data_7B0K # _entry.id 7B0K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7B0K pdb_00007b0k 10.2210/pdb7b0k/pdb WWPDB D_1292112398 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7B0K _pdbx_database_status.recvd_initial_deposition_date 2020-11-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Baerland, N.' 1 ? 'Perez, C.' 2 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary 'Sci Adv' ? ? 2375-2548 ? ? 8 ? eabm1122 eabm1122 'Mechanistic basis of choline import involved in teichoic acids and lipopolysaccharide modification.' 2022 ? 10.1126/sciadv.abm1122 35235350 ? ? ? ? ? ? ? ? ? US ? ? 1 Biorxiv ? ? ? ? ? ? ? ? ? 'Mechanistic basis of choline import involved in teichoic acids and lipopolysaccharide modification' 2021 ? 10.1101/2021.09.14.460277 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Barland, N.' 1 0000-0002-8168-6248 primary 'Rueff, A.S.' 2 ? primary 'Cebrero, G.' 3 0000-0001-7171-0921 primary 'Hutter, C.A.J.' 4 0000-0002-8920-3343 primary 'Seeger, M.A.' 5 0000-0003-1761-8571 primary 'Veening, J.W.' 6 0000-0002-3162-6634 primary 'Perez, C.' 7 0000-0002-5800-0084 1 'Barland, N.' 8 ? 1 'Rueff, A.S.' 9 ? 1 'Cebrero, G.' 10 ? 1 'Hutter, C.A.' 11 ? 1 'Seeger, M.A.' 12 ? 1 'Veening, J.W.' 13 ? 1 'Perez, C.' 14 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 120.431 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7B0K _cell.details ? _cell.formula_units_Z ? _cell.length_a 128.900 _cell.length_a_esd ? _cell.length_b 43.440 _cell.length_b_esd ? _cell.length_c 126.820 _cell.length_c_esd ? _cell.volume 612291.914 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7B0K _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y' _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Drug/metabolite transporter (DMT) superfamily permease' 31647.631 1 ? ? 'membrane protein' ? 2 non-polymer syn 'CHOLINE ION' 104.171 1 ? ? ligand ? # _entity_name_com.entity_id 1 _entity_name_com.name 'EamA family transporter' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKSKNGVPFGLLSGIFWGLGLTVSAYIFSIFTDLSPFVVAATHDFLSIFILLAFLLVKEGKVRLSIFLNIRNVSVIIGAL LAGPIGMQANLYAVKYIGSSLASSVSAIYPAISVLLAFFFLKHKISKNTVFGIVLIIGGIIAQTYKVEQVNSFYIGILCA LVCAIAWGSESVLSSFAMESELSEIEALLIRQVTSFLSYLVIVLFSHQSFTAVANGQLLGLMIVFAAFDMISYLAYYIAI NRLQPAKATGLNVSYVVWTVLFAVVFLGAPLDMLTIMTSLVVIAGVYIIIKE ; _entity_poly.pdbx_seq_one_letter_code_can ;MKSKNGVPFGLLSGIFWGLGLTVSAYIFSIFTDLSPFVVAATHDFLSIFILLAFLLVKEGKVRLSIFLNIRNVSVIIGAL LAGPIGMQANLYAVKYIGSSLASSVSAIYPAISVLLAFFFLKHKISKNTVFGIVLIIGGIIAQTYKVEQVNSFYIGILCA LVCAIAWGSESVLSSFAMESELSEIEALLIRQVTSFLSYLVIVLFSHQSFTAVANGQLLGLMIVFAAFDMISYLAYYIAI NRLQPAKATGLNVSYVVWTVLFAVVFLGAPLDMLTIMTSLVVIAGVYIIIKE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 SER n 1 4 LYS n 1 5 ASN n 1 6 GLY n 1 7 VAL n 1 8 PRO n 1 9 PHE n 1 10 GLY n 1 11 LEU n 1 12 LEU n 1 13 SER n 1 14 GLY n 1 15 ILE n 1 16 PHE n 1 17 TRP n 1 18 GLY n 1 19 LEU n 1 20 GLY n 1 21 LEU n 1 22 THR n 1 23 VAL n 1 24 SER n 1 25 ALA n 1 26 TYR n 1 27 ILE n 1 28 PHE n 1 29 SER n 1 30 ILE n 1 31 PHE n 1 32 THR n 1 33 ASP n 1 34 LEU n 1 35 SER n 1 36 PRO n 1 37 PHE n 1 38 VAL n 1 39 VAL n 1 40 ALA n 1 41 ALA n 1 42 THR n 1 43 HIS n 1 44 ASP n 1 45 PHE n 1 46 LEU n 1 47 SER n 1 48 ILE n 1 49 PHE n 1 50 ILE n 1 51 LEU n 1 52 LEU n 1 53 ALA n 1 54 PHE n 1 55 LEU n 1 56 LEU n 1 57 VAL n 1 58 LYS n 1 59 GLU n 1 60 GLY n 1 61 LYS n 1 62 VAL n 1 63 ARG n 1 64 LEU n 1 65 SER n 1 66 ILE n 1 67 PHE n 1 68 LEU n 1 69 ASN n 1 70 ILE n 1 71 ARG n 1 72 ASN n 1 73 VAL n 1 74 SER n 1 75 VAL n 1 76 ILE n 1 77 ILE n 1 78 GLY n 1 79 ALA n 1 80 LEU n 1 81 LEU n 1 82 ALA n 1 83 GLY n 1 84 PRO n 1 85 ILE n 1 86 GLY n 1 87 MET n 1 88 GLN n 1 89 ALA n 1 90 ASN n 1 91 LEU n 1 92 TYR n 1 93 ALA n 1 94 VAL n 1 95 LYS n 1 96 TYR n 1 97 ILE n 1 98 GLY n 1 99 SER n 1 100 SER n 1 101 LEU n 1 102 ALA n 1 103 SER n 1 104 SER n 1 105 VAL n 1 106 SER n 1 107 ALA n 1 108 ILE n 1 109 TYR n 1 110 PRO n 1 111 ALA n 1 112 ILE n 1 113 SER n 1 114 VAL n 1 115 LEU n 1 116 LEU n 1 117 ALA n 1 118 PHE n 1 119 PHE n 1 120 PHE n 1 121 LEU n 1 122 LYS n 1 123 HIS n 1 124 LYS n 1 125 ILE n 1 126 SER n 1 127 LYS n 1 128 ASN n 1 129 THR n 1 130 VAL n 1 131 PHE n 1 132 GLY n 1 133 ILE n 1 134 VAL n 1 135 LEU n 1 136 ILE n 1 137 ILE n 1 138 GLY n 1 139 GLY n 1 140 ILE n 1 141 ILE n 1 142 ALA n 1 143 GLN n 1 144 THR n 1 145 TYR n 1 146 LYS n 1 147 VAL n 1 148 GLU n 1 149 GLN n 1 150 VAL n 1 151 ASN n 1 152 SER n 1 153 PHE n 1 154 TYR n 1 155 ILE n 1 156 GLY n 1 157 ILE n 1 158 LEU n 1 159 CYS n 1 160 ALA n 1 161 LEU n 1 162 VAL n 1 163 CYS n 1 164 ALA n 1 165 ILE n 1 166 ALA n 1 167 TRP n 1 168 GLY n 1 169 SER n 1 170 GLU n 1 171 SER n 1 172 VAL n 1 173 LEU n 1 174 SER n 1 175 SER n 1 176 PHE n 1 177 ALA n 1 178 MET n 1 179 GLU n 1 180 SER n 1 181 GLU n 1 182 LEU n 1 183 SER n 1 184 GLU n 1 185 ILE n 1 186 GLU n 1 187 ALA n 1 188 LEU n 1 189 LEU n 1 190 ILE n 1 191 ARG n 1 192 GLN n 1 193 VAL n 1 194 THR n 1 195 SER n 1 196 PHE n 1 197 LEU n 1 198 SER n 1 199 TYR n 1 200 LEU n 1 201 VAL n 1 202 ILE n 1 203 VAL n 1 204 LEU n 1 205 PHE n 1 206 SER n 1 207 HIS n 1 208 GLN n 1 209 SER n 1 210 PHE n 1 211 THR n 1 212 ALA n 1 213 VAL n 1 214 ALA n 1 215 ASN n 1 216 GLY n 1 217 GLN n 1 218 LEU n 1 219 LEU n 1 220 GLY n 1 221 LEU n 1 222 MET n 1 223 ILE n 1 224 VAL n 1 225 PHE n 1 226 ALA n 1 227 ALA n 1 228 PHE n 1 229 ASP n 1 230 MET n 1 231 ILE n 1 232 SER n 1 233 TYR n 1 234 LEU n 1 235 ALA n 1 236 TYR n 1 237 TYR n 1 238 ILE n 1 239 ALA n 1 240 ILE n 1 241 ASN n 1 242 ARG n 1 243 LEU n 1 244 GLN n 1 245 PRO n 1 246 ALA n 1 247 LYS n 1 248 ALA n 1 249 THR n 1 250 GLY n 1 251 LEU n 1 252 ASN n 1 253 VAL n 1 254 SER n 1 255 TYR n 1 256 VAL n 1 257 VAL n 1 258 TRP n 1 259 THR n 1 260 VAL n 1 261 LEU n 1 262 PHE n 1 263 ALA n 1 264 VAL n 1 265 VAL n 1 266 PHE n 1 267 LEU n 1 268 GLY n 1 269 ALA n 1 270 PRO n 1 271 LEU n 1 272 ASP n 1 273 MET n 1 274 LEU n 1 275 THR n 1 276 ILE n 1 277 MET n 1 278 THR n 1 279 SER n 1 280 LEU n 1 281 VAL n 1 282 VAL n 1 283 ILE n 1 284 ALA n 1 285 GLY n 1 286 VAL n 1 287 TYR n 1 288 ILE n 1 289 ILE n 1 290 ILE n 1 291 LYS n 1 292 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 292 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ;ERS021280_00207, ERS409062_01153, GM533_00320, SAMEA104035127_01235, SAMEA104035134_01163, SAMEA104154639_01167, SAMEA104154682_01012, SAMEA2204024_01167, SAMEA3232645_00550, SAMEA3354337_01417, SAMEA3389964_01659, SAMEA3390019_01836, SAMEA3714202_00443 ; _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus pneumoniae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1313 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant Gold _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0E7XN74_STREE _struct_ref.pdbx_db_accession A0A0E7XN74 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKSKNGVPFGLLSGIFWGLGLTVSAYIFSIFTDLSPFVVAATHDFLSIFILLAFLLVKEGKVRLSIFLNIRNVSVIIGAL LAGPIGMQANLYAVKYIGSSLASSVSAIYPAISVLLAFFFLKHKISKNTVFGIVLIIGGIIAQTYKVEQVNSFYIGILCA LVCAIAWGSESVLSSFAMESELSEIEALLIRQVTSFLSYLVIVLFSHQSFTAVANGQLLGLMIVFAAFDMISYLAYYIAI NRLQPAKATGLNVSYVVWTVLFAVVFLGAPLDMLTIMTSLVVIAGVYIIIKE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7B0K _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 292 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0E7XN74 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 292 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 292 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CHT non-polymer . 'CHOLINE ION' ? 'C5 H14 N O 1' 104.171 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7B0K _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.84 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 74.57 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30 % PEG 400, 50 mM HEPES pH 6.4' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 298 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-02-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate 114.86 _reflns.entry_id 7B0K _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.530 _reflns.d_resolution_low 12.995 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5593 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 72.100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.259 _reflns.pdbx_Rmerge_I_obs 0.121 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 3.940 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.821 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.146 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 18226 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 3.830 3.950 ? 2.320 ? ? ? ? 196 37.200 ? ? ? ? 0.571 ? ? ? ? ? ? ? ? 3.520 ? ? ? ? 0.677 ? ? 1 1 0.851 ? ? ? ? ? ? ? ? ? ? 3.950 4.080 ? 1.730 ? ? ? ? 294 61.100 ? ? ? ? 0.815 ? ? ? ? ? ? ? ? 3.527 ? ? ? ? 0.961 ? ? 2 1 0.795 ? ? ? ? ? ? ? ? ? ? 4.080 4.220 ? 1.740 ? ? ? ? 453 89.500 ? ? ? ? 0.671 ? ? ? ? ? ? ? ? 3.501 ? ? ? ? 0.796 ? ? 3 1 0.883 ? ? ? ? ? ? ? ? ? ? 4.220 4.380 ? 2.190 ? ? ? ? 474 99.000 ? ? ? ? 0.550 ? ? ? ? ? ? ? ? 3.437 ? ? ? ? 0.654 ? ? 4 1 0.922 ? ? ? ? ? ? ? ? ? ? 4.380 4.560 ? 2.660 ? ? ? ? 435 98.000 ? ? ? ? 0.413 ? ? ? ? ? ? ? ? 3.425 ? ? ? ? 0.494 ? ? 5 1 0.955 ? ? ? ? ? ? ? ? ? ? 4.560 4.760 ? 3.020 ? ? ? ? 426 97.500 ? ? ? ? 0.365 ? ? ? ? ? ? ? ? 3.369 ? ? ? ? 0.437 ? ? 6 1 0.972 ? ? ? ? ? ? ? ? ? ? 4.760 4.990 ? 3.290 ? ? ? ? 396 97.800 ? ? ? ? 0.347 ? ? ? ? ? ? ? ? 3.275 ? ? ? ? 0.415 ? ? 7 1 0.950 ? ? ? ? ? ? ? ? ? ? 4.990 5.260 ? 3.570 ? ? ? ? 402 96.900 ? ? ? ? 0.303 ? ? ? ? ? ? ? ? 3.241 ? ? ? ? 0.363 ? ? 8 1 0.967 ? ? ? ? ? ? ? ? ? ? 5.260 5.580 ? 3.520 ? ? ? ? 358 94.200 ? ? ? ? 0.268 ? ? ? ? ? ? ? ? 3.179 ? ? ? ? 0.323 ? ? 9 1 0.975 ? ? ? ? ? ? ? ? ? ? 5.580 5.970 ? 3.720 ? ? ? ? 332 95.700 ? ? ? ? 0.251 ? ? ? ? ? ? ? ? 3.000 ? ? ? ? 0.306 ? ? 10 1 0.954 ? ? ? ? ? ? ? ? ? ? 5.970 6.440 ? 4.680 ? ? ? ? 339 98.800 ? ? ? ? 0.213 ? ? ? ? ? ? ? ? 3.324 ? ? ? ? 0.255 ? ? 11 1 0.964 ? ? ? ? ? ? ? ? ? ? 6.440 7.060 ? 5.790 ? ? ? ? 315 98.400 ? ? ? ? 0.166 ? ? ? ? ? ? ? ? 3.324 ? ? ? ? 0.197 ? ? 12 1 0.984 ? ? ? ? ? ? ? ? ? ? 7.060 7.890 ? 7.070 ? ? ? ? 269 98.500 ? ? ? ? 0.102 ? ? ? ? ? ? ? ? 2.974 ? ? ? ? 0.124 ? ? 13 1 0.990 ? ? ? ? ? ? ? ? ? ? 7.890 9.110 ? 8.390 ? ? ? ? 249 94.700 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 2.948 ? ? ? ? 0.082 ? ? 14 1 0.995 ? ? ? ? ? ? ? ? ? ? 9.110 11.160 ? 8.870 ? ? ? ? 186 87.700 ? ? ? ? 0.070 ? ? ? ? ? ? ? ? 2.565 ? ? ? ? 0.086 ? ? 15 1 0.990 ? ? ? ? ? ? ? ? ? ? 11.160 15.790 ? 9.240 ? ? ? ? 149 89.200 ? ? ? ? 0.060 ? ? ? ? ? ? ? ? 2.772 ? ? ? ? 0.072 ? ? 16 1 0.995 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 101.62 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7B0K _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.80 _refine.ls_d_res_low 10.96 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5147 _refine.ls_number_reflns_R_free 513 _refine.ls_number_reflns_R_work 4634 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 86.77 _refine.ls_percent_reflns_R_free 9.97 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.3110 _refine.ls_R_factor_R_free 0.3267 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.3091 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model other _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 38.1135 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.7292 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.80 _refine_hist.d_res_low 10.96 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1945 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1938 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0026 ? 1984 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5637 ? 2701 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0402 ? 343 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0039 ? 314 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.7054 ? 1137 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.80 4.17 . . 82 718 55.17 . . . 0.4071 . 0.3653 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.17 4.72 . . 143 1295 97.96 . . . 0.3144 . 0.3234 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.72 5.80 . . 145 1281 96.29 . . . 0.3487 . 0.3127 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.80 10.96 . . 143 1340 96.86 . . . 0.2959 . 0.2838 . . . . . . . . . . . # _struct.entry_id 7B0K _struct.title 'membrane protein structure' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7B0K _struct_keywords.text 'choline transporter, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 6 ? SER A 29 ? GLY A 6 SER A 29 1 ? 24 HELX_P HELX_P2 AA2 PHE A 37 ? ALA A 53 ? PHE A 37 ALA A 53 1 ? 17 HELX_P HELX_P3 AA3 PHE A 54 ? LEU A 56 ? PHE A 54 LEU A 56 5 ? 3 HELX_P HELX_P4 AA4 ARG A 71 ? LEU A 80 ? ARG A 71 LEU A 80 1 ? 10 HELX_P HELX_P5 AA5 GLY A 86 ? TYR A 92 ? GLY A 86 TYR A 92 1 ? 7 HELX_P HELX_P6 AA6 SER A 100 ? SER A 106 ? SER A 100 SER A 106 1 ? 7 HELX_P HELX_P7 AA7 ILE A 108 ? PHE A 118 ? ILE A 108 PHE A 118 1 ? 11 HELX_P HELX_P8 AA8 THR A 129 ? TYR A 145 ? THR A 129 TYR A 145 1 ? 17 HELX_P HELX_P9 AA9 ILE A 155 ? ALA A 177 ? ILE A 155 ALA A 177 1 ? 23 HELX_P HELX_P10 AB1 GLU A 186 ? VAL A 203 ? GLU A 186 VAL A 203 1 ? 18 HELX_P HELX_P11 AB2 GLN A 217 ? LEU A 243 ? GLN A 217 LEU A 243 1 ? 27 HELX_P HELX_P12 AB3 GLN A 244 ? VAL A 253 ? GLN A 244 VAL A 253 1 ? 10 HELX_P HELX_P13 AB4 SER A 254 ? VAL A 256 ? SER A 254 VAL A 256 5 ? 3 HELX_P HELX_P14 AB5 VAL A 257 ? PHE A 266 ? VAL A 257 PHE A 266 1 ? 10 HELX_P HELX_P15 AB6 ASP A 272 ? GLY A 285 ? ASP A 272 GLY A 285 1 ? 14 HELX_P HELX_P16 AB7 GLY A 285 ? ILE A 290 ? GLY A 285 ILE A 290 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 7B0K _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.007758 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.004557 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023020 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009145 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 LYS 4 4 ? ? ? A . n A 1 5 ASN 5 5 ? ? ? A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 TRP 17 17 17 TRP TRP A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 VAL 57 57 ? ? ? A . n A 1 58 LYS 58 58 ? ? ? A . n A 1 59 GLU 59 59 ? ? ? A . n A 1 60 GLY 60 60 ? ? ? A . n A 1 61 LYS 61 61 ? ? ? A . n A 1 62 VAL 62 62 ? ? ? A . n A 1 63 ARG 63 63 ? ? ? A . n A 1 64 LEU 64 64 ? ? ? A . n A 1 65 SER 65 65 ? ? ? A . n A 1 66 ILE 66 66 ? ? ? A . n A 1 67 PHE 67 67 ? ? ? A . n A 1 68 LEU 68 68 ? ? ? A . n A 1 69 ASN 69 69 ? ? ? A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 TYR 109 109 109 TYR TYR A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 HIS 123 123 123 HIS HIS A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 TYR 145 145 145 TYR TYR A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 GLU 148 148 ? ? ? A . n A 1 149 GLN 149 149 ? ? ? A . n A 1 150 VAL 150 150 ? ? ? A . n A 1 151 ASN 151 151 ? ? ? A . n A 1 152 SER 152 152 ? ? ? A . n A 1 153 PHE 153 153 ? ? ? A . n A 1 154 TYR 154 154 154 TYR TYR A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 ILE 157 157 157 ILE ILE A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 CYS 159 159 159 CYS CYS A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 CYS 163 163 163 CYS CYS A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 ILE 165 165 165 ILE ILE A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 TRP 167 167 167 TRP TRP A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 MET 178 178 178 MET MET A . n A 1 179 GLU 179 179 179 GLU GLU A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 ILE 185 185 185 ILE ILE A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 ILE 190 190 190 ILE ILE A . n A 1 191 ARG 191 191 191 ARG ARG A . n A 1 192 GLN 192 192 192 GLN GLN A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 THR 194 194 194 THR THR A . n A 1 195 SER 195 195 195 SER SER A . n A 1 196 PHE 196 196 196 PHE PHE A . n A 1 197 LEU 197 197 197 LEU LEU A . n A 1 198 SER 198 198 198 SER SER A . n A 1 199 TYR 199 199 199 TYR TYR A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 ILE 202 202 202 ILE ILE A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 LEU 204 204 ? ? ? A . n A 1 205 PHE 205 205 ? ? ? A . n A 1 206 SER 206 206 ? ? ? A . n A 1 207 HIS 207 207 ? ? ? A . n A 1 208 GLN 208 208 ? ? ? A . n A 1 209 SER 209 209 ? ? ? A . n A 1 210 PHE 210 210 ? ? ? A . n A 1 211 THR 211 211 ? ? ? A . n A 1 212 ALA 212 212 ? ? ? A . n A 1 213 VAL 213 213 ? ? ? A . n A 1 214 ALA 214 214 ? ? ? A . n A 1 215 ASN 215 215 ? ? ? A . n A 1 216 GLY 216 216 216 GLY GLY A . n A 1 217 GLN 217 217 217 GLN GLN A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 LEU 219 219 219 LEU LEU A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 MET 222 222 222 MET MET A . n A 1 223 ILE 223 223 223 ILE ILE A . n A 1 224 VAL 224 224 224 VAL VAL A . n A 1 225 PHE 225 225 225 PHE PHE A . n A 1 226 ALA 226 226 226 ALA ALA A . n A 1 227 ALA 227 227 227 ALA ALA A . n A 1 228 PHE 228 228 228 PHE PHE A . n A 1 229 ASP 229 229 229 ASP ASP A . n A 1 230 MET 230 230 230 MET MET A . n A 1 231 ILE 231 231 231 ILE ILE A . n A 1 232 SER 232 232 232 SER SER A . n A 1 233 TYR 233 233 233 TYR TYR A . n A 1 234 LEU 234 234 234 LEU LEU A . n A 1 235 ALA 235 235 235 ALA ALA A . n A 1 236 TYR 236 236 236 TYR TYR A . n A 1 237 TYR 237 237 237 TYR TYR A . n A 1 238 ILE 238 238 238 ILE ILE A . n A 1 239 ALA 239 239 239 ALA ALA A . n A 1 240 ILE 240 240 240 ILE ILE A . n A 1 241 ASN 241 241 241 ASN ASN A . n A 1 242 ARG 242 242 242 ARG ARG A . n A 1 243 LEU 243 243 243 LEU LEU A . n A 1 244 GLN 244 244 244 GLN GLN A . n A 1 245 PRO 245 245 245 PRO PRO A . n A 1 246 ALA 246 246 246 ALA ALA A . n A 1 247 LYS 247 247 247 LYS LYS A . n A 1 248 ALA 248 248 248 ALA ALA A . n A 1 249 THR 249 249 249 THR THR A . n A 1 250 GLY 250 250 250 GLY GLY A . n A 1 251 LEU 251 251 251 LEU LEU A . n A 1 252 ASN 252 252 252 ASN ASN A . n A 1 253 VAL 253 253 253 VAL VAL A . n A 1 254 SER 254 254 254 SER SER A . n A 1 255 TYR 255 255 255 TYR TYR A . n A 1 256 VAL 256 256 256 VAL VAL A . n A 1 257 VAL 257 257 257 VAL VAL A . n A 1 258 TRP 258 258 258 TRP TRP A . n A 1 259 THR 259 259 259 THR THR A . n A 1 260 VAL 260 260 260 VAL VAL A . n A 1 261 LEU 261 261 261 LEU LEU A . n A 1 262 PHE 262 262 262 PHE PHE A . n A 1 263 ALA 263 263 263 ALA ALA A . n A 1 264 VAL 264 264 264 VAL VAL A . n A 1 265 VAL 265 265 265 VAL VAL A . n A 1 266 PHE 266 266 266 PHE PHE A . n A 1 267 LEU 267 267 267 LEU LEU A . n A 1 268 GLY 268 268 268 GLY GLY A . n A 1 269 ALA 269 269 269 ALA ALA A . n A 1 270 PRO 270 270 270 PRO PRO A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 ASP 272 272 272 ASP ASP A . n A 1 273 MET 273 273 273 MET MET A . n A 1 274 LEU 274 274 274 LEU LEU A . n A 1 275 THR 275 275 275 THR THR A . n A 1 276 ILE 276 276 276 ILE ILE A . n A 1 277 MET 277 277 277 MET MET A . n A 1 278 THR 278 278 278 THR THR A . n A 1 279 SER 279 279 279 SER SER A . n A 1 280 LEU 280 280 280 LEU LEU A . n A 1 281 VAL 281 281 281 VAL VAL A . n A 1 282 VAL 282 282 282 VAL VAL A . n A 1 283 ILE 283 283 283 ILE ILE A . n A 1 284 ALA 284 284 284 ALA ALA A . n A 1 285 GLY 285 285 285 GLY GLY A . n A 1 286 VAL 286 286 286 VAL VAL A . n A 1 287 TYR 287 287 287 TYR TYR A . n A 1 288 ILE 288 288 288 ILE ILE A . n A 1 289 ILE 289 289 289 ILE ILE A . n A 1 290 ILE 290 290 290 ILE ILE A . n A 1 291 LYS 291 291 291 LYS LYS A . n A 1 292 GLU 292 292 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email camilo.perez@unibas.ch _pdbx_contact_author.name_first Camilo _pdbx_contact_author.name_last Perez _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5800-0084 # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CHT _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 301 _pdbx_nonpoly_scheme.auth_seq_num 301 _pdbx_nonpoly_scheme.pdb_mon_id CHT _pdbx_nonpoly_scheme.auth_mon_id CHT _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 360 ? 1 MORE 7 ? 1 'SSA (A^2)' 12310 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15.2_3472 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 5 # _pdbx_entry_details.entry_id 7B0K _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 91 ? ? -91.19 -66.08 2 1 TYR A 96 ? ? -146.64 16.95 3 1 ALA A 177 ? ? -79.55 -85.23 4 1 GLU A 186 ? ? -134.72 -35.16 5 1 LEU A 271 ? ? 48.75 72.35 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A LYS 4 ? A LYS 4 5 1 Y 1 A ASN 5 ? A ASN 5 6 1 Y 1 A VAL 57 ? A VAL 57 7 1 Y 1 A LYS 58 ? A LYS 58 8 1 Y 1 A GLU 59 ? A GLU 59 9 1 Y 1 A GLY 60 ? A GLY 60 10 1 Y 1 A LYS 61 ? A LYS 61 11 1 Y 1 A VAL 62 ? A VAL 62 12 1 Y 1 A ARG 63 ? A ARG 63 13 1 Y 1 A LEU 64 ? A LEU 64 14 1 Y 1 A SER 65 ? A SER 65 15 1 Y 1 A ILE 66 ? A ILE 66 16 1 Y 1 A PHE 67 ? A PHE 67 17 1 Y 1 A LEU 68 ? A LEU 68 18 1 Y 1 A ASN 69 ? A ASN 69 19 1 Y 1 A GLU 148 ? A GLU 148 20 1 Y 1 A GLN 149 ? A GLN 149 21 1 Y 1 A VAL 150 ? A VAL 150 22 1 Y 1 A ASN 151 ? A ASN 151 23 1 Y 1 A SER 152 ? A SER 152 24 1 Y 1 A PHE 153 ? A PHE 153 25 1 Y 1 A LEU 204 ? A LEU 204 26 1 Y 1 A PHE 205 ? A PHE 205 27 1 Y 1 A SER 206 ? A SER 206 28 1 Y 1 A HIS 207 ? A HIS 207 29 1 Y 1 A GLN 208 ? A GLN 208 30 1 Y 1 A SER 209 ? A SER 209 31 1 Y 1 A PHE 210 ? A PHE 210 32 1 Y 1 A THR 211 ? A THR 211 33 1 Y 1 A ALA 212 ? A ALA 212 34 1 Y 1 A VAL 213 ? A VAL 213 35 1 Y 1 A ALA 214 ? A ALA 214 36 1 Y 1 A ASN 215 ? A ASN 215 37 1 Y 1 A GLU 292 ? A GLU 292 # _pdbx_audit_support.funding_organization 'Swiss National Science Foundation' _pdbx_audit_support.country Switzerland _pdbx_audit_support.grant_number PP00P3_198903 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id CHT _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id CHT _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CHOLINE ION' _pdbx_entity_nonpoly.comp_id CHT # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #