data_7AXG # _entry.id 7AXG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7AXG pdb_00007axg 10.2210/pdb7axg/pdb WWPDB D_1292111625 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-01-13 2 'Structure model' 1 1 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7AXG _pdbx_database_status.recvd_initial_deposition_date 2020-11-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Delfosse, V.' 1 0000-0002-7436-7935 'Huet, T.' 2 0000-0003-1342-979X 'Blanc, P.' 3 0000-0001-5535-4242 'Bourguet, W.' 4 0000-0002-0643-7719 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 118 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Mechanistic insights into the synergistic activation of the RXR-PXR heterodimer by endocrine disruptor mixtures.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2020551118 _citation.pdbx_database_id_PubMed 33361153 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Delfosse, V.' 1 0000-0002-7436-7935 primary 'Huet, T.' 2 0000-0002-8144-7917 primary 'Harrus, D.' 3 0000-0002-7651-672X primary 'Granell, M.' 4 ? primary 'Bourguet, M.' 5 ? primary 'Gardia-Parege, C.' 6 ? primary 'Chiavarina, B.' 7 0000-0003-1444-174X primary 'Grimaldi, M.' 8 ? primary 'Le Mevel, S.' 9 0000-0003-4357-7945 primary 'Blanc, P.' 10 ? primary 'Huang, D.' 11 ? primary 'Gruszczyk, J.' 12 0000-0003-4536-2964 primary 'Demeneix, B.' 13 0000-0003-4544-971X primary 'Cianferani, S.' 14 ? primary 'Fini, J.B.' 15 ? primary 'Balaguer, P.' 16 0000-0002-3524-3622 primary 'Bourguet, W.' 17 0000-0002-0643-7719 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nuclear receptor subfamily 1 group I member 2' 36747.465 1 ? ? ? ? 2 non-polymer syn tributylstannanyl 290.053 2 ? ? ? ? 3 water nat water 18.015 50 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Orphan nuclear receptor PAR1,Orphan nuclear receptor PXR,Pregnane X receptor,Steroid and xenobiotic receptor,SXR' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKKGHHHHHHGSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAK WSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKG AAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQ HRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGSLVPR ; _entity_poly.pdbx_seq_one_letter_code_can ;MKKGHHHHHHGSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAK WSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKG AAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQ HRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGSLVPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 tributylstannanyl TBY 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 LYS n 1 4 GLY n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 GLY n 1 12 SER n 1 13 GLU n 1 14 ARG n 1 15 THR n 1 16 GLY n 1 17 THR n 1 18 GLN n 1 19 PRO n 1 20 LEU n 1 21 GLY n 1 22 VAL n 1 23 GLN n 1 24 GLY n 1 25 LEU n 1 26 THR n 1 27 GLU n 1 28 GLU n 1 29 GLN n 1 30 ARG n 1 31 MET n 1 32 MET n 1 33 ILE n 1 34 ARG n 1 35 GLU n 1 36 LEU n 1 37 MET n 1 38 ASP n 1 39 ALA n 1 40 GLN n 1 41 MET n 1 42 LYS n 1 43 THR n 1 44 PHE n 1 45 ASP n 1 46 THR n 1 47 THR n 1 48 PHE n 1 49 SER n 1 50 HIS n 1 51 PHE n 1 52 LYS n 1 53 ASN n 1 54 PHE n 1 55 ARG n 1 56 LEU n 1 57 PRO n 1 58 GLY n 1 59 VAL n 1 60 LEU n 1 61 SER n 1 62 SER n 1 63 GLY n 1 64 CYS n 1 65 GLU n 1 66 LEU n 1 67 PRO n 1 68 GLU n 1 69 SER n 1 70 LEU n 1 71 GLN n 1 72 ALA n 1 73 PRO n 1 74 SER n 1 75 ARG n 1 76 GLU n 1 77 GLU n 1 78 ALA n 1 79 ALA n 1 80 LYS n 1 81 TRP n 1 82 SER n 1 83 GLN n 1 84 VAL n 1 85 ARG n 1 86 LYS n 1 87 ASP n 1 88 LEU n 1 89 CYS n 1 90 SER n 1 91 LEU n 1 92 LYS n 1 93 VAL n 1 94 SER n 1 95 LEU n 1 96 GLN n 1 97 LEU n 1 98 ARG n 1 99 GLY n 1 100 GLU n 1 101 ASP n 1 102 GLY n 1 103 SER n 1 104 VAL n 1 105 TRP n 1 106 ASN n 1 107 TYR n 1 108 LYS n 1 109 PRO n 1 110 PRO n 1 111 ALA n 1 112 ASP n 1 113 SER n 1 114 GLY n 1 115 GLY n 1 116 LYS n 1 117 GLU n 1 118 ILE n 1 119 PHE n 1 120 SER n 1 121 LEU n 1 122 LEU n 1 123 PRO n 1 124 HIS n 1 125 MET n 1 126 ALA n 1 127 ASP n 1 128 MET n 1 129 SER n 1 130 THR n 1 131 TYR n 1 132 MET n 1 133 PHE n 1 134 LYS n 1 135 GLY n 1 136 ILE n 1 137 ILE n 1 138 SER n 1 139 PHE n 1 140 ALA n 1 141 LYS n 1 142 VAL n 1 143 ILE n 1 144 SER n 1 145 TYR n 1 146 PHE n 1 147 ARG n 1 148 ASP n 1 149 LEU n 1 150 PRO n 1 151 ILE n 1 152 GLU n 1 153 ASP n 1 154 GLN n 1 155 ILE n 1 156 SER n 1 157 LEU n 1 158 LEU n 1 159 LYS n 1 160 GLY n 1 161 ALA n 1 162 ALA n 1 163 PHE n 1 164 GLU n 1 165 LEU n 1 166 CYS n 1 167 GLN n 1 168 LEU n 1 169 ARG n 1 170 PHE n 1 171 ASN n 1 172 THR n 1 173 VAL n 1 174 PHE n 1 175 ASN n 1 176 ALA n 1 177 GLU n 1 178 THR n 1 179 GLY n 1 180 THR n 1 181 TRP n 1 182 GLU n 1 183 CYS n 1 184 GLY n 1 185 ARG n 1 186 LEU n 1 187 SER n 1 188 TYR n 1 189 CYS n 1 190 LEU n 1 191 GLU n 1 192 ASP n 1 193 THR n 1 194 ALA n 1 195 GLY n 1 196 GLY n 1 197 PHE n 1 198 GLN n 1 199 GLN n 1 200 LEU n 1 201 LEU n 1 202 LEU n 1 203 GLU n 1 204 PRO n 1 205 MET n 1 206 LEU n 1 207 LYS n 1 208 PHE n 1 209 HIS n 1 210 TYR n 1 211 MET n 1 212 LEU n 1 213 LYS n 1 214 LYS n 1 215 LEU n 1 216 GLN n 1 217 LEU n 1 218 HIS n 1 219 GLU n 1 220 GLU n 1 221 GLU n 1 222 TYR n 1 223 VAL n 1 224 LEU n 1 225 MET n 1 226 GLN n 1 227 ALA n 1 228 ILE n 1 229 SER n 1 230 LEU n 1 231 PHE n 1 232 SER n 1 233 PRO n 1 234 ASP n 1 235 ARG n 1 236 PRO n 1 237 GLY n 1 238 VAL n 1 239 LEU n 1 240 GLN n 1 241 HIS n 1 242 ARG n 1 243 VAL n 1 244 VAL n 1 245 ASP n 1 246 GLN n 1 247 LEU n 1 248 GLN n 1 249 GLU n 1 250 GLN n 1 251 PHE n 1 252 ALA n 1 253 ILE n 1 254 THR n 1 255 LEU n 1 256 LYS n 1 257 SER n 1 258 TYR n 1 259 ILE n 1 260 GLU n 1 261 CYS n 1 262 ASN n 1 263 ARG n 1 264 PRO n 1 265 GLN n 1 266 PRO n 1 267 ALA n 1 268 HIS n 1 269 ARG n 1 270 PHE n 1 271 LEU n 1 272 PHE n 1 273 LEU n 1 274 LYS n 1 275 ILE n 1 276 MET n 1 277 ALA n 1 278 MET n 1 279 LEU n 1 280 THR n 1 281 GLU n 1 282 LEU n 1 283 ARG n 1 284 SER n 1 285 ILE n 1 286 ASN n 1 287 ALA n 1 288 GLN n 1 289 HIS n 1 290 THR n 1 291 GLN n 1 292 ARG n 1 293 LEU n 1 294 LEU n 1 295 ARG n 1 296 ILE n 1 297 GLN n 1 298 ASP n 1 299 ILE n 1 300 HIS n 1 301 PRO n 1 302 PHE n 1 303 ALA n 1 304 THR n 1 305 PRO n 1 306 LEU n 1 307 MET n 1 308 GLN n 1 309 GLU n 1 310 LEU n 1 311 PHE n 1 312 GLY n 1 313 ILE n 1 314 THR n 1 315 GLY n 1 316 SER n 1 317 LEU n 1 318 VAL n 1 319 PRO n 1 320 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 320 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'NR1I2, PXR' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TBY non-polymer . tributylstannanyl tributyltin 'C12 H27 Sn' 290.053 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 119 ? ? ? A . n A 1 2 LYS 2 120 ? ? ? A . n A 1 3 LYS 3 121 ? ? ? A . n A 1 4 GLY 4 122 ? ? ? A . n A 1 5 HIS 5 123 ? ? ? A . n A 1 6 HIS 6 124 ? ? ? A . n A 1 7 HIS 7 125 ? ? ? A . n A 1 8 HIS 8 126 ? ? ? A . n A 1 9 HIS 9 127 ? ? ? A . n A 1 10 HIS 10 128 ? ? ? A . n A 1 11 GLY 11 129 ? ? ? A . n A 1 12 SER 12 130 ? ? ? A . n A 1 13 GLU 13 131 ? ? ? A . n A 1 14 ARG 14 132 ? ? ? A . n A 1 15 THR 15 133 ? ? ? A . n A 1 16 GLY 16 134 ? ? ? A . n A 1 17 THR 17 135 ? ? ? A . n A 1 18 GLN 18 136 ? ? ? A . n A 1 19 PRO 19 137 ? ? ? A . n A 1 20 LEU 20 138 ? ? ? A . n A 1 21 GLY 21 139 ? ? ? A . n A 1 22 VAL 22 140 ? ? ? A . n A 1 23 GLN 23 141 ? ? ? A . n A 1 24 GLY 24 142 142 GLY GLY A . n A 1 25 LEU 25 143 143 LEU LEU A . n A 1 26 THR 26 144 144 THR THR A . n A 1 27 GLU 27 145 145 GLU GLU A . n A 1 28 GLU 28 146 146 GLU GLU A . n A 1 29 GLN 29 147 147 GLN GLN A . n A 1 30 ARG 30 148 148 ARG ARG A . n A 1 31 MET 31 149 149 MET MET A . n A 1 32 MET 32 150 150 MET MET A . n A 1 33 ILE 33 151 151 ILE ILE A . n A 1 34 ARG 34 152 152 ARG ARG A . n A 1 35 GLU 35 153 153 GLU GLU A . n A 1 36 LEU 36 154 154 LEU LEU A . n A 1 37 MET 37 155 155 MET MET A . n A 1 38 ASP 38 156 156 ASP ASP A . n A 1 39 ALA 39 157 157 ALA ALA A . n A 1 40 GLN 40 158 158 GLN GLN A . n A 1 41 MET 41 159 159 MET MET A . n A 1 42 LYS 42 160 160 LYS LYS A . n A 1 43 THR 43 161 161 THR THR A . n A 1 44 PHE 44 162 162 PHE PHE A . n A 1 45 ASP 45 163 163 ASP ASP A . n A 1 46 THR 46 164 164 THR THR A . n A 1 47 THR 47 165 165 THR THR A . n A 1 48 PHE 48 166 166 PHE PHE A . n A 1 49 SER 49 167 167 SER SER A . n A 1 50 HIS 50 168 168 HIS HIS A . n A 1 51 PHE 51 169 169 PHE PHE A . n A 1 52 LYS 52 170 170 LYS LYS A . n A 1 53 ASN 53 171 171 ASN ASN A . n A 1 54 PHE 54 172 172 PHE PHE A . n A 1 55 ARG 55 173 173 ARG ARG A . n A 1 56 LEU 56 174 174 LEU LEU A . n A 1 57 PRO 57 175 175 PRO PRO A . n A 1 58 GLY 58 176 176 GLY GLY A . n A 1 59 VAL 59 177 177 VAL VAL A . n A 1 60 LEU 60 178 ? ? ? A . n A 1 61 SER 61 179 ? ? ? A . n A 1 62 SER 62 180 ? ? ? A . n A 1 63 GLY 63 181 ? ? ? A . n A 1 64 CYS 64 182 ? ? ? A . n A 1 65 GLU 65 183 ? ? ? A . n A 1 66 LEU 66 184 ? ? ? A . n A 1 67 PRO 67 185 ? ? ? A . n A 1 68 GLU 68 186 ? ? ? A . n A 1 69 SER 69 187 ? ? ? A . n A 1 70 LEU 70 188 ? ? ? A . n A 1 71 GLN 71 189 ? ? ? A . n A 1 72 ALA 72 190 ? ? ? A . n A 1 73 PRO 73 191 ? ? ? A . n A 1 74 SER 74 192 ? ? ? A . n A 1 75 ARG 75 193 ? ? ? A . n A 1 76 GLU 76 194 ? ? ? A . n A 1 77 GLU 77 195 ? ? ? A . n A 1 78 ALA 78 196 ? ? ? A . n A 1 79 ALA 79 197 197 ALA ALA A . n A 1 80 LYS 80 198 198 LYS LYS A . n A 1 81 TRP 81 199 199 TRP TRP A . n A 1 82 SER 82 200 200 SER SER A . n A 1 83 GLN 83 201 201 GLN GLN A . n A 1 84 VAL 84 202 202 VAL VAL A . n A 1 85 ARG 85 203 203 ARG ARG A . n A 1 86 LYS 86 204 204 LYS LYS A . n A 1 87 ASP 87 205 205 ASP ASP A . n A 1 88 LEU 88 206 206 LEU LEU A . n A 1 89 CYS 89 207 207 CYS CYS A . n A 1 90 SER 90 208 208 SER SER A . n A 1 91 LEU 91 209 209 LEU LEU A . n A 1 92 LYS 92 210 210 LYS LYS A . n A 1 93 VAL 93 211 211 VAL VAL A . n A 1 94 SER 94 212 212 SER SER A . n A 1 95 LEU 95 213 213 LEU LEU A . n A 1 96 GLN 96 214 214 GLN GLN A . n A 1 97 LEU 97 215 215 LEU LEU A . n A 1 98 ARG 98 216 216 ARG ARG A . n A 1 99 GLY 99 217 217 GLY GLY A . n A 1 100 GLU 100 218 218 GLU GLU A . n A 1 101 ASP 101 219 219 ASP ASP A . n A 1 102 GLY 102 220 220 GLY GLY A . n A 1 103 SER 103 221 221 SER SER A . n A 1 104 VAL 104 222 222 VAL VAL A . n A 1 105 TRP 105 223 223 TRP TRP A . n A 1 106 ASN 106 224 224 ASN ASN A . n A 1 107 TYR 107 225 225 TYR TYR A . n A 1 108 LYS 108 226 226 LYS LYS A . n A 1 109 PRO 109 227 227 PRO PRO A . n A 1 110 PRO 110 228 228 PRO PRO A . n A 1 111 ALA 111 229 229 ALA ALA A . n A 1 112 ASP 112 230 230 ASP ASP A . n A 1 113 SER 113 231 ? ? ? A . n A 1 114 GLY 114 232 ? ? ? A . n A 1 115 GLY 115 233 ? ? ? A . n A 1 116 LYS 116 234 234 LYS LYS A . n A 1 117 GLU 117 235 235 GLU GLU A . n A 1 118 ILE 118 236 236 ILE ILE A . n A 1 119 PHE 119 237 237 PHE PHE A . n A 1 120 SER 120 238 238 SER SER A . n A 1 121 LEU 121 239 239 LEU LEU A . n A 1 122 LEU 122 240 240 LEU LEU A . n A 1 123 PRO 123 241 241 PRO PRO A . n A 1 124 HIS 124 242 242 HIS HIS A . n A 1 125 MET 125 243 243 MET MET A . n A 1 126 ALA 126 244 244 ALA ALA A . n A 1 127 ASP 127 245 245 ASP ASP A . n A 1 128 MET 128 246 246 MET MET A . n A 1 129 SER 129 247 247 SER SER A . n A 1 130 THR 130 248 248 THR THR A . n A 1 131 TYR 131 249 249 TYR TYR A . n A 1 132 MET 132 250 250 MET MET A . n A 1 133 PHE 133 251 251 PHE PHE A . n A 1 134 LYS 134 252 252 LYS LYS A . n A 1 135 GLY 135 253 253 GLY GLY A . n A 1 136 ILE 136 254 254 ILE ILE A . n A 1 137 ILE 137 255 255 ILE ILE A . n A 1 138 SER 138 256 256 SER SER A . n A 1 139 PHE 139 257 257 PHE PHE A . n A 1 140 ALA 140 258 258 ALA ALA A . n A 1 141 LYS 141 259 259 LYS LYS A . n A 1 142 VAL 142 260 260 VAL VAL A . n A 1 143 ILE 143 261 261 ILE ILE A . n A 1 144 SER 144 262 262 SER SER A . n A 1 145 TYR 145 263 263 TYR TYR A . n A 1 146 PHE 146 264 264 PHE PHE A . n A 1 147 ARG 147 265 265 ARG ARG A . n A 1 148 ASP 148 266 266 ASP ASP A . n A 1 149 LEU 149 267 267 LEU LEU A . n A 1 150 PRO 150 268 268 PRO PRO A . n A 1 151 ILE 151 269 269 ILE ILE A . n A 1 152 GLU 152 270 270 GLU GLU A . n A 1 153 ASP 153 271 271 ASP ASP A . n A 1 154 GLN 154 272 272 GLN GLN A . n A 1 155 ILE 155 273 273 ILE ILE A . n A 1 156 SER 156 274 274 SER SER A . n A 1 157 LEU 157 275 275 LEU LEU A . n A 1 158 LEU 158 276 276 LEU LEU A . n A 1 159 LYS 159 277 277 LYS LYS A . n A 1 160 GLY 160 278 278 GLY GLY A . n A 1 161 ALA 161 279 279 ALA ALA A . n A 1 162 ALA 162 280 280 ALA ALA A . n A 1 163 PHE 163 281 281 PHE PHE A . n A 1 164 GLU 164 282 282 GLU GLU A . n A 1 165 LEU 165 283 283 LEU LEU A . n A 1 166 CYS 166 284 284 CYS CYS A . n A 1 167 GLN 167 285 285 GLN GLN A . n A 1 168 LEU 168 286 286 LEU LEU A . n A 1 169 ARG 169 287 287 ARG ARG A . n A 1 170 PHE 170 288 288 PHE PHE A . n A 1 171 ASN 171 289 289 ASN ASN A . n A 1 172 THR 172 290 290 THR THR A . n A 1 173 VAL 173 291 291 VAL VAL A . n A 1 174 PHE 174 292 292 PHE PHE A . n A 1 175 ASN 175 293 293 ASN ASN A . n A 1 176 ALA 176 294 294 ALA ALA A . n A 1 177 GLU 177 295 295 GLU GLU A . n A 1 178 THR 178 296 296 THR THR A . n A 1 179 GLY 179 297 297 GLY GLY A . n A 1 180 THR 180 298 298 THR THR A . n A 1 181 TRP 181 299 299 TRP TRP A . n A 1 182 GLU 182 300 300 GLU GLU A . n A 1 183 CYS 183 301 301 CYS CYS A . n A 1 184 GLY 184 302 302 GLY GLY A . n A 1 185 ARG 185 303 303 ARG ARG A . n A 1 186 LEU 186 304 304 LEU LEU A . n A 1 187 SER 187 305 305 SER SER A . n A 1 188 TYR 188 306 306 TYR TYR A . n A 1 189 CYS 189 307 307 CYS CYS A . n A 1 190 LEU 190 308 308 LEU LEU A . n A 1 191 GLU 191 309 309 GLU GLU A . n A 1 192 ASP 192 310 310 ASP ASP A . n A 1 193 THR 193 311 ? ? ? A . n A 1 194 ALA 194 312 ? ? ? A . n A 1 195 GLY 195 313 ? ? ? A . n A 1 196 GLY 196 314 314 GLY GLY A . n A 1 197 PHE 197 315 315 PHE PHE A . n A 1 198 GLN 198 316 316 GLN GLN A . n A 1 199 GLN 199 317 317 GLN GLN A . n A 1 200 LEU 200 318 318 LEU LEU A . n A 1 201 LEU 201 319 319 LEU LEU A . n A 1 202 LEU 202 320 320 LEU LEU A . n A 1 203 GLU 203 321 321 GLU GLU A . n A 1 204 PRO 204 322 322 PRO PRO A . n A 1 205 MET 205 323 323 MET MET A . n A 1 206 LEU 206 324 324 LEU LEU A . n A 1 207 LYS 207 325 325 LYS LYS A . n A 1 208 PHE 208 326 326 PHE PHE A . n A 1 209 HIS 209 327 327 HIS HIS A . n A 1 210 TYR 210 328 328 TYR TYR A . n A 1 211 MET 211 329 329 MET MET A . n A 1 212 LEU 212 330 330 LEU LEU A . n A 1 213 LYS 213 331 331 LYS LYS A . n A 1 214 LYS 214 332 332 LYS LYS A . n A 1 215 LEU 215 333 333 LEU LEU A . n A 1 216 GLN 216 334 334 GLN GLN A . n A 1 217 LEU 217 335 335 LEU LEU A . n A 1 218 HIS 218 336 336 HIS HIS A . n A 1 219 GLU 219 337 337 GLU GLU A . n A 1 220 GLU 220 338 338 GLU GLU A . n A 1 221 GLU 221 339 339 GLU GLU A . n A 1 222 TYR 222 340 340 TYR TYR A . n A 1 223 VAL 223 341 341 VAL VAL A . n A 1 224 LEU 224 342 342 LEU LEU A . n A 1 225 MET 225 343 343 MET MET A . n A 1 226 GLN 226 344 344 GLN GLN A . n A 1 227 ALA 227 345 345 ALA ALA A . n A 1 228 ILE 228 346 346 ILE ILE A . n A 1 229 SER 229 347 347 SER SER A . n A 1 230 LEU 230 348 348 LEU LEU A . n A 1 231 PHE 231 349 349 PHE PHE A . n A 1 232 SER 232 350 350 SER SER A . n A 1 233 PRO 233 351 351 PRO PRO A . n A 1 234 ASP 234 352 352 ASP ASP A . n A 1 235 ARG 235 353 353 ARG ARG A . n A 1 236 PRO 236 354 354 PRO PRO A . n A 1 237 GLY 237 355 355 GLY GLY A . n A 1 238 VAL 238 356 356 VAL VAL A . n A 1 239 LEU 239 357 357 LEU LEU A . n A 1 240 GLN 240 358 358 GLN GLN A . n A 1 241 HIS 241 359 359 HIS HIS A . n A 1 242 ARG 242 360 360 ARG ARG A . n A 1 243 VAL 243 361 361 VAL VAL A . n A 1 244 VAL 244 362 362 VAL VAL A . n A 1 245 ASP 245 363 363 ASP ASP A . n A 1 246 GLN 246 364 364 GLN GLN A . n A 1 247 LEU 247 365 365 LEU LEU A . n A 1 248 GLN 248 366 366 GLN GLN A . n A 1 249 GLU 249 367 367 GLU GLU A . n A 1 250 GLN 250 368 368 GLN GLN A . n A 1 251 PHE 251 369 369 PHE PHE A . n A 1 252 ALA 252 370 370 ALA ALA A . n A 1 253 ILE 253 371 371 ILE ILE A . n A 1 254 THR 254 372 372 THR THR A . n A 1 255 LEU 255 373 373 LEU LEU A . n A 1 256 LYS 256 374 374 LYS LYS A . n A 1 257 SER 257 375 375 SER SER A . n A 1 258 TYR 258 376 376 TYR TYR A . n A 1 259 ILE 259 377 377 ILE ILE A . n A 1 260 GLU 260 378 378 GLU GLU A . n A 1 261 CYS 261 379 379 CYS CYS A . n A 1 262 ASN 262 380 380 ASN ASN A . n A 1 263 ARG 263 381 381 ARG ARG A . n A 1 264 PRO 264 382 382 PRO PRO A . n A 1 265 GLN 265 383 383 GLN GLN A . n A 1 266 PRO 266 384 384 PRO PRO A . n A 1 267 ALA 267 385 385 ALA ALA A . n A 1 268 HIS 268 386 386 HIS HIS A . n A 1 269 ARG 269 387 387 ARG ARG A . n A 1 270 PHE 270 388 388 PHE PHE A . n A 1 271 LEU 271 389 389 LEU LEU A . n A 1 272 PHE 272 390 390 PHE PHE A . n A 1 273 LEU 273 391 391 LEU LEU A . n A 1 274 LYS 274 392 392 LYS LYS A . n A 1 275 ILE 275 393 393 ILE ILE A . n A 1 276 MET 276 394 394 MET MET A . n A 1 277 ALA 277 395 395 ALA ALA A . n A 1 278 MET 278 396 396 MET MET A . n A 1 279 LEU 279 397 397 LEU LEU A . n A 1 280 THR 280 398 398 THR THR A . n A 1 281 GLU 281 399 399 GLU GLU A . n A 1 282 LEU 282 400 400 LEU LEU A . n A 1 283 ARG 283 401 401 ARG ARG A . n A 1 284 SER 284 402 402 SER SER A . n A 1 285 ILE 285 403 403 ILE ILE A . n A 1 286 ASN 286 404 404 ASN ASN A . n A 1 287 ALA 287 405 405 ALA ALA A . n A 1 288 GLN 288 406 406 GLN GLN A . n A 1 289 HIS 289 407 407 HIS HIS A . n A 1 290 THR 290 408 408 THR THR A . n A 1 291 GLN 291 409 409 GLN GLN A . n A 1 292 ARG 292 410 410 ARG ARG A . n A 1 293 LEU 293 411 411 LEU LEU A . n A 1 294 LEU 294 412 412 LEU LEU A . n A 1 295 ARG 295 413 413 ARG ARG A . n A 1 296 ILE 296 414 414 ILE ILE A . n A 1 297 GLN 297 415 415 GLN GLN A . n A 1 298 ASP 298 416 416 ASP ASP A . n A 1 299 ILE 299 417 417 ILE ILE A . n A 1 300 HIS 300 418 418 HIS HIS A . n A 1 301 PRO 301 419 419 PRO PRO A . n A 1 302 PHE 302 420 420 PHE PHE A . n A 1 303 ALA 303 421 421 ALA ALA A . n A 1 304 THR 304 422 422 THR THR A . n A 1 305 PRO 305 423 423 PRO PRO A . n A 1 306 LEU 306 424 424 LEU LEU A . n A 1 307 MET 307 425 425 MET MET A . n A 1 308 GLN 308 426 426 GLN GLN A . n A 1 309 GLU 309 427 427 GLU GLU A . n A 1 310 LEU 310 428 428 LEU LEU A . n A 1 311 PHE 311 429 429 PHE PHE A . n A 1 312 GLY 312 430 430 GLY GLY A . n A 1 313 ILE 313 431 431 ILE ILE A . n A 1 314 THR 314 432 432 THR THR A . n A 1 315 GLY 315 433 433 GLY GLY A . n A 1 316 SER 316 434 434 SER SER A . n A 1 317 LEU 317 435 435 LEU LEU A . n A 1 318 VAL 318 436 ? ? ? A . n A 1 319 PRO 319 437 ? ? ? A . n A 1 320 ARG 320 438 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 TBY 1 501 1 TBY TBY A . C 2 TBY 1 502 2 TBY TBY A . D 3 HOH 1 601 51 HOH HOH A . D 3 HOH 2 602 62 HOH HOH A . D 3 HOH 3 603 7 HOH HOH A . D 3 HOH 4 604 55 HOH HOH A . D 3 HOH 5 605 52 HOH HOH A . D 3 HOH 6 606 6 HOH HOH A . D 3 HOH 7 607 53 HOH HOH A . D 3 HOH 8 608 14 HOH HOH A . D 3 HOH 9 609 57 HOH HOH A . D 3 HOH 10 610 18 HOH HOH A . D 3 HOH 11 611 16 HOH HOH A . D 3 HOH 12 612 48 HOH HOH A . D 3 HOH 13 613 5 HOH HOH A . D 3 HOH 14 614 8 HOH HOH A . D 3 HOH 15 615 39 HOH HOH A . D 3 HOH 16 616 64 HOH HOH A . D 3 HOH 17 617 9 HOH HOH A . D 3 HOH 18 618 13 HOH HOH A . D 3 HOH 19 619 56 HOH HOH A . D 3 HOH 20 620 2 HOH HOH A . D 3 HOH 21 621 60 HOH HOH A . D 3 HOH 22 622 4 HOH HOH A . D 3 HOH 23 623 10 HOH HOH A . D 3 HOH 24 624 49 HOH HOH A . D 3 HOH 25 625 3 HOH HOH A . D 3 HOH 26 626 41 HOH HOH A . D 3 HOH 27 627 33 HOH HOH A . D 3 HOH 28 628 40 HOH HOH A . D 3 HOH 29 629 27 HOH HOH A . D 3 HOH 30 630 20 HOH HOH A . D 3 HOH 31 631 43 HOH HOH A . D 3 HOH 32 632 63 HOH HOH A . D 3 HOH 33 633 59 HOH HOH A . D 3 HOH 34 634 61 HOH HOH A . D 3 HOH 35 635 65 HOH HOH A . D 3 HOH 36 636 31 HOH HOH A . D 3 HOH 37 637 19 HOH HOH A . D 3 HOH 38 638 26 HOH HOH A . D 3 HOH 39 639 58 HOH HOH A . D 3 HOH 40 640 15 HOH HOH A . D 3 HOH 41 641 17 HOH HOH A . D 3 HOH 42 642 32 HOH HOH A . D 3 HOH 43 643 21 HOH HOH A . D 3 HOH 44 644 24 HOH HOH A . D 3 HOH 45 645 23 HOH HOH A . D 3 HOH 46 646 35 HOH HOH A . D 3 HOH 47 647 67 HOH HOH A . D 3 HOH 48 648 54 HOH HOH A . D 3 HOH 49 649 66 HOH HOH A . D 3 HOH 50 650 47 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 146 ? CD ? A GLU 28 CD 2 1 Y 1 A GLU 146 ? OE1 ? A GLU 28 OE1 3 1 Y 1 A GLU 146 ? OE2 ? A GLU 28 OE2 4 1 Y 1 A MET 149 ? CG ? A MET 31 CG 5 1 Y 1 A MET 149 ? SD ? A MET 31 SD 6 1 Y 1 A MET 149 ? CE ? A MET 31 CE 7 1 Y 1 A ARG 152 ? CD ? A ARG 34 CD 8 1 Y 1 A ARG 152 ? NE ? A ARG 34 NE 9 1 Y 1 A ARG 152 ? CZ ? A ARG 34 CZ 10 1 Y 1 A ARG 152 ? NH1 ? A ARG 34 NH1 11 1 Y 1 A ARG 152 ? NH2 ? A ARG 34 NH2 12 1 Y 1 A LYS 170 ? CE ? A LYS 52 CE 13 1 Y 1 A LYS 170 ? NZ ? A LYS 52 NZ 14 1 Y 1 A VAL 177 ? CG1 ? A VAL 59 CG1 15 1 Y 1 A VAL 177 ? CG2 ? A VAL 59 CG2 16 1 Y 1 A LYS 198 ? CG ? A LYS 80 CG 17 1 Y 1 A LYS 198 ? CD ? A LYS 80 CD 18 1 Y 1 A LYS 198 ? CE ? A LYS 80 CE 19 1 Y 1 A LYS 198 ? NZ ? A LYS 80 NZ 20 1 Y 1 A TRP 199 ? CG ? A TRP 81 CG 21 1 Y 1 A TRP 199 ? CD1 ? A TRP 81 CD1 22 1 Y 1 A TRP 199 ? CD2 ? A TRP 81 CD2 23 1 Y 1 A TRP 199 ? NE1 ? A TRP 81 NE1 24 1 Y 1 A TRP 199 ? CE2 ? A TRP 81 CE2 25 1 Y 1 A TRP 199 ? CE3 ? A TRP 81 CE3 26 1 Y 1 A TRP 199 ? CZ2 ? A TRP 81 CZ2 27 1 Y 1 A TRP 199 ? CZ3 ? A TRP 81 CZ3 28 1 Y 1 A TRP 199 ? CH2 ? A TRP 81 CH2 29 1 Y 1 A SER 200 ? OG ? A SER 82 OG 30 1 Y 1 A VAL 202 ? CG1 ? A VAL 84 CG1 31 1 Y 1 A VAL 202 ? CG2 ? A VAL 84 CG2 32 1 Y 1 A ARG 203 ? CG ? A ARG 85 CG 33 1 Y 1 A ARG 203 ? CD ? A ARG 85 CD 34 1 Y 1 A ARG 203 ? NE ? A ARG 85 NE 35 1 Y 1 A ARG 203 ? CZ ? A ARG 85 CZ 36 1 Y 1 A ARG 203 ? NH1 ? A ARG 85 NH1 37 1 Y 1 A ARG 203 ? NH2 ? A ARG 85 NH2 38 1 Y 1 A LYS 204 ? CG ? A LYS 86 CG 39 1 Y 1 A LYS 204 ? CD ? A LYS 86 CD 40 1 Y 1 A LYS 204 ? CE ? A LYS 86 CE 41 1 Y 1 A LYS 204 ? NZ ? A LYS 86 NZ 42 1 Y 1 A SER 208 ? OG ? A SER 90 OG 43 1 Y 1 A LEU 209 ? CG ? A LEU 91 CG 44 1 Y 1 A LEU 209 ? CD1 ? A LEU 91 CD1 45 1 Y 1 A LEU 209 ? CD2 ? A LEU 91 CD2 46 1 Y 1 A LYS 210 ? CG ? A LYS 92 CG 47 1 Y 1 A LYS 210 ? CD ? A LYS 92 CD 48 1 Y 1 A LYS 210 ? CE ? A LYS 92 CE 49 1 Y 1 A LYS 210 ? NZ ? A LYS 92 NZ 50 1 Y 1 A GLU 218 ? CG ? A GLU 100 CG 51 1 Y 1 A GLU 218 ? CD ? A GLU 100 CD 52 1 Y 1 A GLU 218 ? OE1 ? A GLU 100 OE1 53 1 Y 1 A GLU 218 ? OE2 ? A GLU 100 OE2 54 1 Y 1 A LYS 226 ? CD ? A LYS 108 CD 55 1 Y 1 A LYS 226 ? CE ? A LYS 108 CE 56 1 Y 1 A LYS 226 ? NZ ? A LYS 108 NZ 57 1 Y 1 A LYS 234 ? CG ? A LYS 116 CG 58 1 Y 1 A LYS 234 ? CD ? A LYS 116 CD 59 1 Y 1 A LYS 234 ? CE ? A LYS 116 CE 60 1 Y 1 A LYS 234 ? NZ ? A LYS 116 NZ 61 1 Y 1 A LYS 259 ? NZ ? A LYS 141 NZ 62 1 Y 1 A GLU 295 ? CG ? A GLU 177 CG 63 1 Y 1 A GLU 295 ? CD ? A GLU 177 CD 64 1 Y 1 A GLU 295 ? OE1 ? A GLU 177 OE1 65 1 Y 1 A GLU 295 ? OE2 ? A GLU 177 OE2 66 1 Y 1 A ARG 303 ? CD ? A ARG 185 CD 67 1 Y 1 A ARG 303 ? NE ? A ARG 185 NE 68 1 Y 1 A ARG 303 ? CZ ? A ARG 185 CZ 69 1 Y 1 A ARG 303 ? NH1 ? A ARG 185 NH1 70 1 Y 1 A ARG 303 ? NH2 ? A ARG 185 NH2 71 1 Y 1 A ASP 310 ? CG ? A ASP 192 CG 72 1 Y 1 A ASP 310 ? OD1 ? A ASP 192 OD1 73 1 Y 1 A ASP 310 ? OD2 ? A ASP 192 OD2 74 1 Y 1 A PHE 315 ? CG ? A PHE 197 CG 75 1 Y 1 A PHE 315 ? CD1 ? A PHE 197 CD1 76 1 Y 1 A PHE 315 ? CD2 ? A PHE 197 CD2 77 1 Y 1 A PHE 315 ? CE1 ? A PHE 197 CE1 78 1 Y 1 A PHE 315 ? CE2 ? A PHE 197 CE2 79 1 Y 1 A PHE 315 ? CZ ? A PHE 197 CZ 80 1 Y 1 A GLN 316 ? CG ? A GLN 198 CG 81 1 Y 1 A GLN 316 ? CD ? A GLN 198 CD 82 1 Y 1 A GLN 316 ? OE1 ? A GLN 198 OE1 83 1 Y 1 A GLN 316 ? NE2 ? A GLN 198 NE2 84 1 Y 1 A GLN 317 ? CG ? A GLN 199 CG 85 1 Y 1 A GLN 317 ? CD ? A GLN 199 CD 86 1 Y 1 A GLN 317 ? OE1 ? A GLN 199 OE1 87 1 Y 1 A GLN 317 ? NE2 ? A GLN 199 NE2 88 1 Y 1 A LEU 318 ? CG ? A LEU 200 CG 89 1 Y 1 A LEU 318 ? CD1 ? A LEU 200 CD1 90 1 Y 1 A LEU 318 ? CD2 ? A LEU 200 CD2 91 1 Y 1 A LEU 319 ? CD1 ? A LEU 201 CD1 92 1 Y 1 A LEU 319 ? CD2 ? A LEU 201 CD2 93 1 Y 1 A LYS 325 ? CD ? A LYS 207 CD 94 1 Y 1 A LYS 325 ? CE ? A LYS 207 CE 95 1 Y 1 A LYS 325 ? NZ ? A LYS 207 NZ 96 1 Y 1 A LYS 332 ? CE ? A LYS 214 CE 97 1 Y 1 A LYS 332 ? NZ ? A LYS 214 NZ 98 1 Y 1 A HIS 359 ? ND1 ? A HIS 241 ND1 99 1 Y 1 A HIS 359 ? CE1 ? A HIS 241 CE1 100 1 Y 1 A HIS 359 ? NE2 ? A HIS 241 NE2 101 1 Y 1 A ARG 360 ? CD ? A ARG 242 CD 102 1 Y 1 A ARG 360 ? NE ? A ARG 242 NE 103 1 Y 1 A ARG 360 ? CZ ? A ARG 242 CZ 104 1 Y 1 A ARG 360 ? NH1 ? A ARG 242 NH1 105 1 Y 1 A ARG 360 ? NH2 ? A ARG 242 NH2 106 1 Y 1 A GLN 364 ? CG ? A GLN 246 CG 107 1 Y 1 A GLN 364 ? CD ? A GLN 246 CD 108 1 Y 1 A GLN 364 ? OE1 ? A GLN 246 OE1 109 1 Y 1 A GLN 364 ? NE2 ? A GLN 246 NE2 110 1 Y 1 A GLN 406 ? CD ? A GLN 288 CD 111 1 Y 1 A GLN 406 ? OE1 ? A GLN 288 OE1 112 1 Y 1 A GLN 406 ? NE2 ? A GLN 288 NE2 113 1 Y 1 A ILE 417 ? CG1 ? A ILE 299 CG1 114 1 Y 1 A ILE 417 ? CG2 ? A ILE 299 CG2 115 1 Y 1 A ILE 417 ? CD1 ? A ILE 299 CD1 116 1 Y 1 A LEU 435 ? CG ? A LEU 317 CG 117 1 Y 1 A LEU 435 ? CD1 ? A LEU 317 CD1 118 1 Y 1 A LEU 435 ? CD2 ? A LEU 317 CD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18_3845 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18_3845 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7AXG _cell.details ? _cell.formula_units_Z ? _cell.length_a 92.320 _cell.length_a_esd ? _cell.length_b 92.320 _cell.length_b_esd ? _cell.length_c 86.710 _cell.length_c_esd ? _cell.volume 739027.791 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7AXG _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall 'P 4nw 2abw' _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7AXG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.51 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.07 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;50 - 100 mM imidazole 8 - 14% isopropanol ; _exptl_crystal_grow.pdbx_pH_range '7.0 - 7.4' # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-06-07 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.8731 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.8731 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-2 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 49.64 _reflns.entry_id 7AXG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.7 _reflns.d_resolution_low 41.29 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10746 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.128 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low 2.77 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 761 _reflns_shell.percent_possible_all 99.9 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 8.7 _reflns_shell.pdbx_Rsym_value 0.697 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 49.98 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7AXG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.70 _refine.ls_d_res_low 41.29 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10746 _refine.ls_number_reflns_R_free 860 _refine.ls_number_reflns_R_work 9886 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.82 _refine.ls_percent_reflns_R_free 8.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2117 _refine.ls_R_factor_R_free 0.2377 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2094 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1ILG _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.9647 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2796 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.70 _refine_hist.d_res_low 41.29 _refine_hist.number_atoms_solvent 50 _refine_hist.number_atoms_total 2159 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2083 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0032 ? 2166 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5645 ? 2925 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0363 ? 329 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0041 ? 372 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 16.9339 ? 313 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.70 2.87 . . 140 1607 99.89 . . . 0.2996 . 0.2626 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.87 3.09 . . 139 1607 99.83 . . . 0.2797 . 0.2502 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.09 3.40 . . 141 1622 99.94 . . . 0.2824 . 0.2477 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.40 3.89 . . 142 1630 99.89 . . . 0.1939 . 0.2086 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.89 4.90 . . 145 1666 100.00 . . . 0.2249 . 0.1760 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.91 41.29 . . 153 1754 99.43 . . . 0.2323 . 0.1975 . . . . . . . . . . . # _struct.entry_id 7AXG _struct.title 'Crystal structure of the hPXR-LBD in complex with tributyltin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7AXG _struct_keywords.text 'NUCLEAR RECEPTOR HORMONE RECEPTOR PREGNANE X RECEPTOR, NUCLEAR PROTEIN' _struct_keywords.pdbx_keywords 'NUCLEAR PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NR1I2_HUMAN _struct_ref.pdbx_db_accession O75469 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSL KVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFN TVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQF AITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS ; _struct_ref.pdbx_align_begin 130 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7AXG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 12 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 316 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O75469 _struct_ref_seq.db_align_beg 130 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 434 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 130 _struct_ref_seq.pdbx_auth_seq_align_end 434 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7AXG MET A 1 ? UNP O75469 ? ? 'initiating methionine' 119 1 1 7AXG LYS A 2 ? UNP O75469 ? ? 'expression tag' 120 2 1 7AXG LYS A 3 ? UNP O75469 ? ? 'expression tag' 121 3 1 7AXG GLY A 4 ? UNP O75469 ? ? 'expression tag' 122 4 1 7AXG HIS A 5 ? UNP O75469 ? ? 'expression tag' 123 5 1 7AXG HIS A 6 ? UNP O75469 ? ? 'expression tag' 124 6 1 7AXG HIS A 7 ? UNP O75469 ? ? 'expression tag' 125 7 1 7AXG HIS A 8 ? UNP O75469 ? ? 'expression tag' 126 8 1 7AXG HIS A 9 ? UNP O75469 ? ? 'expression tag' 127 9 1 7AXG HIS A 10 ? UNP O75469 ? ? 'expression tag' 128 10 1 7AXG GLY A 11 ? UNP O75469 ? ? 'expression tag' 129 11 1 7AXG LEU A 317 ? UNP O75469 ? ? 'expression tag' 435 12 1 7AXG VAL A 318 ? UNP O75469 ? ? 'expression tag' 436 13 1 7AXG PRO A 319 ? UNP O75469 ? ? 'expression tag' 437 14 1 7AXG ARG A 320 ? UNP O75469 ? ? 'expression tag' 438 15 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly 'gel filtration' monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 1450 ? 2 MORE -12 ? 2 'SSA (A^2)' 26480 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D 2 1,2 A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'A DIMERIC FORM REMAINS HYPOTHETICAL' # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_664 -y+1,-x+1,-z-1/2 0.0000000000 -1.0000000000 0.0000000000 92.3200000000 -1.0000000000 0.0000000000 0.0000000000 92.3200000000 0.0000000000 0.0000000000 -1.0000000000 -43.3550000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 26 ? PHE A 44 ? THR A 144 PHE A 162 1 ? 19 HELX_P HELX_P2 AA2 LYS A 80 ? ARG A 85 ? LYS A 198 ARG A 203 1 ? 6 HELX_P HELX_P3 AA3 LYS A 86 ? LEU A 88 ? LYS A 204 LEU A 206 5 ? 3 HELX_P HELX_P4 AA4 LYS A 116 ? SER A 120 ? LYS A 234 SER A 238 5 ? 5 HELX_P HELX_P5 AA5 LEU A 121 ? ILE A 143 ? LEU A 239 ILE A 261 1 ? 23 HELX_P HELX_P6 AA6 ILE A 143 ? ASP A 148 ? ILE A 261 ASP A 266 1 ? 6 HELX_P HELX_P7 AA7 PRO A 150 ? VAL A 173 ? PRO A 268 VAL A 291 1 ? 24 HELX_P HELX_P8 AA8 GLN A 199 ? LEU A 202 ? GLN A 317 LEU A 320 5 ? 4 HELX_P HELX_P9 AA9 GLU A 203 ? LEU A 215 ? GLU A 321 LEU A 333 1 ? 13 HELX_P HELX_P10 AB1 HIS A 218 ? PHE A 231 ? HIS A 336 PHE A 349 1 ? 14 HELX_P HELX_P11 AB2 GLN A 240 ? ARG A 263 ? GLN A 358 ARG A 381 1 ? 24 HELX_P HELX_P12 AB3 GLN A 265 ? ARG A 269 ? GLN A 383 ARG A 387 5 ? 5 HELX_P HELX_P13 AB4 PHE A 270 ? HIS A 300 ? PHE A 388 HIS A 418 1 ? 31 HELX_P HELX_P14 AB5 THR A 304 ? GLY A 312 ? THR A 422 GLY A 430 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 89 SG ? ? ? 1_555 B TBY . SN1 ? ? A CYS 207 A TBY 501 1_555 ? ? ? ? ? ? www.phenix-online.org/documentation/reference/refinement.html#definition-of-custom-bonds-and-angles 1.975 ? ? metalc2 metalc ? ? A CYS 166 SG ? ? ? 1_555 C TBY . SN1 ? ? A CYS 284 A TBY 502 1_555 ? ? ? ? ? ? www.phenix-online.org/documentation/reference/refinement.html#definition-of-custom-bonds-and-angles 2.296 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 89 ? A CYS 207 ? 1_555 SN1 ? B TBY . ? A TBY 501 ? 1_555 C10 ? B TBY . ? A TBY 501 ? 1_555 108.3 ? 2 SG ? A CYS 89 ? A CYS 207 ? 1_555 SN1 ? B TBY . ? A TBY 501 ? 1_555 C2 ? B TBY . ? A TBY 501 ? 1_555 108.7 ? 3 C10 ? B TBY . ? A TBY 501 ? 1_555 SN1 ? B TBY . ? A TBY 501 ? 1_555 C2 ? B TBY . ? A TBY 501 ? 1_555 108.0 ? 4 SG ? A CYS 89 ? A CYS 207 ? 1_555 SN1 ? B TBY . ? A TBY 501 ? 1_555 C6 ? B TBY . ? A TBY 501 ? 1_555 109.9 ? 5 C10 ? B TBY . ? A TBY 501 ? 1_555 SN1 ? B TBY . ? A TBY 501 ? 1_555 C6 ? B TBY . ? A TBY 501 ? 1_555 94.1 ? 6 C2 ? B TBY . ? A TBY 501 ? 1_555 SN1 ? B TBY . ? A TBY 501 ? 1_555 C6 ? B TBY . ? A TBY 501 ? 1_555 125.8 ? 7 SG ? A CYS 166 ? A CYS 284 ? 1_555 SN1 ? C TBY . ? A TBY 502 ? 1_555 C10 ? C TBY . ? A TBY 502 ? 1_555 108.4 ? 8 SG ? A CYS 166 ? A CYS 284 ? 1_555 SN1 ? C TBY . ? A TBY 502 ? 1_555 C2 ? C TBY . ? A TBY 502 ? 1_555 107.2 ? 9 C10 ? C TBY . ? A TBY 502 ? 1_555 SN1 ? C TBY . ? A TBY 502 ? 1_555 C2 ? C TBY . ? A TBY 502 ? 1_555 114.0 ? 10 SG ? A CYS 166 ? A CYS 284 ? 1_555 SN1 ? C TBY . ? A TBY 502 ? 1_555 C6 ? C TBY . ? A TBY 502 ? 1_555 106.3 ? 11 C10 ? C TBY . ? A TBY 502 ? 1_555 SN1 ? C TBY . ? A TBY 502 ? 1_555 C6 ? C TBY . ? A TBY 502 ? 1_555 96.4 ? 12 C2 ? C TBY . ? A TBY 502 ? 1_555 SN1 ? C TBY . ? A TBY 502 ? 1_555 C6 ? C TBY . ? A TBY 502 ? 1_555 123.5 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 104 ? TYR A 107 ? VAL A 222 TYR A 225 AA1 2 VAL A 93 ? ARG A 98 ? VAL A 211 ARG A 216 AA1 3 LEU A 186 ? LEU A 190 ? LEU A 304 LEU A 308 AA1 4 THR A 180 ? CYS A 183 ? THR A 298 CYS A 301 AA1 5 PHE A 174 ? ASN A 175 ? PHE A 292 ASN A 293 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TYR A 107 ? O TYR A 225 N LEU A 95 ? N LEU A 213 AA1 2 3 N SER A 94 ? N SER A 212 O CYS A 189 ? O CYS A 307 AA1 3 4 O LEU A 186 ? O LEU A 304 N CYS A 183 ? N CYS A 301 AA1 4 5 O THR A 180 ? O THR A 298 N ASN A 175 ? N ASN A 293 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A TBY 501 ? 3 'binding site for residue TBY A 501' AC2 Software A TBY 502 ? 8 'binding site for residue TBY A 502' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 CYS A 89 ? CYS A 207 . ? 1_555 ? 2 AC1 3 TRP A 181 ? TRP A 299 . ? 1_555 ? 3 AC1 3 TBY C . ? TBY A 502 . ? 1_555 ? 4 AC2 8 MET A 125 ? MET A 243 . ? 1_555 ? 5 AC2 8 MET A 128 ? MET A 246 . ? 1_555 ? 6 AC2 8 SER A 129 ? SER A 247 . ? 1_555 ? 7 AC2 8 PHE A 163 ? PHE A 281 . ? 1_555 ? 8 AC2 8 CYS A 166 ? CYS A 284 . ? 1_555 ? 9 AC2 8 GLN A 167 ? GLN A 285 . ? 1_555 ? 10 AC2 8 HIS A 209 ? HIS A 327 . ? 1_555 ? 11 AC2 8 TBY B . ? TBY A 501 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 207 ? ? -57.77 100.03 2 1 CYS A 301 ? ? -117.41 66.78 3 1 PHE A 349 ? ? -97.06 41.63 4 1 PHE A 420 ? ? -152.80 -18.49 5 1 SER A 434 ? ? -116.96 -160.25 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+3/4 3 y+1/2,-x+1/2,z+1/4 4 x+1/2,-y+1/2,-z+1/4 5 -x+1/2,y+1/2,-z+3/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # _pdbx_entry_details.entry_id 7AXG _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 650 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 5.91 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 119 ? A MET 1 2 1 Y 1 A LYS 120 ? A LYS 2 3 1 Y 1 A LYS 121 ? A LYS 3 4 1 Y 1 A GLY 122 ? A GLY 4 5 1 Y 1 A HIS 123 ? A HIS 5 6 1 Y 1 A HIS 124 ? A HIS 6 7 1 Y 1 A HIS 125 ? A HIS 7 8 1 Y 1 A HIS 126 ? A HIS 8 9 1 Y 1 A HIS 127 ? A HIS 9 10 1 Y 1 A HIS 128 ? A HIS 10 11 1 Y 1 A GLY 129 ? A GLY 11 12 1 Y 1 A SER 130 ? A SER 12 13 1 Y 1 A GLU 131 ? A GLU 13 14 1 Y 1 A ARG 132 ? A ARG 14 15 1 Y 1 A THR 133 ? A THR 15 16 1 Y 1 A GLY 134 ? A GLY 16 17 1 Y 1 A THR 135 ? A THR 17 18 1 Y 1 A GLN 136 ? A GLN 18 19 1 Y 1 A PRO 137 ? A PRO 19 20 1 Y 1 A LEU 138 ? A LEU 20 21 1 Y 1 A GLY 139 ? A GLY 21 22 1 Y 1 A VAL 140 ? A VAL 22 23 1 Y 1 A GLN 141 ? A GLN 23 24 1 Y 1 A LEU 178 ? A LEU 60 25 1 Y 1 A SER 179 ? A SER 61 26 1 Y 1 A SER 180 ? A SER 62 27 1 Y 1 A GLY 181 ? A GLY 63 28 1 Y 1 A CYS 182 ? A CYS 64 29 1 Y 1 A GLU 183 ? A GLU 65 30 1 Y 1 A LEU 184 ? A LEU 66 31 1 Y 1 A PRO 185 ? A PRO 67 32 1 Y 1 A GLU 186 ? A GLU 68 33 1 Y 1 A SER 187 ? A SER 69 34 1 Y 1 A LEU 188 ? A LEU 70 35 1 Y 1 A GLN 189 ? A GLN 71 36 1 Y 1 A ALA 190 ? A ALA 72 37 1 Y 1 A PRO 191 ? A PRO 73 38 1 Y 1 A SER 192 ? A SER 74 39 1 Y 1 A ARG 193 ? A ARG 75 40 1 Y 1 A GLU 194 ? A GLU 76 41 1 Y 1 A GLU 195 ? A GLU 77 42 1 Y 1 A ALA 196 ? A ALA 78 43 1 Y 1 A SER 231 ? A SER 113 44 1 Y 1 A GLY 232 ? A GLY 114 45 1 Y 1 A GLY 233 ? A GLY 115 46 1 Y 1 A THR 311 ? A THR 193 47 1 Y 1 A ALA 312 ? A ALA 194 48 1 Y 1 A GLY 313 ? A GLY 195 49 1 Y 1 A VAL 436 ? A VAL 318 50 1 Y 1 A PRO 437 ? A PRO 319 51 1 Y 1 A ARG 438 ? A ARG 320 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 TBY C11 C N N 304 TBY C10 C N N 305 TBY SN1 SN N N 306 TBY C2 C N N 307 TBY C3 C N N 308 TBY C4 C N N 309 TBY C5 C N N 310 TBY C6 C N N 311 TBY C7 C N N 312 TBY C8 C N N 313 TBY C9 C N N 314 TBY C12 C N N 315 TBY C13 C N N 316 TBY H11 H N N 317 TBY H11A H N N 318 TBY H10 H N N 319 TBY H10A H N N 320 TBY H2 H N N 321 TBY H2A H N N 322 TBY H3 H N N 323 TBY H3A H N N 324 TBY H4 H N N 325 TBY H4A H N N 326 TBY H5 H N N 327 TBY H5A H N N 328 TBY H5B H N N 329 TBY H6 H N N 330 TBY H6A H N N 331 TBY H7 H N N 332 TBY H7A H N N 333 TBY H8 H N N 334 TBY H8A H N N 335 TBY H9 H N N 336 TBY H9A H N N 337 TBY H9B H N N 338 TBY H12 H N N 339 TBY H12A H N N 340 TBY H13 H N N 341 TBY H13A H N N 342 TBY H13B H N N 343 THR N N N N 344 THR CA C N S 345 THR C C N N 346 THR O O N N 347 THR CB C N R 348 THR OG1 O N N 349 THR CG2 C N N 350 THR OXT O N N 351 THR H H N N 352 THR H2 H N N 353 THR HA H N N 354 THR HB H N N 355 THR HG1 H N N 356 THR HG21 H N N 357 THR HG22 H N N 358 THR HG23 H N N 359 THR HXT H N N 360 TRP N N N N 361 TRP CA C N S 362 TRP C C N N 363 TRP O O N N 364 TRP CB C N N 365 TRP CG C Y N 366 TRP CD1 C Y N 367 TRP CD2 C Y N 368 TRP NE1 N Y N 369 TRP CE2 C Y N 370 TRP CE3 C Y N 371 TRP CZ2 C Y N 372 TRP CZ3 C Y N 373 TRP CH2 C Y N 374 TRP OXT O N N 375 TRP H H N N 376 TRP H2 H N N 377 TRP HA H N N 378 TRP HB2 H N N 379 TRP HB3 H N N 380 TRP HD1 H N N 381 TRP HE1 H N N 382 TRP HE3 H N N 383 TRP HZ2 H N N 384 TRP HZ3 H N N 385 TRP HH2 H N N 386 TRP HXT H N N 387 TYR N N N N 388 TYR CA C N S 389 TYR C C N N 390 TYR O O N N 391 TYR CB C N N 392 TYR CG C Y N 393 TYR CD1 C Y N 394 TYR CD2 C Y N 395 TYR CE1 C Y N 396 TYR CE2 C Y N 397 TYR CZ C Y N 398 TYR OH O N N 399 TYR OXT O N N 400 TYR H H N N 401 TYR H2 H N N 402 TYR HA H N N 403 TYR HB2 H N N 404 TYR HB3 H N N 405 TYR HD1 H N N 406 TYR HD2 H N N 407 TYR HE1 H N N 408 TYR HE2 H N N 409 TYR HH H N N 410 TYR HXT H N N 411 VAL N N N N 412 VAL CA C N S 413 VAL C C N N 414 VAL O O N N 415 VAL CB C N N 416 VAL CG1 C N N 417 VAL CG2 C N N 418 VAL OXT O N N 419 VAL H H N N 420 VAL H2 H N N 421 VAL HA H N N 422 VAL HB H N N 423 VAL HG11 H N N 424 VAL HG12 H N N 425 VAL HG13 H N N 426 VAL HG21 H N N 427 VAL HG22 H N N 428 VAL HG23 H N N 429 VAL HXT H N N 430 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 TBY C11 C10 sing N N 290 TBY C11 C12 sing N N 291 TBY C10 SN1 sing N N 292 TBY SN1 C2 sing N N 293 TBY SN1 C6 sing N N 294 TBY C2 C3 sing N N 295 TBY C3 C4 sing N N 296 TBY C4 C5 sing N N 297 TBY C6 C7 sing N N 298 TBY C7 C8 sing N N 299 TBY C8 C9 sing N N 300 TBY C12 C13 sing N N 301 TBY C11 H11 sing N N 302 TBY C11 H11A sing N N 303 TBY C10 H10 sing N N 304 TBY C10 H10A sing N N 305 TBY C2 H2 sing N N 306 TBY C2 H2A sing N N 307 TBY C3 H3 sing N N 308 TBY C3 H3A sing N N 309 TBY C4 H4 sing N N 310 TBY C4 H4A sing N N 311 TBY C5 H5 sing N N 312 TBY C5 H5A sing N N 313 TBY C5 H5B sing N N 314 TBY C6 H6 sing N N 315 TBY C6 H6A sing N N 316 TBY C7 H7 sing N N 317 TBY C7 H7A sing N N 318 TBY C8 H8 sing N N 319 TBY C8 H8A sing N N 320 TBY C9 H9 sing N N 321 TBY C9 H9A sing N N 322 TBY C9 H9B sing N N 323 TBY C12 H12 sing N N 324 TBY C12 H12A sing N N 325 TBY C13 H13 sing N N 326 TBY C13 H13A sing N N 327 TBY C13 H13B sing N N 328 THR N CA sing N N 329 THR N H sing N N 330 THR N H2 sing N N 331 THR CA C sing N N 332 THR CA CB sing N N 333 THR CA HA sing N N 334 THR C O doub N N 335 THR C OXT sing N N 336 THR CB OG1 sing N N 337 THR CB CG2 sing N N 338 THR CB HB sing N N 339 THR OG1 HG1 sing N N 340 THR CG2 HG21 sing N N 341 THR CG2 HG22 sing N N 342 THR CG2 HG23 sing N N 343 THR OXT HXT sing N N 344 TRP N CA sing N N 345 TRP N H sing N N 346 TRP N H2 sing N N 347 TRP CA C sing N N 348 TRP CA CB sing N N 349 TRP CA HA sing N N 350 TRP C O doub N N 351 TRP C OXT sing N N 352 TRP CB CG sing N N 353 TRP CB HB2 sing N N 354 TRP CB HB3 sing N N 355 TRP CG CD1 doub Y N 356 TRP CG CD2 sing Y N 357 TRP CD1 NE1 sing Y N 358 TRP CD1 HD1 sing N N 359 TRP CD2 CE2 doub Y N 360 TRP CD2 CE3 sing Y N 361 TRP NE1 CE2 sing Y N 362 TRP NE1 HE1 sing N N 363 TRP CE2 CZ2 sing Y N 364 TRP CE3 CZ3 doub Y N 365 TRP CE3 HE3 sing N N 366 TRP CZ2 CH2 doub Y N 367 TRP CZ2 HZ2 sing N N 368 TRP CZ3 CH2 sing Y N 369 TRP CZ3 HZ3 sing N N 370 TRP CH2 HH2 sing N N 371 TRP OXT HXT sing N N 372 TYR N CA sing N N 373 TYR N H sing N N 374 TYR N H2 sing N N 375 TYR CA C sing N N 376 TYR CA CB sing N N 377 TYR CA HA sing N N 378 TYR C O doub N N 379 TYR C OXT sing N N 380 TYR CB CG sing N N 381 TYR CB HB2 sing N N 382 TYR CB HB3 sing N N 383 TYR CG CD1 doub Y N 384 TYR CG CD2 sing Y N 385 TYR CD1 CE1 sing Y N 386 TYR CD1 HD1 sing N N 387 TYR CD2 CE2 doub Y N 388 TYR CD2 HD2 sing N N 389 TYR CE1 CZ doub Y N 390 TYR CE1 HE1 sing N N 391 TYR CE2 CZ sing Y N 392 TYR CE2 HE2 sing N N 393 TYR CZ OH sing N N 394 TYR OH HH sing N N 395 TYR OXT HXT sing N N 396 VAL N CA sing N N 397 VAL N H sing N N 398 VAL N H2 sing N N 399 VAL CA C sing N N 400 VAL CA CB sing N N 401 VAL CA HA sing N N 402 VAL C O doub N N 403 VAL C OXT sing N N 404 VAL CB CG1 sing N N 405 VAL CB CG2 sing N N 406 VAL CB HB sing N N 407 VAL CG1 HG11 sing N N 408 VAL CG1 HG12 sing N N 409 VAL CG1 HG13 sing N N 410 VAL CG2 HG21 sing N N 411 VAL CG2 HG22 sing N N 412 VAL CG2 HG23 sing N N 413 VAL OXT HXT sing N N 414 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Agence Nationale de la Recherche (ANR)' France ANR-10-INBS-04-01 1 'Agence Nationale de la Recherche (ANR)' France ANR-10-INBS-05 2 'European Union (EU)' France 825489 3 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id TBY _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id TBY _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1ILG _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 43 21 2' _space_group.name_Hall 'P 4nw 2abw' _space_group.IT_number 96 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 7AXG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010832 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010832 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011533 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? SN ? ? 40.10939 9.71450 ? ? 1.78792 30.82803 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_