? A GLU 513 125 1 Y 1 A LYS 514 ? A LYS 514 126 1 Y 1 A PRO 515 ? A PRO 515 127 1 Y 1 A ILE 516 ? A ILE 516 128 1 Y 1 A ASP 517 ? A ASP 517 129 1 Y 1 A SER 518 ? A SER 518 130 1 Y 1 A GLU 519 ? A GLU 519 131 1 Y 1 A THR 520 ? A THR 520 132 1 Y 1 A LYS 521 ? A LYS 521 133 1 Y 1 A MET 522 ? A MET 522 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 6Z6 N1 N N N 1 6Z6 C2 C Y N 2 6Z6 O2 O N N 3 6Z6 C4 C Y N 4 6Z6 C5 C Y N 5 6Z6 C6 C Y N 6 6Z6 O1 O N N 7 6Z6 C9 C N N 8 6Z6 C8 C N N 9 6Z6 C13 C N N 10 6Z6 C14 C N N 11 6Z6 N N N N 12 6Z6 C15 C N N 13 6Z6 C16 C N N 14 6Z6 C7 C N R 15 6Z6 C3 C Y N 16 6Z6 C1 C Y N 17 6Z6 O O N N 18 6Z6 C C N N 19 6Z6 C10 C N N 20 6Z6 C11 C N S 21 6Z6 C12 C N N 22 6Z6 C17 C Y N 23 6Z6 C18 C Y N 24 6Z6 C19 C Y N 25 6Z6 C20 C Y N 26 6Z6 C21 C Y N 27 6Z6 C26 C Y N 28 6Z6 C22 C Y N 29 6Z6 C23 C Y N 30 6Z6 C24 C Y N 31 6Z6 C25 C Y N 32 6Z6 H1 H N N 33 6Z6 H2 H N N 34 6Z6 H3 H N N 35 6Z6 H4 H N N 36 6Z6 H5 H N N 37 6Z6 H6 H N N 38 6Z6 H7 H N N 39 6Z6 H8 H N N 40 6Z6 H9 H N N 41 6Z6 H10 H N N 42 6Z6 H11 H N N 43 6Z6 H12 H N N 44 6Z6 H13 H N N 45 6Z6 H14 H N N 46 6Z6 H15 H N N 47 6Z6 H16 H N N 48 6Z6 H17 H N N 49 6Z6 H18 H N N 50 6Z6 H19 H N N 51 6Z6 H20 H N N 52 6Z6 H21 H N N 53 6Z6 H22 H N N 54 ALA N N N N 55 ALA CA C N S 56 ALA C C N N 57 ALA O O N N 58 ALA CB C N N 59 ALA OXT O N N 60 ALA H H N N 61 ALA H2 H N N 62 ALA HA H N N 63 ALA HB1 H N N 64 ALA HB2 H N N 65 ALA HB3 H N N 66 ALA HXT H N N 67 ARG N N N N 68 ARG CA C N S 69 ARG C C N N 70 ARG O O N N 71 ARG CB C N N 72 ARG CG C N N 73 ARG CD C N N 74 ARG NE N N N 75 ARG CZ C N N 76 ARG NH1 N N N 77 ARG NH2 N N N 78 ARG OXT O N N 79 ARG H H N N 80 ARG H2 H N N 81 ARG HA H N N 82 ARG HB2 H N N 83 ARG HB3 H N N 84 ARG HG2 H N N 85 ARG HG3 H N N 86 ARG HD2 H N N 87 ARG HD3 H N N 88 ARG HE H N N 89 ARG HH11 H N N 90 ARG HH12 H N N 91 ARG HH21 H N N 92 ARG HH22 H N N 93 ARG HXT H N N 94 ASN N N N N 95 ASN CA C N S 96 ASN C C N N 97 ASN O O N N 98 ASN CB C N N 99 ASN CG C N N 100 ASN OD1 O N N 101 ASN ND2 N N N 102 ASN OXT O N N 103 ASN H H N N 104 ASN H2 H N N 105 ASN HA H N N 106 ASN HB2 H N N 107 ASN HB3 H N N 108 ASN HD21 H N N 109 ASN HD22 H N N 110 ASN HXT H N N 111 ASP N N N N 112 ASP CA C N S 113 ASP C C N N 114 ASP O O N N 115 ASP CB C N N 116 ASP CG C N N 117 ASP OD1 O N N 118 ASP OD2 O N N 119 ASP OXT O N N 120 ASP H H N N 121 ASP H2 H N N 122 ASP HA H N N 123 ASP HB2 H N N 124 ASP HB3 H N N 125 ASP HD2 H N N 126 ASP HXT H N N 127 BA BA BA N N 128 CYS N N N N 129 CYS CA C N R 130 CYS C C N N 131 CYS O O N N 132 CYS CB C N N 133 CYS SG S N N 134 CYS OXT O N N 135 CYS H H N N 136 CYS H2 H N N 137 CYS HA H N N 138 CYS HB2 H N N 139 CYS HB3 H N N 140 CYS HG H N N 141 CYS HXT H N N 142 GLN N N N N 143 GLN CA C N S 144 GLN C C N N 145 GLN O O N N 146 GLN CB C N N 147 GLN CG C N N 148 GLN CD C N N 149 GLN OE1 O N N 150 GLN NE2 N N N 151 GLN OXT O N N 152 GLN H H N N 153 GLN H2 H N N 154 GLN HA H N N 155 GLN HB2 H N N 156 GLN HB3 H N N 157 GLN HG2 H N N 158 GLN HG3 H N N 159 GLN HE21 H N N 160 GLN HE22 H N N 161 GLN HXT H N N 162 GLU N N N N 163 GLU CA C N S 164 GLU C C N N 165 GLU O O N N 166 GLU CB C N N 167 GLU CG C N N 168 GLU CD C N N 169 GLU OE1 O N N 170 GLU OE2 O N N 171 GLU OXT O N N 172 GLU H H N N 173 GLU H2 H N N 174 GLU HA H N N 175 GLU HB2 H N N 176 GLU HB3 H N N 177 GLU HG2 H N N 178 GLU HG3 H N N 179 GLU HE2 H N N 180 GLU HXT H N N 181 GLY N N N N 182 GLY CA C N N 183 GLY C C N N 184 GLY O O N N 185 GLY OXT O N N 186 GLY H H N N 187 GLY H2 H N N 188 GLY HA2 H N N 189 GLY HA3 H N N 190 GLY HXT H N N 191 HIS N N N N 192 HIS CA C N S 193 HIS C C N N 194 HIS O O N N 195 HIS CB C N N 196 HIS CG C Y N 197 HIS ND1 N Y N 198 HIS CD2 C Y N 199 HIS CE1 C Y N 200 HIS NE2 N Y N 201 HIS OXT O N N 202 HIS H H N N 203 HIS H2 H N N 204 HIS HA H N N 205 HIS HB2 H N N 206 HIS HB3 H N N 207 HIS HD1 H N N 208 HIS HD2 H N N 209 HIS HE1 H N N 210 HIS HE2 H N N 211 HIS HXT H N N 212 ILE N N N N 213 ILE CA C N S 214 ILE C C N N 215 ILE O O N N 216 ILE CB C N S 217 ILE CG1 C N N 218 ILE CG2 C N N 219 ILE CD1 C N N 220 ILE OXT O N N 221 ILE H H N N 222 ILE H2 H N N 223 ILE HA H N N 224 ILE HB H N N 225 ILE HG12 H N N 226 ILE HG13 H N N 227 ILE HG21 H N N 228 ILE HG22 H N N 229 ILE HG23 H N N 230 ILE HD11 H N N 231 ILE HD12 H N N 232 ILE HD13 H N N 233 ILE HXT H N N 234 LEU N N N N 235 LEU CA C N S 236 LEU C C N N 237 LEU O O N N 238 LEU CB C N N 239 LEU CG C N N 240 LEU CD1 C N N 241 LEU CD2 C N N 242 LEU OXT O N N 243 LEU H H N N 244 LEU H2 H N N 245 LEU HA H N N 246 LEU HB2 H N N 247 LEU HB3 H N N 248 LEU HG H N N 249 LEU HD11 H N N 250 LEU HD12 H N N 251 LEU HD13 H N N 252 LEU HD21 H N N 253 LEU HD22 H N N 254 LEU HD23 H N N 255 LEU HXT H N N 256 LYS N N N N 257 LYS CA C N S 258 LYS C C N N 259 LYS O O N N 260 LYS CB C N N 261 LYS CG C N N 262 LYS CD C N N 263 LYS CE C N N 264 LYS NZ N N N 265 LYS OXT O N N 266 LYS H H N N 267 LYS H2 H N N 268 LYS HA H N N 269 LYS HB2 H N N 270 LYS HB3 H N N 271 LYS HG2 H N N 272 LYS HG3 H N N 273 LYS HD2 H N N 274 LYS HD3 H N N 275 LYS HE2 H N N 276 LYS HE3 H N N 277 LYS HZ1 H N N 278 LYS HZ2 H N N 279 LYS HZ3 H N N 280 LYS HXT H N N 281 MET N N N N 282 MET CA C N S 283 MET C C N N 284 MET O O N N 285 MET CB C N N 286 MET CG C N N 287 MET SD S N N 288 MET CE C N N 289 MET OXT O N N 290 MET H H N N 291 MET H2 H N N 292 MET HA H N N 293 MET HB2 H N N 294 MET HB3 H N N 295 MET HG2 H N N 296 MET HG3 H N N 297 MET HE1 H N N 298 MET HE2 H N N 299 MET HE3 H N N 300 MET HXT H N N 301 PHE N N N N 302 PHE CA C N S 303 PHE C C N N 304 PHE O O N N 305 PHE CB C N N 306 PHE CG C Y N 307 PHE CD1 C Y N 308 PHE CD2 C Y N 309 PHE CE1 C Y N 310 PHE CE2 C Y N 311 PHE CZ C Y N 312 PHE OXT O N N 313 PHE H H N N 314 PHE H2 H N N 315 PHE HA H N N 316 PHE HB2 H N N 317 PHE HB3 H N N 318 PHE HD1 H N N 319 PHE HD2 H N N 320 PHE HE1 H N N 321 PHE HE2 H N N 322 PHE HZ H N N 323 PHE HXT H N N 324 PRO N N N N 325 PRO CA C N S 326 PRO C C N N 327 PRO O O N N 328 PRO CB C N N 329 PRO CG C N N 330 PRO CD C N N 331 PRO OXT O N N 332 PRO H H N N 333 PRO HA H N N 334 PRO HB2 H N N 335 PRO HB3 H N N 336 PRO HG2 H N N 337 PRO HG3 H N N 338 PRO HD2 H N N 339 PRO HD3 H N N 340 PRO HXT H N N 341 SER N N N N 342 SER CA C N S 343 SER C C N N 344 SER O O N N 345 SER CB C N N 346 SER OG O N N 347 SER OXT O N N 348 SER H H N N 349 SER H2 H N N 350 SER HA H N N 351 SER HB2 H N N 352 SER HB3 H N N 353 SER HG H N N 354 SER HXT H N N 355 THR N N N N 356 THR CA C N S 357 THR C C N N 358 THR O O N N 359 THR CB C N R 360 THR OG1 O N N 361 THR CG2 C N N 362 THR OXT O N N 363 THR H H N N 364 THR H2 H N N 365 THR HA H N N 366 THR HB H N N 367 THR HG1 H N N 368 THR HG21 H N N 369 THR HG22 H N N 370 THR HG23 H N N 371 THR HXT H N N 372 TRP N N N N 373 TRP CA C N S 374 TRP C C N N 375 TRP O O N N 376 TRP CB C N N 377 TRP CG C Y N 378 TRP CD1 C Y N 379 TRP CD2 C Y N 380 TRP NE1 N Y N 381 TRP CE2 C Y N 382 TRP CE3 C Y N 383 TRP CZ2 C Y N 384 TRP CZ3 C Y N 385 TRP CH2 C Y N 386 TRP OXT O N N 387 TRP H H N N 388 TRP H2 H N N 389 TRP HA H N N 390 TRP HB2 H N N 391 TRP HB3 H N N 392 TRP HD1 H N N 393 TRP HE1 H N N 394 TRP HE3 H N N 395 TRP HZ2 H N N 396 TRP HZ3 H N N 397 TRP HH2 H N N 398 TRP HXT H N N 399 TYR N N N N 400 TYR CA C N S 401 TYR C C N N 402 TYR O O N N 403 TYR CB C N N 404 TYR CG C Y N 405 TYR CD1 C Y N 406 TYR CD2 C Y N 407 TYR CE1 C Y N 408 TYR CE2 C Y N 409 TYR CZ C Y N 410 TYR OH O N N 411 TYR OXT O N N 412 TYR H H N N 413 TYR H2 H N N 414 TYR HA H N N 415 TYR HB2 H N N 416 TYR HB3 H N N 417 TYR HD1 H N N 418 TYR HD2 H N N 419 TYR HE1 H N N 420 TYR HE2 H N N 421 TYR HH H N N 422 TYR HXT H N N 423 VAL N N N N 424 VAL CA C N S 425 VAL C C N N 426 VAL O O N N 427 VAL CB C N N 428 VAL CG1 C N N 429 VAL CG2 C N N 430 VAL OXT O N N 431 VAL H H N N 432 VAL H2 H N N 433 VAL HA H N N 434 VAL HB H N N 435 VAL HG11 H N N 436 VAL HG12 H N N 437 VAL HG13 H N N 438 VAL HG21 H N N 439 VAL HG22 H N N 440 VAL HG23 H N N 441 VAL HXT H N N 442 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 6Z6 C O sing N N 1 6Z6 O C1 sing N N 2 6Z6 C1 C2 doub Y N 3 6Z6 C1 C6 sing Y N 4 6Z6 C2 C3 sing Y N 5 6Z6 C6 C5 doub Y N 6 6Z6 C3 C4 doub Y N 7 6Z6 C5 C4 sing Y N 8 6Z6 C4 C7 sing N N 9 6Z6 N1 C16 trip N N 10 6Z6 C16 C15 sing N N 11 6Z6 C7 C15 sing N N 12 6Z6 C7 C8 sing N N 13 6Z6 O1 C9 doub N N 14 6Z6 C15 C14 doub N N 15 6Z6 C8 C9 sing N N 16 6Z6 C8 C13 doub N N 17 6Z6 C9 C10 sing N N 18 6Z6 C14 N sing N N 19 6Z6 C14 O2 sing N N 20 6Z6 C24 C25 doub Y N 21 6Z6 C24 C23 sing Y N 22 6Z6 C13 O2 sing N N 23 6Z6 C13 C12 sing N N 24 6Z6 C10 C11 sing N N 25 6Z6 C25 C26 sing Y N 26 6Z6 C23 C22 doub Y N 27 6Z6 C12 C11 sing N N 28 6Z6 C11 C17 sing N N 29 6Z6 C26 C17 doub Y N 30 6Z6 C26 C21 sing Y N 31 6Z6 C17 C18 sing Y N 32 6Z6 C22 C21 sing Y N 33 6Z6 C21 C20 doub Y N 34 6Z6 C18 C19 doub Y N 35 6Z6 C20 C19 sing Y N 36 6Z6 C2 H1 sing N N 37 6Z6 C5 H2 sing N N 38 6Z6 C6 H3 sing N N 39 6Z6 N H4 sing N N 40 6Z6 N H5 sing N N 41 6Z6 C3 H6 sing N N 42 6Z6 C H7 sing N N 43 6Z6 C H8 sing N N 44 6Z6 C H9 sing N N 45 6Z6 C10 H10 sing N N 46 6Z6 C10 H11 sing N N 47 6Z6 C11 H12 sing N N 48 6Z6 C12 H13 sing N N 49 6Z6 C12 H14 sing N N 50 6Z6 C18 H15 sing N N 51 6Z6 C19 H16 sing N N 52 6Z6 C20 H17 sing N N 53 6Z6 C22 H18 sing N N 54 6Z6 C23 H19 sing N N 55 6Z6 C24 H20 sing N N 56 6Z6 C25 H21 sing N N 57 6Z6 C7 H22 sing N N 58 ALA N CA sing N N 59 ALA N H sing N N 60 ALA N H2 sing N N 61 ALA CA C sing N N 62 ALA CA CB sing N N 63 ALA CA HA sing N N 64 ALA C O doub N N 65 ALA C OXT sing N N 66 ALA CB HB1 sing N N 67 ALA CB HB2 sing N N 68 ALA CB HB3 sing N N 69 ALA OXT HXT sing N N 70 ARG N CA sing N N 71 ARG N H sing N N 72 ARG N H2 sing N N 73 ARG CA C sing N N 74 ARG CA CB sing N N 75 ARG CA HA sing N N 76 ARG C O doub N N 77 ARG C OXT sing N N 78 ARG CB CG sing N N 79 ARG CB HB2 sing N N 80 ARG CB HB3 sing N N 81 ARG CG CD sing N N 82 ARG CG HG2 sing N N 83 ARG CG HG3 sing N N 84 ARG CD NE sing N N 85 ARG CD HD2 sing N N 86 ARG CD HD3 sing N N 87 ARG NE CZ sing N N 88 ARG NE HE sing N N 89 ARG CZ NH1 sing N N 90 ARG CZ NH2 doub N N 91 ARG NH1 HH11 sing N N 92 ARG NH1 HH12 sing N N 93 ARG NH2 HH21 sing N N 94 ARG NH2 HH22 sing N N 95 ARG OXT HXT sing N N 96 ASN N CA sing N N 97 ASN N H sing N N 98 ASN N H2 sing N N 99 ASN CA C sing N N 100 ASN CA CB sing N N 101 ASN CA HA sing N N 102 ASN C O doub N N 103 ASN C OXT sing N N 104 ASN CB CG sing N N 105 ASN CB HB2 sing N N 106 ASN CB HB3 sing N N 107 ASN CG OD1 doub N N 108 ASN CG ND2 sing N N 109 ASN ND2 HD21 sing N N 110 ASN ND2 HD22 sing N N 111 ASN OXT HXT sing N N 112 ASP N CA sing N N 113 ASP N H sing N N 114 ASP N H2 sing N N 115 ASP CA C sing N N 116 ASP CA CB sing N N 117 ASP CA HA sing N N 118 ASP C O doub N N 119 ASP C OXT sing N N 120 ASP CB CG sing N N 121 ASP CB HB2 sing N N 122 ASP CB HB3 sing N N 123 ASP CG OD1 doub N N 124 ASP CG OD2 sing N N 125 ASP OD2 HD2 sing N N 126 ASP OXT HXT sing N N 127 CYS N CA sing N N 128 CYS N H sing N N 129 CYS N H2 sing N N 130 CYS CA C sing N N 131 CYS CA CB sing N N 132 CYS CA HA sing N N 133 CYS C O doub N N 134 CYS C OXT sing N N 135 CYS CB SG sing N N 136 CYS CB HB2 sing N N 137 CYS CB HB3 sing N N 138 CYS SG HG sing N N 139 CYS OXT HXT sing N N 140 GLN N CA sing N N 141 GLN N H sing N N 142 GLN N H2 sing N N 143 GLN CA C sing N N 144 GLN CA CB sing N N 145 GLN CA HA sing N N 146 GLN C O doub N N 147 GLN C OXT sing N N 148 GLN CB CG sing N N 149 GLN CB HB2 sing N N 150 GLN CB HB3 sing N N 151 GLN CG CD sing N N 152 GLN CG HG2 sing N N 153 GLN CG HG3 sing N N 154 GLN CD OE1 doub N N 155 GLN CD NE2 sing N N 156 GLN NE2 HE21 sing N N 157 GLN NE2 HE22 sing N N 158 GLN OXT HXT sing N N 159 GLU N CA sing N N 160 GLU N H sing N N 161 GLU N H2 sing N N 162 GLU CA C sing N N 163 GLU CA CB sing N N 164 GLU CA HA sing N N 165 GLU C O doub N N 166 GLU C OXT sing N N 167 GLU CB CG sing N N 168 GLU CB HB2 sing N N 169 GLU CB HB3 sing N N 170 GLU CG CD sing N N 171 GLU CG HG2 sing N N 172 GLU CG HG3 sing N N 173 GLU CD OE1 doub N N 174 GLU CD OE2 sing N N 175 GLU OE2 HE2 sing N N 176 GLU OXT HXT sing N N 177 GLY N CA sing N N 178 GLY N H sing N N 179 GLY N H2 sing N N 180 GLY CA C sing N N 181 GLY CA HA2 sing N N 182 GLY CA HA3 sing N N 183 GLY C O doub N N 184 GLY C OXT sing N N 185 GLY OXT HXT sing N N 186 HIS N CA sing N N 187 HIS N H sing N N 188 HIS N H2 sing N N 189 HIS CA C sing N N 190 HIS CA CB sing N N 191 HIS CA HA sing N N 192 HIS C O doub N N 193 HIS C OXT sing N N 194 HIS CB CG sing N N 195 HIS CB HB2 sing N N 196 HIS CB HB3 sing N N 197 HIS CG ND1 sing Y N 198 HIS CG CD2 doub Y N 199 HIS ND1 CE1 doub Y N 200 HIS ND1 HD1 sing N N 201 HIS CD2 NE2 sing Y N 202 HIS CD2 HD2 sing N N 203 HIS CE1 NE2 sing Y N 204 HIS CE1 HE1 sing N N 205 HIS NE2 HE2 sing N N 206 HIS OXT HXT sing N N 207 ILE N CA sing N N 208 ILE N H sing N N 209 ILE N H2 sing N N 210 ILE CA C sing N N 211 ILE CA CB sing N N 212 ILE CA HA sing N N 213 ILE C O doub N N 214 ILE C OXT sing N N 215 ILE CB CG1 sing N N 216 ILE CB CG2 sing N N 217 ILE CB HB sing N N 218 ILE CG1 CD1 sing N N 219 ILE CG1 HG12 sing N N 220 ILE CG1 HG13 sing N N 221 ILE CG2 HG21 sing N N 222 ILE CG2 HG22 sing N N 223 ILE CG2 HG23 sing N N 224 ILE CD1 HD11 sing N N 225 ILE CD1 HD12 sing N N 226 ILE CD1 HD13 sing N N 227 ILE OXT HXT sing N N 228 LEU N CA sing N N 229 LEU N H sing N N 230 LEU N H2 sing N N 231 LEU CA C sing N N 232 LEU CA CB sing N N 233 LEU CA HA sing N N 234 LEU C O doub N N 235 LEU C OXT sing N N 236 LEU CB CG sing N N 237 LEU CB HB2 sing N N 238 LEU CB HB3 sing N N 239 LEU CG CD1 sing N N 240 LEU CG CD2 sing N N 241 LEU CG HG sing N N 242 LEU CD1 HD11 sing N N 243 LEU CD1 HD12 sing N N 244 LEU CD1 HD13 sing N N 245 LEU CD2 HD21 sing N N 246 LEU CD2 HD22 sing N N 247 LEU CD2 HD23 sing N N 248 LEU OXT HXT sing N N 249 LYS N CA sing N N 250 LYS N H sing N N 251 LYS N H2 sing N N 252 LYS CA C sing N N 253 LYS CA CB sing N N 254 LYS CA HA sing N N 255 LYS C O doub N N 256 LYS C OXT sing N N 257 LYS CB CG sing N N 258 LYS CB HB2 sing N N 259 LYS CB HB3 sing N N 260 LYS CG CD sing N N 261 LYS CG HG2 sing N N 262 LYS CG HG3 sing N N 263 LYS CD CE sing N N 264 LYS CD HD2 sing N N 265 LYS CD HD3 sing N N 266 LYS CE NZ sing N N 267 LYS CE HE2 sing N N 268 LYS CE HE3 sing N N 269 LYS NZ HZ1 sing N N 270 LYS NZ HZ2 sing N N 271 LYS NZ HZ3 sing N N 272 LYS OXT HXT sing N N 273 MET N CA sing N N 274 MET N H sing N N 275 MET N H2 sing N N 276 MET CA C sing N N 277 MET CA CB sing N N 278 MET CA HA sing N N 279 MET C O doub N N 280 MET C OXT sing N N 281 MET CB CG sing N N 282 MET CB HB2 sing N N 283 MET CB HB3 sing N N 284 MET CG SD sing N N 285 MET CG HG2 sing N N 286 MET CG HG3 sing N N 287 MET SD CE sing N N 288 MET CE HE1 sing N N 289 MET CE HE2 sing N N 290 MET CE HE3 sing N N 291 MET OXT HXT sing N N 292 PHE N CA sing N N 293 PHE N H sing N N 294 PHE N H2 sing N N 295 PHE CA C sing N N 296 PHE CA CB sing N N 297 PHE CA HA sing N N 298 PHE C O doub N N 299 PHE C OXT sing N N 300 PHE CB CG sing N N 301 PHE CB HB2 sing N N 302 PHE CB HB3 sing N N 303 PHE CG CD1 doub Y N 304 PHE CG CD2 sing Y N 305 PHE CD1 CE1 sing Y N 306 PHE CD1 HD1 sing N N 307 PHE CD2 CE2 doub Y N 308 PHE CD2 HD2 sing N N 309 PHE CE1 CZ doub Y N 310 PHE CE1 HE1 sing N N 311 PHE CE2 CZ sing Y N 312 PHE CE2 HE2 sing N N 313 PHE CZ HZ sing N N 314 PHE OXT HXT sing N N 315 PRO N CA sing N N 316 PRO N CD sing N N 317 PRO N H sing N N 318 PRO CA C sing N N 319 PRO CA CB sing N N 320 PRO CA HA sing N N 321 PRO C O doub N N 322 PRO C OXT sing N N 323 PRO CB CG sing N N 324 PRO CB HB2 sing N N 325 PRO CB HB3 sing N N 326 PRO CG CD sing N N 327 PRO CG HG2 sing N N 328 PRO CG HG3 sing N N 329 PRO CD HD2 sing N N 330 PRO CD HD3 sing N N 331 PRO OXT HXT sing N N 332 SER N CA sing N N 333 SER N H sing N N 334 SER N H2 sing N N 335 SER CA C sing N N 336 SER CA CB sing N N 337 SER CA HA sing N N 338 SER C O doub N N 339 SER C OXT sing N N 340 SER CB OG sing N N 341 SER CB HB2 sing N N 342 SER CB HB3 sing N N 343 SER OG HG sing N N 344 SER OXT HXT sing N N 345 THR N CA sing N N 346 THR N H sing N N 347 THR N H2 sing N N 348 THR CA C sing N N 349 THR CA CB sing N N 350 THR CA HA sing N N 351 THR C O doub N N 352 THR C OXT sing N N 353 THR CB OG1 sing N N 354 THR CB CG2 sing N N 355 THR CB HB sing N N 356 THR OG1 HG1 sing N N 357 THR CG2 HG21 sing N N 358 THR CG2 HG22 sing N N 359 THR CG2 HG23 sing N N 360 THR OXT HXT sing N N 361 TRP N CA sing N N 362 TRP N H sing N N 363 TRP N H2 sing N N 364 TRP CA C sing N N 365 TRP CA CB sing N N 366 TRP CA HA sing N N 367 TRP C O doub N N 368 TRP C OXT sing N N 369 TRP CB CG sing N N 370 TRP CB HB2 sing N N 371 TRP CB HB3 sing N N 372 TRP CG CD1 doub Y N 373 TRP CG CD2 sing Y N 374 TRP CD1 NE1 sing Y N 375 TRP CD1 HD1 sing N N 376 TRP CD2 CE2 doub Y N 377 TRP CD2 CE3 sing Y N 378 TRP NE1 CE2 sing Y N 379 TRP NE1 HE1 sing N N 380 TRP CE2 CZ2 sing Y N 381 TRP CE3 CZ3 doub Y N 382 TRP CE3 HE3 sing N N 383 TRP CZ2 CH2 doub Y N 384 TRP CZ2 HZ2 sing N N 385 TRP CZ3 CH2 sing Y N 386 TRP CZ3 HZ3 sing N N 387 TRP CH2 HH2 sing N N 388 TRP OXT HXT sing N N 389 TYR N CA sing N N 390 TYR N H sing N N 391 TYR N H2 sing N N 392 TYR CA C sing N N 393 TYR CA CB sing N N 394 TYR CA HA sing N N 395 TYR C O doub N N 396 TYR C OXT sing N N 397 TYR CB CG sing N N 398 TYR CB HB2 sing N N 399 TYR CB HB3 sing N N 400 TYR CG CD1 doub Y N 401 TYR CG CD2 sing Y N 402 TYR CD1 CE1 sing Y N 403 TYR CD1 HD1 sing N N 404 TYR CD2 CE2 doub Y N 405 TYR CD2 HD2 sing N N 406 TYR CE1 CZ doub Y N 407 TYR CE1 HE1 sing N N 408 TYR CE2 CZ sing Y N 409 TYR CE2 HE2 sing N N 410 TYR CZ OH sing N N 411 TYR OH HH sing N N 412 TYR OXT HXT sing N N 413 VAL N CA sing N N 414 VAL N H sing N N 415 VAL N H2 sing N N 416 VAL CA C sing N N 417 VAL CA CB sing N N 418 VAL CA HA sing N N 419 VAL C O doub N N 420 VAL C OXT sing N N 421 VAL CB CG1 sing N N 422 VAL CB CG2 sing N N 423 VAL CB HB sing N N 424 VAL CG1 HG11 sing N N 425 VAL CG1 HG12 sing N N 426 VAL CG1 HG13 sing N N 427 VAL CG2 HG21 sing N N 428 VAL CG2 HG22 sing N N 429 VAL CG2 HG23 sing N N 430 VAL OXT HXT sing N N 431 # _pdbx_audit_support.funding_organization 'European Research Council (ERC)' _pdbx_audit_support.country France _pdbx_audit_support.grant_number 309657 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id BA _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id BA _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5LM4 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7AWL _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008004 _atom_sites.fract_transf_matrix[1][2] 0.004621 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009242 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010867 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol BA C N O S # loop_