data_7B0T # _entry.id 7B0T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7B0T pdb_00007b0t 10.2210/pdb7b0t/pdb WWPDB D_1292112438 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-02-17 2 'Structure model' 1 1 2021-04-14 3 'Structure model' 1 2 2021-04-28 4 'Structure model' 1 3 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 3 'Structure model' '_citation.journal_volume' 10 3 'Structure model' '_citation.page_first' 11 3 'Structure model' '_citation.page_last' 12 3 'Structure model' '_citation_author.identifier_ORCID' 13 4 'Structure model' '_database_2.pdbx_DOI' 14 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7B0T _pdbx_database_status.recvd_initial_deposition_date 2020-11-21 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ni, X.' 1 ? 'Chaikuad, A.' 2 ? 'Brennan, P.E.' 3 ? 'Knapp, S.' 4 ? 'Structural Genomics Consortium (SGC)' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Chem.Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1554-8937 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first 571 _citation.page_last 578 _citation.title 'Structure and Inhibitor Binding Characterization of Oncogenic MLLT1 Mutants.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acschembio.0c00960 _citation.pdbx_database_id_PubMed 33749253 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ni, X.' 1 ? primary 'Londregan, A.T.' 2 ? primary 'Owen, D.R.' 3 ? primary 'Knapp, S.' 4 ? primary 'Chaikuad, A.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein ENL' 18045.850 1 ? ? ? ? 2 non-polymer syn '3-iodanyl-4-methyl-~{N}-[2-(piperidin-1-ylmethyl)-3~{H}-benzimidazol-5-yl]benzamide' 474.338 1 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 5 ? ? ? ? 4 water nat water 18.015 13 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'YEATS domain-containing protein 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDNQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPPYKVEESGYAG FIMPIEVHFKNKEEPRKVCFTYDLFLNLEGKVNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEGAHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDNQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPPYKVEESGYAG FIMPIEVHFKNKEEPRKVCFTYDLFLNLEGKVNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEGAHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '3-iodanyl-4-methyl-~{N}-[2-(piperidin-1-ylmethyl)-3~{H}-benzimidazol-5-yl]benzamide' GKT 3 1,2-ETHANEDIOL EDO 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 ASN n 1 4 GLN n 1 5 CYS n 1 6 THR n 1 7 VAL n 1 8 GLN n 1 9 VAL n 1 10 ARG n 1 11 LEU n 1 12 GLU n 1 13 LEU n 1 14 GLY n 1 15 HIS n 1 16 ARG n 1 17 ALA n 1 18 GLN n 1 19 LEU n 1 20 ARG n 1 21 LYS n 1 22 LYS n 1 23 PRO n 1 24 THR n 1 25 THR n 1 26 GLU n 1 27 GLY n 1 28 PHE n 1 29 THR n 1 30 HIS n 1 31 ASP n 1 32 TRP n 1 33 MET n 1 34 VAL n 1 35 PHE n 1 36 VAL n 1 37 ARG n 1 38 GLY n 1 39 PRO n 1 40 GLU n 1 41 GLN n 1 42 CYS n 1 43 ASP n 1 44 ILE n 1 45 GLN n 1 46 HIS n 1 47 PHE n 1 48 VAL n 1 49 GLU n 1 50 LYS n 1 51 VAL n 1 52 VAL n 1 53 PHE n 1 54 TRP n 1 55 LEU n 1 56 HIS n 1 57 ASP n 1 58 SER n 1 59 PHE n 1 60 PRO n 1 61 LYS n 1 62 PRO n 1 63 ARG n 1 64 ARG n 1 65 VAL n 1 66 CYS n 1 67 LYS n 1 68 GLU n 1 69 PRO n 1 70 PRO n 1 71 TYR n 1 72 LYS n 1 73 VAL n 1 74 GLU n 1 75 GLU n 1 76 SER n 1 77 GLY n 1 78 TYR n 1 79 ALA n 1 80 GLY n 1 81 PHE n 1 82 ILE n 1 83 MET n 1 84 PRO n 1 85 ILE n 1 86 GLU n 1 87 VAL n 1 88 HIS n 1 89 PHE n 1 90 LYS n 1 91 ASN n 1 92 LYS n 1 93 GLU n 1 94 GLU n 1 95 PRO n 1 96 ARG n 1 97 LYS n 1 98 VAL n 1 99 CYS n 1 100 PHE n 1 101 THR n 1 102 TYR n 1 103 ASP n 1 104 LEU n 1 105 PHE n 1 106 LEU n 1 107 ASN n 1 108 LEU n 1 109 GLU n 1 110 GLY n 1 111 LYS n 1 112 VAL n 1 113 ASN n 1 114 HIS n 1 115 LEU n 1 116 ARG n 1 117 CYS n 1 118 GLU n 1 119 LYS n 1 120 LEU n 1 121 THR n 1 122 PHE n 1 123 ASN n 1 124 ASN n 1 125 PRO n 1 126 THR n 1 127 THR n 1 128 GLU n 1 129 PHE n 1 130 ARG n 1 131 TYR n 1 132 LYS n 1 133 LEU n 1 134 LEU n 1 135 ARG n 1 136 ALA n 1 137 GLY n 1 138 GLY n 1 139 VAL n 1 140 MET n 1 141 VAL n 1 142 MET n 1 143 PRO n 1 144 GLU n 1 145 GLY n 1 146 ALA n 1 147 HIS n 1 148 HIS n 1 149 HIS n 1 150 HIS n 1 151 HIS n 1 152 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 152 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MLLT1, ENL, LTG19, YEATS1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GKT non-polymer . '3-iodanyl-4-methyl-~{N}-[2-(piperidin-1-ylmethyl)-3~{H}-benzimidazol-5-yl]benzamide' ? 'C21 H23 I N4 O' 474.338 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 ? ? ? A . n A 1 3 ASN 3 3 ? ? ? A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 MET 33 33 33 MET MET A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 CYS 99 99 99 CYS CYS A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 CYS 117 117 117 CYS CYS A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 PHE 122 122 122 PHE PHE A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 TYR 131 131 131 TYR TYR A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 MET 140 140 140 MET MET A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 MET 142 142 ? ? ? A . n A 1 143 PRO 143 143 ? ? ? A . n A 1 144 GLU 144 144 ? ? ? A . n A 1 145 GLY 145 145 ? ? ? A . n A 1 146 ALA 146 146 ? ? ? A . n A 1 147 HIS 147 147 ? ? ? A . n A 1 148 HIS 148 148 ? ? ? A . n A 1 149 HIS 149 149 ? ? ? A . n A 1 150 HIS 150 150 ? ? ? A . n A 1 151 HIS 151 151 ? ? ? A . n A 1 152 HIS 152 152 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GKT 1 201 201 GKT MMA A . C 3 EDO 1 202 301 EDO EDO A . D 3 EDO 1 203 401 EDO EDO A . E 3 EDO 1 204 501 EDO EDO A . F 3 EDO 1 205 601 EDO EDO A . G 3 EDO 1 206 701 EDO EDO A . H 4 HOH 1 301 16 HOH HOH A . H 4 HOH 2 302 13 HOH HOH A . H 4 HOH 3 303 5 HOH HOH A . H 4 HOH 4 304 1 HOH HOH A . H 4 HOH 5 305 2 HOH HOH A . H 4 HOH 6 306 3 HOH HOH A . H 4 HOH 7 307 15 HOH HOH A . H 4 HOH 8 308 14 HOH HOH A . H 4 HOH 9 309 17 HOH HOH A . H 4 HOH 10 310 7 HOH HOH A . H 4 HOH 11 311 10 HOH HOH A . H 4 HOH 12 312 19 HOH HOH A . H 4 HOH 13 313 6 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 4 ? CG ? A GLN 4 CG 2 1 Y 1 A GLN 4 ? CD ? A GLN 4 CD 3 1 Y 1 A GLN 4 ? OE1 ? A GLN 4 OE1 4 1 Y 1 A GLN 4 ? NE2 ? A GLN 4 NE2 5 1 Y 1 A LYS 21 ? CG ? A LYS 21 CG 6 1 Y 1 A LYS 21 ? CD ? A LYS 21 CD 7 1 Y 1 A LYS 21 ? CE ? A LYS 21 CE 8 1 Y 1 A LYS 21 ? NZ ? A LYS 21 NZ 9 1 Y 1 A LYS 22 ? CG ? A LYS 22 CG 10 1 Y 1 A LYS 22 ? CD ? A LYS 22 CD 11 1 Y 1 A LYS 22 ? CE ? A LYS 22 CE 12 1 Y 1 A LYS 22 ? NZ ? A LYS 22 NZ 13 1 Y 1 A GLU 40 ? CG ? A GLU 40 CG 14 1 Y 1 A GLU 40 ? CD ? A GLU 40 CD 15 1 Y 1 A GLU 40 ? OE1 ? A GLU 40 OE1 16 1 Y 1 A GLU 40 ? OE2 ? A GLU 40 OE2 17 1 Y 1 A GLN 41 ? CG ? A GLN 41 CG 18 1 Y 1 A GLN 41 ? CD ? A GLN 41 CD 19 1 Y 1 A GLN 41 ? OE1 ? A GLN 41 OE1 20 1 Y 1 A GLN 41 ? NE2 ? A GLN 41 NE2 21 1 Y 1 A GLU 68 ? CG ? A GLU 68 CG 22 1 Y 1 A GLU 68 ? CD ? A GLU 68 CD 23 1 Y 1 A GLU 68 ? OE1 ? A GLU 68 OE1 24 1 Y 1 A GLU 68 ? OE2 ? A GLU 68 OE2 25 1 Y 1 A GLU 109 ? CG ? A GLU 109 CG 26 1 Y 1 A GLU 109 ? CD ? A GLU 109 CD 27 1 Y 1 A GLU 109 ? OE1 ? A GLU 109 OE1 28 1 Y 1 A GLU 109 ? OE2 ? A GLU 109 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MLPHARE ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7B0T _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.739 _cell.length_a_esd ? _cell.length_b 48.739 _cell.length_b_esd ? _cell.length_c 131.995 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7B0T _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7B0T _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.17 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.37 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '28% PEG 3350, 0.2M NaOAc, 0.1M Bis-Tris, pH6.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-04-23 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7B0T _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.050 _reflns.d_resolution_low 48.740 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10697 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.600 _reflns.pdbx_Rmerge_I_obs 0.094 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.500 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 13 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.099 _reflns.pdbx_Rpim_I_all 0.031 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 103164 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.050 2.110 ? ? ? ? ? ? 804 100.000 ? ? ? ? 1.169 ? ? ? ? ? ? ? ? 10.100 ? ? ? ? ? 0.378 ? 1 1 0.858 ? ? 8.940 48.740 ? ? ? ? ? ? 182 99.900 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 7.500 ? ? ? ? 0.059 0.019 ? 2 1 0.998 ? ? # _refine.aniso_B[1][1] -2.7000 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -2.7000 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 5.4100 _refine.B_iso_max 102.930 _refine.B_iso_mean 56.2810 _refine.B_iso_min 35.430 _refine.correlation_coeff_Fo_to_Fc 0.9590 _refine.correlation_coeff_Fo_to_Fc_free 0.9360 _refine.details 'U VALUES : WITH TLS ADDED HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7B0T _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.0500 _refine.ls_d_res_low 45.7200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10142 _refine.ls_number_reflns_R_free 496 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9500 _refine.ls_percent_reflns_R_free 4.7000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2208 _refine.ls_R_factor_R_free 0.2756 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2180 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6t1j _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.2120 _refine.pdbx_overall_ESU_R_Free 0.1960 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 17.3710 _refine.overall_SU_ML 0.2120 _refine.overall_SU_R_Cruickshank_DPI 0.2123 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.0500 _refine_hist.d_res_low 45.7200 _refine_hist.number_atoms_solvent 13 _refine_hist.number_atoms_total 1183 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 138 _refine_hist.pdbx_B_iso_mean_ligand 62.81 _refine_hist.pdbx_B_iso_mean_solvent 50.55 _refine_hist.pdbx_number_atoms_protein 1123 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 47 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 0.013 1201 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1133 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.313 1.662 1616 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.177 1.608 2598 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.861 5.000 137 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 20.477 20.308 65 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.091 15.000 194 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 21.987 15.000 10 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.064 0.200 142 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 1411 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 297 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.0500 _refine_ls_shell.d_res_low 2.1030 _refine_ls_shell.number_reflns_all 765 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 40 _refine_ls_shell.number_reflns_R_work 725 _refine_ls_shell.percent_reflns_obs 99.8700 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3110 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3080 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7B0T _struct.title 'Crystal structure of MLLT1 YEATS domain T3 mutant in complex with benzimidazole-amide based compound 1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7B0T _struct_keywords.text 'T3 mutant, Structural Genomics, Structural Genomics Consortium, SGC, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ENL_HUMAN _struct_ref.pdbx_db_accession Q03111 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDNQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPPYKVEESGYAG FIMPIEVHFKNKEEPRKVCFTYDLFLNLEGNPPVNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEGA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7B0T _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 146 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q03111 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 148 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 146 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7B0T LYS A 111 ? UNP Q03111 ASN 111 'engineered mutation' 111 1 1 7B0T ? A ? ? UNP Q03111 PRO 112 deletion ? 2 1 7B0T ? A ? ? UNP Q03111 PRO 113 deletion ? 3 1 7B0T HIS A 147 ? UNP Q03111 ? ? 'expression tag' 147 4 1 7B0T HIS A 148 ? UNP Q03111 ? ? 'expression tag' 148 5 1 7B0T HIS A 149 ? UNP Q03111 ? ? 'expression tag' 149 6 1 7B0T HIS A 150 ? UNP Q03111 ? ? 'expression tag' 150 7 1 7B0T HIS A 151 ? UNP Q03111 ? ? 'expression tag' 151 8 1 7B0T HIS A 152 ? UNP Q03111 ? ? 'expression tag' 152 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomer _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 880 ? 1 MORE 11 ? 1 'SSA (A^2)' 7850 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 43 ? HIS A 46 ? ASP A 43 HIS A 46 5 ? 4 HELX_P HELX_P2 AA2 THR A 126 ? ALA A 136 ? THR A 126 ALA A 136 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 69 A . ? PRO 69 A PRO 70 A ? PRO 70 A 1 1.84 2 GLU 94 A . ? GLU 94 A PRO 95 A ? PRO 95 A 1 -13.32 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 71 ? GLY A 77 ? TYR A 71 GLY A 77 AA1 2 HIS A 30 ? ARG A 37 ? HIS A 30 ARG A 37 AA1 3 THR A 6 ? LEU A 19 ? THR A 6 LEU A 19 AA1 4 LYS A 111 ? ASN A 123 ? LYS A 111 ASN A 123 AA2 1 TYR A 71 ? GLY A 77 ? TYR A 71 GLY A 77 AA2 2 HIS A 30 ? ARG A 37 ? HIS A 30 ARG A 37 AA2 3 THR A 6 ? LEU A 19 ? THR A 6 LEU A 19 AA2 4 VAL A 139 ? VAL A 141 ? VAL A 139 VAL A 141 AA3 1 ARG A 63 ? CYS A 66 ? ARG A 63 CYS A 66 AA3 2 VAL A 48 ? TRP A 54 ? VAL A 48 TRP A 54 AA3 3 PHE A 81 ? PHE A 89 ? PHE A 81 PHE A 89 AA3 4 LYS A 97 ? LEU A 104 ? LYS A 97 LEU A 104 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 75 ? O GLU A 75 N TRP A 32 ? N TRP A 32 AA1 2 3 O ARG A 37 ? O ARG A 37 N GLU A 12 ? N GLU A 12 AA1 3 4 N LEU A 13 ? N LEU A 13 O ARG A 116 ? O ARG A 116 AA2 1 2 O GLU A 75 ? O GLU A 75 N TRP A 32 ? N TRP A 32 AA2 2 3 O ARG A 37 ? O ARG A 37 N GLU A 12 ? N GLU A 12 AA2 3 4 N GLN A 8 ? N GLN A 8 O VAL A 139 ? O VAL A 139 AA3 1 2 O ARG A 64 ? O ARG A 64 N PHE A 53 ? N PHE A 53 AA3 2 3 N LYS A 50 ? N LYS A 50 O HIS A 88 ? O HIS A 88 AA3 3 4 N MET A 83 ? N MET A 83 O TYR A 102 ? O TYR A 102 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A GKT 201 ? 14 'binding site for residue GKT A 201' AC2 Software A EDO 202 ? 7 'binding site for residue EDO A 202' AC3 Software A EDO 203 ? 3 'binding site for residue EDO A 203' AC4 Software A EDO 204 ? 4 'binding site for residue EDO A 204' AC5 Software A EDO 205 ? 6 'binding site for residue EDO A 205' AC6 Software A EDO 206 ? 4 'binding site for residue EDO A 206' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 PHE A 28 ? PHE A 28 . ? 1_555 ? 2 AC1 14 HIS A 56 ? HIS A 56 . ? 1_555 ? 3 AC1 14 SER A 58 ? SER A 58 . ? 1_555 ? 4 AC1 14 PHE A 59 ? PHE A 59 . ? 1_555 ? 5 AC1 14 PRO A 60 ? PRO A 60 . ? 1_555 ? 6 AC1 14 GLU A 75 ? GLU A 75 . ? 1_555 ? 7 AC1 14 SER A 76 ? SER A 76 . ? 1_555 ? 8 AC1 14 GLY A 77 ? GLY A 77 . ? 1_555 ? 9 AC1 14 TYR A 78 ? TYR A 78 . ? 1_555 ? 10 AC1 14 ALA A 79 ? ALA A 79 . ? 1_555 ? 11 AC1 14 GLY A 80 ? GLY A 80 . ? 1_555 ? 12 AC1 14 ARG A 130 ? ARG A 130 . ? 1_565 ? 13 AC1 14 MET A 140 ? MET A 140 . ? 1_565 ? 14 AC1 14 HOH H . ? HOH A 310 . ? 1_555 ? 15 AC2 7 VAL A 9 ? VAL A 9 . ? 1_555 ? 16 AC2 7 ARG A 10 ? ARG A 10 . ? 1_555 ? 17 AC2 7 PRO A 39 ? PRO A 39 . ? 1_555 ? 18 AC2 7 CYS A 42 ? CYS A 42 . ? 1_555 ? 19 AC2 7 ILE A 44 ? ILE A 44 . ? 1_555 ? 20 AC2 7 PHE A 47 ? PHE A 47 . ? 1_555 ? 21 AC2 7 ALA A 136 ? ALA A 136 . ? 1_555 ? 22 AC3 3 GLN A 18 ? GLN A 18 . ? 1_555 ? 23 AC3 3 TRP A 32 ? TRP A 32 . ? 1_555 ? 24 AC3 3 MET A 33 ? MET A 33 . ? 1_555 ? 25 AC4 4 TYR A 102 ? TYR A 102 . ? 1_555 ? 26 AC4 4 ASP A 103 ? ASP A 103 . ? 1_555 ? 27 AC4 4 HIS A 114 ? HIS A 114 . ? 7_555 ? 28 AC4 4 ARG A 116 ? ARG A 116 . ? 1_555 ? 29 AC5 6 LYS A 111 ? LYS A 111 . ? 1_555 ? 30 AC5 6 VAL A 112 ? VAL A 112 . ? 1_555 ? 31 AC5 6 ASN A 113 ? ASN A 113 . ? 1_555 ? 32 AC5 6 CYS A 117 ? CYS A 117 . ? 7_555 ? 33 AC5 6 GLU A 118 ? GLU A 118 . ? 7_555 ? 34 AC5 6 LYS A 119 ? LYS A 119 . ? 7_555 ? 35 AC6 4 PRO A 70 ? PRO A 70 . ? 6_545 ? 36 AC6 4 GLU A 93 ? GLU A 93 . ? 1_555 ? 37 AC6 4 GLU A 94 ? GLU A 94 . ? 1_555 ? 38 AC6 4 HOH H . ? HOH A 306 . ? 6_545 ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 41 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 81.81 _pdbx_validate_torsion.psi 1.39 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Genomics Consortium' _pdbx_SG_project.initial_of_center SGC # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -0.8921 _pdbx_refine_tls.origin_y -4.0944 _pdbx_refine_tls.origin_z 12.9729 _pdbx_refine_tls.T[1][1] 0.0159 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0132 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0001 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.0194 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0165 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.1513 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 3.6929 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -2.5145 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.4478 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 5.8809 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.7502 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.3182 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.1301 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.2367 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0132 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.0605 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0783 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0381 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.1182 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.0921 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.2084 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 4 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 141 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # _pdbx_entry_details.entry_id 7B0T _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASP 2 ? A ASP 2 3 1 Y 1 A ASN 3 ? A ASN 3 4 1 Y 1 A MET 142 ? A MET 142 5 1 Y 1 A PRO 143 ? A PRO 143 6 1 Y 1 A GLU 144 ? A GLU 144 7 1 Y 1 A GLY 145 ? A GLY 145 8 1 Y 1 A ALA 146 ? A ALA 146 9 1 Y 1 A HIS 147 ? A HIS 147 10 1 Y 1 A HIS 148 ? A HIS 148 11 1 Y 1 A HIS 149 ? A HIS 149 12 1 Y 1 A HIS 150 ? A HIS 150 13 1 Y 1 A HIS 151 ? A HIS 151 14 1 Y 1 A HIS 152 ? A HIS 152 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GKT C1 C Y N 98 GKT C2 C Y N 99 GKT C3 C Y N 100 GKT C4 C Y N 101 GKT C5 C Y N 102 GKT C6 C Y N 103 GKT C7 C N N 104 GKT O O N N 105 GKT I I N N 106 GKT C C N N 107 GKT N N N N 108 GKT C8 C Y N 109 GKT C20 C Y N 110 GKT C19 C Y N 111 GKT C11 C Y N 112 GKT C10 C Y N 113 GKT C9 C Y N 114 GKT N3 N Y N 115 GKT C12 C Y N 116 GKT N1 N Y N 117 GKT C13 C N N 118 GKT N2 N N N 119 GKT C18 C N N 120 GKT C17 C N N 121 GKT C16 C N N 122 GKT C15 C N N 123 GKT C14 C N N 124 GKT H1 H N N 125 GKT H2 H N N 126 GKT H3 H N N 127 GKT H4 H N N 128 GKT H5 H N N 129 GKT H6 H N N 130 GKT H7 H N N 131 GKT H8 H N N 132 GKT H9 H N N 133 GKT H10 H N N 134 GKT H11 H N N 135 GKT H13 H N N 136 GKT H14 H N N 137 GKT H16 H N N 138 GKT H17 H N N 139 GKT H18 H N N 140 GKT H19 H N N 141 GKT H20 H N N 142 GKT H21 H N N 143 GKT H22 H N N 144 GKT H23 H N N 145 GKT H24 H N N 146 GKT H25 H N N 147 GLN N N N N 148 GLN CA C N S 149 GLN C C N N 150 GLN O O N N 151 GLN CB C N N 152 GLN CG C N N 153 GLN CD C N N 154 GLN OE1 O N N 155 GLN NE2 N N N 156 GLN OXT O N N 157 GLN H H N N 158 GLN H2 H N N 159 GLN HA H N N 160 GLN HB2 H N N 161 GLN HB3 H N N 162 GLN HG2 H N N 163 GLN HG3 H N N 164 GLN HE21 H N N 165 GLN HE22 H N N 166 GLN HXT H N N 167 GLU N N N N 168 GLU CA C N S 169 GLU C C N N 170 GLU O O N N 171 GLU CB C N N 172 GLU CG C N N 173 GLU CD C N N 174 GLU OE1 O N N 175 GLU OE2 O N N 176 GLU OXT O N N 177 GLU H H N N 178 GLU H2 H N N 179 GLU HA H N N 180 GLU HB2 H N N 181 GLU HB3 H N N 182 GLU HG2 H N N 183 GLU HG3 H N N 184 GLU HE2 H N N 185 GLU HXT H N N 186 GLY N N N N 187 GLY CA C N N 188 GLY C C N N 189 GLY O O N N 190 GLY OXT O N N 191 GLY H H N N 192 GLY H2 H N N 193 GLY HA2 H N N 194 GLY HA3 H N N 195 GLY HXT H N N 196 HIS N N N N 197 HIS CA C N S 198 HIS C C N N 199 HIS O O N N 200 HIS CB C N N 201 HIS CG C Y N 202 HIS ND1 N Y N 203 HIS CD2 C Y N 204 HIS CE1 C Y N 205 HIS NE2 N Y N 206 HIS OXT O N N 207 HIS H H N N 208 HIS H2 H N N 209 HIS HA H N N 210 HIS HB2 H N N 211 HIS HB3 H N N 212 HIS HD1 H N N 213 HIS HD2 H N N 214 HIS HE1 H N N 215 HIS HE2 H N N 216 HIS HXT H N N 217 HOH O O N N 218 HOH H1 H N N 219 HOH H2 H N N 220 ILE N N N N 221 ILE CA C N S 222 ILE C C N N 223 ILE O O N N 224 ILE CB C N S 225 ILE CG1 C N N 226 ILE CG2 C N N 227 ILE CD1 C N N 228 ILE OXT O N N 229 ILE H H N N 230 ILE H2 H N N 231 ILE HA H N N 232 ILE HB H N N 233 ILE HG12 H N N 234 ILE HG13 H N N 235 ILE HG21 H N N 236 ILE HG22 H N N 237 ILE HG23 H N N 238 ILE HD11 H N N 239 ILE HD12 H N N 240 ILE HD13 H N N 241 ILE HXT H N N 242 LEU N N N N 243 LEU CA C N S 244 LEU C C N N 245 LEU O O N N 246 LEU CB C N N 247 LEU CG C N N 248 LEU CD1 C N N 249 LEU CD2 C N N 250 LEU OXT O N N 251 LEU H H N N 252 LEU H2 H N N 253 LEU HA H N N 254 LEU HB2 H N N 255 LEU HB3 H N N 256 LEU HG H N N 257 LEU HD11 H N N 258 LEU HD12 H N N 259 LEU HD13 H N N 260 LEU HD21 H N N 261 LEU HD22 H N N 262 LEU HD23 H N N 263 LEU HXT H N N 264 LYS N N N N 265 LYS CA C N S 266 LYS C C N N 267 LYS O O N N 268 LYS CB C N N 269 LYS CG C N N 270 LYS CD C N N 271 LYS CE C N N 272 LYS NZ N N N 273 LYS OXT O N N 274 LYS H H N N 275 LYS H2 H N N 276 LYS HA H N N 277 LYS HB2 H N N 278 LYS HB3 H N N 279 LYS HG2 H N N 280 LYS HG3 H N N 281 LYS HD2 H N N 282 LYS HD3 H N N 283 LYS HE2 H N N 284 LYS HE3 H N N 285 LYS HZ1 H N N 286 LYS HZ2 H N N 287 LYS HZ3 H N N 288 LYS HXT H N N 289 MET N N N N 290 MET CA C N S 291 MET C C N N 292 MET O O N N 293 MET CB C N N 294 MET CG C N N 295 MET SD S N N 296 MET CE C N N 297 MET OXT O N N 298 MET H H N N 299 MET H2 H N N 300 MET HA H N N 301 MET HB2 H N N 302 MET HB3 H N N 303 MET HG2 H N N 304 MET HG3 H N N 305 MET HE1 H N N 306 MET HE2 H N N 307 MET HE3 H N N 308 MET HXT H N N 309 PHE N N N N 310 PHE CA C N S 311 PHE C C N N 312 PHE O O N N 313 PHE CB C N N 314 PHE CG C Y N 315 PHE CD1 C Y N 316 PHE CD2 C Y N 317 PHE CE1 C Y N 318 PHE CE2 C Y N 319 PHE CZ C Y N 320 PHE OXT O N N 321 PHE H H N N 322 PHE H2 H N N 323 PHE HA H N N 324 PHE HB2 H N N 325 PHE HB3 H N N 326 PHE HD1 H N N 327 PHE HD2 H N N 328 PHE HE1 H N N 329 PHE HE2 H N N 330 PHE HZ H N N 331 PHE HXT H N N 332 PRO N N N N 333 PRO CA C N S 334 PRO C C N N 335 PRO O O N N 336 PRO CB C N N 337 PRO CG C N N 338 PRO CD C N N 339 PRO OXT O N N 340 PRO H H N N 341 PRO HA H N N 342 PRO HB2 H N N 343 PRO HB3 H N N 344 PRO HG2 H N N 345 PRO HG3 H N N 346 PRO HD2 H N N 347 PRO HD3 H N N 348 PRO HXT H N N 349 SER N N N N 350 SER CA C N S 351 SER C C N N 352 SER O O N N 353 SER CB C N N 354 SER OG O N N 355 SER OXT O N N 356 SER H H N N 357 SER H2 H N N 358 SER HA H N N 359 SER HB2 H N N 360 SER HB3 H N N 361 SER HG H N N 362 SER HXT H N N 363 THR N N N N 364 THR CA C N S 365 THR C C N N 366 THR O O N N 367 THR CB C N R 368 THR OG1 O N N 369 THR CG2 C N N 370 THR OXT O N N 371 THR H H N N 372 THR H2 H N N 373 THR HA H N N 374 THR HB H N N 375 THR HG1 H N N 376 THR HG21 H N N 377 THR HG22 H N N 378 THR HG23 H N N 379 THR HXT H N N 380 TRP N N N N 381 TRP CA C N S 382 TRP C C N N 383 TRP O O N N 384 TRP CB C N N 385 TRP CG C Y N 386 TRP CD1 C Y N 387 TRP CD2 C Y N 388 TRP NE1 N Y N 389 TRP CE2 C Y N 390 TRP CE3 C Y N 391 TRP CZ2 C Y N 392 TRP CZ3 C Y N 393 TRP CH2 C Y N 394 TRP OXT O N N 395 TRP H H N N 396 TRP H2 H N N 397 TRP HA H N N 398 TRP HB2 H N N 399 TRP HB3 H N N 400 TRP HD1 H N N 401 TRP HE1 H N N 402 TRP HE3 H N N 403 TRP HZ2 H N N 404 TRP HZ3 H N N 405 TRP HH2 H N N 406 TRP HXT H N N 407 TYR N N N N 408 TYR CA C N S 409 TYR C C N N 410 TYR O O N N 411 TYR CB C N N 412 TYR CG C Y N 413 TYR CD1 C Y N 414 TYR CD2 C Y N 415 TYR CE1 C Y N 416 TYR CE2 C Y N 417 TYR CZ C Y N 418 TYR OH O N N 419 TYR OXT O N N 420 TYR H H N N 421 TYR H2 H N N 422 TYR HA H N N 423 TYR HB2 H N N 424 TYR HB3 H N N 425 TYR HD1 H N N 426 TYR HD2 H N N 427 TYR HE1 H N N 428 TYR HE2 H N N 429 TYR HH H N N 430 TYR HXT H N N 431 VAL N N N N 432 VAL CA C N S 433 VAL C C N N 434 VAL O O N N 435 VAL CB C N N 436 VAL CG1 C N N 437 VAL CG2 C N N 438 VAL OXT O N N 439 VAL H H N N 440 VAL H2 H N N 441 VAL HA H N N 442 VAL HB H N N 443 VAL HG11 H N N 444 VAL HG12 H N N 445 VAL HG13 H N N 446 VAL HG21 H N N 447 VAL HG22 H N N 448 VAL HG23 H N N 449 VAL HXT H N N 450 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GKT C C1 sing N N 92 GKT C2 C1 doub Y N 93 GKT C2 C3 sing Y N 94 GKT C1 C6 sing Y N 95 GKT C3 C4 doub Y N 96 GKT C6 I sing N N 97 GKT C6 C5 doub Y N 98 GKT O C7 doub N N 99 GKT C4 C5 sing Y N 100 GKT C4 C7 sing N N 101 GKT C7 N sing N N 102 GKT N C8 sing N N 103 GKT C20 C8 doub Y N 104 GKT C20 C19 sing Y N 105 GKT C8 C9 sing Y N 106 GKT N3 C19 sing Y N 107 GKT N3 C12 sing Y N 108 GKT C19 C11 doub Y N 109 GKT C9 C10 doub Y N 110 GKT C12 C13 sing N N 111 GKT C12 N1 doub Y N 112 GKT C11 C10 sing Y N 113 GKT C11 N1 sing Y N 114 GKT C13 N2 sing N N 115 GKT N2 C18 sing N N 116 GKT N2 C14 sing N N 117 GKT C18 C17 sing N N 118 GKT C17 C16 sing N N 119 GKT C14 C15 sing N N 120 GKT C16 C15 sing N N 121 GKT C2 H1 sing N N 122 GKT C3 H2 sing N N 123 GKT C5 H3 sing N N 124 GKT C H4 sing N N 125 GKT C H5 sing N N 126 GKT C H6 sing N N 127 GKT N H7 sing N N 128 GKT C20 H8 sing N N 129 GKT C10 H9 sing N N 130 GKT C9 H10 sing N N 131 GKT N3 H11 sing N N 132 GKT C13 H13 sing N N 133 GKT C13 H14 sing N N 134 GKT C18 H16 sing N N 135 GKT C18 H17 sing N N 136 GKT C17 H18 sing N N 137 GKT C17 H19 sing N N 138 GKT C16 H20 sing N N 139 GKT C16 H21 sing N N 140 GKT C15 H22 sing N N 141 GKT C15 H23 sing N N 142 GKT C14 H24 sing N N 143 GKT C14 H25 sing N N 144 GLN N CA sing N N 145 GLN N H sing N N 146 GLN N H2 sing N N 147 GLN CA C sing N N 148 GLN CA CB sing N N 149 GLN CA HA sing N N 150 GLN C O doub N N 151 GLN C OXT sing N N 152 GLN CB CG sing N N 153 GLN CB HB2 sing N N 154 GLN CB HB3 sing N N 155 GLN CG CD sing N N 156 GLN CG HG2 sing N N 157 GLN CG HG3 sing N N 158 GLN CD OE1 doub N N 159 GLN CD NE2 sing N N 160 GLN NE2 HE21 sing N N 161 GLN NE2 HE22 sing N N 162 GLN OXT HXT sing N N 163 GLU N CA sing N N 164 GLU N H sing N N 165 GLU N H2 sing N N 166 GLU CA C sing N N 167 GLU CA CB sing N N 168 GLU CA HA sing N N 169 GLU C O doub N N 170 GLU C OXT sing N N 171 GLU CB CG sing N N 172 GLU CB HB2 sing N N 173 GLU CB HB3 sing N N 174 GLU CG CD sing N N 175 GLU CG HG2 sing N N 176 GLU CG HG3 sing N N 177 GLU CD OE1 doub N N 178 GLU CD OE2 sing N N 179 GLU OE2 HE2 sing N N 180 GLU OXT HXT sing N N 181 GLY N CA sing N N 182 GLY N H sing N N 183 GLY N H2 sing N N 184 GLY CA C sing N N 185 GLY CA HA2 sing N N 186 GLY CA HA3 sing N N 187 GLY C O doub N N 188 GLY C OXT sing N N 189 GLY OXT HXT sing N N 190 HIS N CA sing N N 191 HIS N H sing N N 192 HIS N H2 sing N N 193 HIS CA C sing N N 194 HIS CA CB sing N N 195 HIS CA HA sing N N 196 HIS C O doub N N 197 HIS C OXT sing N N 198 HIS CB CG sing N N 199 HIS CB HB2 sing N N 200 HIS CB HB3 sing N N 201 HIS CG ND1 sing Y N 202 HIS CG CD2 doub Y N 203 HIS ND1 CE1 doub Y N 204 HIS ND1 HD1 sing N N 205 HIS CD2 NE2 sing Y N 206 HIS CD2 HD2 sing N N 207 HIS CE1 NE2 sing Y N 208 HIS CE1 HE1 sing N N 209 HIS NE2 HE2 sing N N 210 HIS OXT HXT sing N N 211 HOH O H1 sing N N 212 HOH O H2 sing N N 213 ILE N CA sing N N 214 ILE N H sing N N 215 ILE N H2 sing N N 216 ILE CA C sing N N 217 ILE CA CB sing N N 218 ILE CA HA sing N N 219 ILE C O doub N N 220 ILE C OXT sing N N 221 ILE CB CG1 sing N N 222 ILE CB CG2 sing N N 223 ILE CB HB sing N N 224 ILE CG1 CD1 sing N N 225 ILE CG1 HG12 sing N N 226 ILE CG1 HG13 sing N N 227 ILE CG2 HG21 sing N N 228 ILE CG2 HG22 sing N N 229 ILE CG2 HG23 sing N N 230 ILE CD1 HD11 sing N N 231 ILE CD1 HD12 sing N N 232 ILE CD1 HD13 sing N N 233 ILE OXT HXT sing N N 234 LEU N CA sing N N 235 LEU N H sing N N 236 LEU N H2 sing N N 237 LEU CA C sing N N 238 LEU CA CB sing N N 239 LEU CA HA sing N N 240 LEU C O doub N N 241 LEU C OXT sing N N 242 LEU CB CG sing N N 243 LEU CB HB2 sing N N 244 LEU CB HB3 sing N N 245 LEU CG CD1 sing N N 246 LEU CG CD2 sing N N 247 LEU CG HG sing N N 248 LEU CD1 HD11 sing N N 249 LEU CD1 HD12 sing N N 250 LEU CD1 HD13 sing N N 251 LEU CD2 HD21 sing N N 252 LEU CD2 HD22 sing N N 253 LEU CD2 HD23 sing N N 254 LEU OXT HXT sing N N 255 LYS N CA sing N N 256 LYS N H sing N N 257 LYS N H2 sing N N 258 LYS CA C sing N N 259 LYS CA CB sing N N 260 LYS CA HA sing N N 261 LYS C O doub N N 262 LYS C OXT sing N N 263 LYS CB CG sing N N 264 LYS CB HB2 sing N N 265 LYS CB HB3 sing N N 266 LYS CG CD sing N N 267 LYS CG HG2 sing N N 268 LYS CG HG3 sing N N 269 LYS CD CE sing N N 270 LYS CD HD2 sing N N 271 LYS CD HD3 sing N N 272 LYS CE NZ sing N N 273 LYS CE HE2 sing N N 274 LYS CE HE3 sing N N 275 LYS NZ HZ1 sing N N 276 LYS NZ HZ2 sing N N 277 LYS NZ HZ3 sing N N 278 LYS OXT HXT sing N N 279 MET N CA sing N N 280 MET N H sing N N 281 MET N H2 sing N N 282 MET CA C sing N N 283 MET CA CB sing N N 284 MET CA HA sing N N 285 MET C O doub N N 286 MET C OXT sing N N 287 MET CB CG sing N N 288 MET CB HB2 sing N N 289 MET CB HB3 sing N N 290 MET CG SD sing N N 291 MET CG HG2 sing N N 292 MET CG HG3 sing N N 293 MET SD CE sing N N 294 MET CE HE1 sing N N 295 MET CE HE2 sing N N 296 MET CE HE3 sing N N 297 MET OXT HXT sing N N 298 PHE N CA sing N N 299 PHE N H sing N N 300 PHE N H2 sing N N 301 PHE CA C sing N N 302 PHE CA CB sing N N 303 PHE CA HA sing N N 304 PHE C O doub N N 305 PHE C OXT sing N N 306 PHE CB CG sing N N 307 PHE CB HB2 sing N N 308 PHE CB HB3 sing N N 309 PHE CG CD1 doub Y N 310 PHE CG CD2 sing Y N 311 PHE CD1 CE1 sing Y N 312 PHE CD1 HD1 sing N N 313 PHE CD2 CE2 doub Y N 314 PHE CD2 HD2 sing N N 315 PHE CE1 CZ doub Y N 316 PHE CE1 HE1 sing N N 317 PHE CE2 CZ sing Y N 318 PHE CE2 HE2 sing N N 319 PHE CZ HZ sing N N 320 PHE OXT HXT sing N N 321 PRO N CA sing N N 322 PRO N CD sing N N 323 PRO N H sing N N 324 PRO CA C sing N N 325 PRO CA CB sing N N 326 PRO CA HA sing N N 327 PRO C O doub N N 328 PRO C OXT sing N N 329 PRO CB CG sing N N 330 PRO CB HB2 sing N N 331 PRO CB HB3 sing N N 332 PRO CG CD sing N N 333 PRO CG HG2 sing N N 334 PRO CG HG3 sing N N 335 PRO CD HD2 sing N N 336 PRO CD HD3 sing N N 337 PRO OXT HXT sing N N 338 SER N CA sing N N 339 SER N H sing N N 340 SER N H2 sing N N 341 SER CA C sing N N 342 SER CA CB sing N N 343 SER CA HA sing N N 344 SER C O doub N N 345 SER C OXT sing N N 346 SER CB OG sing N N 347 SER CB HB2 sing N N 348 SER CB HB3 sing N N 349 SER OG HG sing N N 350 SER OXT HXT sing N N 351 THR N CA sing N N 352 THR N H sing N N 353 THR N H2 sing N N 354 THR CA C sing N N 355 THR CA CB sing N N 356 THR CA HA sing N N 357 THR C O doub N N 358 THR C OXT sing N N 359 THR CB OG1 sing N N 360 THR CB CG2 sing N N 361 THR CB HB sing N N 362 THR OG1 HG1 sing N N 363 THR CG2 HG21 sing N N 364 THR CG2 HG22 sing N N 365 THR CG2 HG23 sing N N 366 THR OXT HXT sing N N 367 TRP N CA sing N N 368 TRP N H sing N N 369 TRP N H2 sing N N 370 TRP CA C sing N N 371 TRP CA CB sing N N 372 TRP CA HA sing N N 373 TRP C O doub N N 374 TRP C OXT sing N N 375 TRP CB CG sing N N 376 TRP CB HB2 sing N N 377 TRP CB HB3 sing N N 378 TRP CG CD1 doub Y N 379 TRP CG CD2 sing Y N 380 TRP CD1 NE1 sing Y N 381 TRP CD1 HD1 sing N N 382 TRP CD2 CE2 doub Y N 383 TRP CD2 CE3 sing Y N 384 TRP NE1 CE2 sing Y N 385 TRP NE1 HE1 sing N N 386 TRP CE2 CZ2 sing Y N 387 TRP CE3 CZ3 doub Y N 388 TRP CE3 HE3 sing N N 389 TRP CZ2 CH2 doub Y N 390 TRP CZ2 HZ2 sing N N 391 TRP CZ3 CH2 sing Y N 392 TRP CZ3 HZ3 sing N N 393 TRP CH2 HH2 sing N N 394 TRP OXT HXT sing N N 395 TYR N CA sing N N 396 TYR N H sing N N 397 TYR N H2 sing N N 398 TYR CA C sing N N 399 TYR CA CB sing N N 400 TYR CA HA sing N N 401 TYR C O doub N N 402 TYR C OXT sing N N 403 TYR CB CG sing N N 404 TYR CB HB2 sing N N 405 TYR CB HB3 sing N N 406 TYR CG CD1 doub Y N 407 TYR CG CD2 sing Y N 408 TYR CD1 CE1 sing Y N 409 TYR CD1 HD1 sing N N 410 TYR CD2 CE2 doub Y N 411 TYR CD2 HD2 sing N N 412 TYR CE1 CZ doub Y N 413 TYR CE1 HE1 sing N N 414 TYR CE2 CZ sing Y N 415 TYR CE2 HE2 sing N N 416 TYR CZ OH sing N N 417 TYR OH HH sing N N 418 TYR OXT HXT sing N N 419 VAL N CA sing N N 420 VAL N H sing N N 421 VAL N H2 sing N N 422 VAL CA C sing N N 423 VAL CA CB sing N N 424 VAL CA HA sing N N 425 VAL C O doub N N 426 VAL C OXT sing N N 427 VAL CB CG1 sing N N 428 VAL CB CG2 sing N N 429 VAL CB HB sing N N 430 VAL CG1 HG11 sing N N 431 VAL CG1 HG12 sing N N 432 VAL CG1 HG13 sing N N 433 VAL CG2 HG21 sing N N 434 VAL CG2 HG22 sing N N 435 VAL CG2 HG23 sing N N 436 VAL OXT HXT sing N N 437 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id GKT _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id GKT _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6T1J _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7B0T _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020517 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020517 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007576 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C I N O S # loop_