data_7B2F # _entry.id 7B2F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7B2F pdb_00007b2f 10.2210/pdb7b2f/pdb WWPDB D_1292112526 ? ? BMRB 34576 ? 10.13018/BMR34576 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-06-09 2 'Structure model' 1 1 2021-06-16 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' 7 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 8 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7B2F _pdbx_database_status.recvd_initial_deposition_date 2020-11-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of the Pax NRPS docking domain PaxB NDD' _pdbx_database_related.db_id 34576 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Watzel, J.' 1 0000-0001-6843-855X 'Sarawi, S.' 2 ? 'Duchardt-Ferner, E.' 3 ? 'Bode, H.B.' 4 ? 'Woehnert, J.' 5 0000-0001-7193-401X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Angew.Chem.Int.Ed.Engl. _citation.journal_id_ASTM ACIEAY _citation.journal_id_CSD 0179 _citation.journal_id_ISSN 1521-3773 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 60 _citation.language ? _citation.page_first 14171 _citation.page_last 14178 _citation.title 'Cooperation between a T Domain and a Minimal C-Terminal Docking Domain to Enable Specific Assembly in a Multiprotein NRPS.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/anie.202103498 _citation.pdbx_database_id_PubMed 33876501 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Watzel, J.' 1 ? primary 'Duchardt-Ferner, E.' 2 ? primary 'Sarawi, S.' 3 ? primary 'Bode, H.B.' 4 ? primary 'Wohnert, J.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Peptide synthetase XpsB (Modular protein)' _entity.formula_weight 3616.222 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.7.58,5.1.1.12 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MNNNELTSLPLAERKRLLELAKAAKLSRQHY _entity_poly.pdbx_seq_one_letter_code_can MNNNELTSLPLAERKRLLELAKAAKLSRQHY _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 ASN n 1 4 ASN n 1 5 GLU n 1 6 LEU n 1 7 THR n 1 8 SER n 1 9 LEU n 1 10 PRO n 1 11 LEU n 1 12 ALA n 1 13 GLU n 1 14 ARG n 1 15 LYS n 1 16 ARG n 1 17 LEU n 1 18 LEU n 1 19 GLU n 1 20 LEU n 1 21 ALA n 1 22 LYS n 1 23 ALA n 1 24 ALA n 1 25 LYS n 1 26 LEU n 1 27 SER n 1 28 ARG n 1 29 GLN n 1 30 HIS n 1 31 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 31 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene XCR1_1150011 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Xenorhabdus cabanillasii JM26' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1427517 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-11a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 TYR 31 31 31 TYR TYR A . n # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7B2F _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7B2F _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7B2F _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _database_PDB_matrix.entry_id 7B2F _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 7B2F _struct.title 'Solution structure of the Pax NRPS docking domain PaxB NDD' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7B2F _struct_keywords.text 'PROTEIN, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7B2F _struct_ref.pdbx_db_accession 7B2F _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7B2F _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7B2F _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 31 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 31 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 3760 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 4 ? LEU A 9 ? ASN A 4 LEU A 9 5 ? 6 HELX_P HELX_P2 AA2 PRO A 10 ? ALA A 24 ? PRO A 10 ALA A 24 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 16 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 16 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 16 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 117.24 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.06 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 24 ? ? -69.14 84.95 2 2 ASN A 4 ? ? -147.27 57.23 3 4 GLN A 29 ? ? -155.58 -62.43 4 5 LYS A 25 ? ? -152.28 -39.98 5 6 ASN A 2 ? ? -153.76 16.51 6 8 GLU A 5 ? ? -67.78 22.22 7 8 LYS A 25 ? ? -135.18 -32.11 8 8 ARG A 28 ? ? -78.68 32.32 9 9 LYS A 25 ? ? -139.06 -47.04 10 10 ASN A 3 ? ? 68.68 -12.72 11 10 GLU A 5 ? ? -151.01 20.78 12 11 ASN A 4 ? ? -160.71 115.71 13 12 LYS A 25 ? ? 38.83 59.26 14 12 ARG A 28 ? ? -144.96 -48.34 15 13 ASN A 2 ? ? -37.13 -39.68 16 13 LYS A 25 ? ? -149.83 -14.71 17 15 LYS A 25 ? ? -148.07 44.76 18 16 GLU A 5 ? ? -112.37 60.10 19 16 LYS A 25 ? ? 55.63 4.73 20 17 ASN A 4 ? ? -110.34 57.02 21 17 GLU A 5 ? ? -134.44 -43.48 22 17 LYS A 25 ? ? -46.79 -74.61 23 17 SER A 27 ? ? -68.57 -175.28 24 18 ARG A 28 ? ? -90.79 -84.44 25 19 ALA A 24 ? ? 52.12 14.17 26 19 LYS A 25 ? ? -69.88 -72.81 27 20 ALA A 24 ? ? 54.73 6.04 28 20 GLN A 29 ? ? -77.03 -168.20 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 6 ARG A 16 ? ? 0.087 'SIDE CHAIN' 2 7 TYR A 31 ? ? 0.069 'SIDE CHAIN' 3 11 ARG A 28 ? ? 0.091 'SIDE CHAIN' 4 14 ARG A 16 ? ? 0.076 'SIDE CHAIN' 5 16 ARG A 28 ? ? 0.088 'SIDE CHAIN' 6 20 ARG A 28 ? ? 0.086 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 7B2F _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7B2F _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '300 uM [U-15N] PaxB NDD, 50 mM sodium phosphate, 100 mM sodium chloride, 5 % [U-2H] D2O, 100 uM DSS, 95% H2O/5% D2O' '95% H2O/5% D2O' 15N_sample solution ? 2 '300 uM [U-15N] PaxB NDD, 50 mM sodium phosphate, 100 mM sodium chloride, 5 % [U-2H] D2O, 100 uM DSS, 95% H2O/5% D2O' '95% H2O/5% D2O' 15N,13C_sample solution ? 3 '300 uM [U-10% 13C; U-15N] PaxB NDD, 50 mM sodium phosphate, 100 mM sodium chloride, 5 % [U-2H] D2O, 100 uM DSS, 95% H2O/5% D2O' '95% H2O/5% D2O' 15N,13C_stereo_sample solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'PaxB NDD' 300 ? uM '[U-15N]' 1 'sodium phosphate' 50 ? mM 'natural abundance' 1 'sodium chloride' 100 ? mM 'natural abundance' 1 D2O 5 ? % '[U-2H]' 1 DSS 100 ? uM 'natural abundance' 2 'PaxB NDD' 300 ? uM '[U-15N]' 2 'sodium phosphate' 50 ? mM 'natural abundance' 2 'sodium chloride' 100 ? mM 'natural abundance' 2 D2O 5 ? % '[U-2H]' 2 DSS 100 ? uM 'natural abundance' 3 'PaxB NDD' 300 ? uM '[U-10% 13C; U-15N]' 3 'sodium phosphate' 50 ? mM 'natural abundance' 3 'sodium chloride' 100 ? mM 'natural abundance' 3 D2O 5 ? % '[U-2H]' 3 DSS 100 ? uM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units bar _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 2 '2D 1H-15N HSQC' 1 isotropic 2 1 2 '3D HNCO' 1 isotropic 7 1 2 '3D HNCACB' 3 isotropic 6 1 2 '3D HBHA(CO)NH' 1 isotropic 15 1 2 '3D C(CO)NH' 2 isotropic 14 1 2 '3D H(CCO)NH' 2 isotropic 3 1 1 '3D 1H-15N NOESY' 2 isotropic 8 1 2 '2D 1H-13C HSQC aliphatic' 2 isotropic 4 1 2 '3D 1H-13C NOESY aliphatic' 2 isotropic 5 1 3 '2D 1H-13C HSQC aliphatic' 1 isotropic # loop_ _pdbx_nmr_refine.entry_id _pdbx_nmr_refine.method _pdbx_nmr_refine.details _pdbx_nmr_refine.software_ordinal 7B2F 'torsion angle dynamics' ? 4 7B2F 'molecular dynamics' ? 5 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'data analysis' TopSpin 3.6.2 'Bruker Biospin' 2 'chemical shift assignment' CARA 1.8.4.2 'Keller and Wuthrich' 3 'peak picking' 'CcpNmr Analysis' 2.4.2 CCPN 4 'structure calculation' CYANA 3.98 'Guntert, Mumenthaler and Wuthrich' 5 refinement OPALp ? 'Koradi, Billeter and Guntert' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 GLN N N N N 58 GLN CA C N S 59 GLN C C N N 60 GLN O O N N 61 GLN CB C N N 62 GLN CG C N N 63 GLN CD C N N 64 GLN OE1 O N N 65 GLN NE2 N N N 66 GLN OXT O N N 67 GLN H H N N 68 GLN H2 H N N 69 GLN HA H N N 70 GLN HB2 H N N 71 GLN HB3 H N N 72 GLN HG2 H N N 73 GLN HG3 H N N 74 GLN HE21 H N N 75 GLN HE22 H N N 76 GLN HXT H N N 77 GLU N N N N 78 GLU CA C N S 79 GLU C C N N 80 GLU O O N N 81 GLU CB C N N 82 GLU CG C N N 83 GLU CD C N N 84 GLU OE1 O N N 85 GLU OE2 O N N 86 GLU OXT O N N 87 GLU H H N N 88 GLU H2 H N N 89 GLU HA H N N 90 GLU HB2 H N N 91 GLU HB3 H N N 92 GLU HG2 H N N 93 GLU HG3 H N N 94 GLU HE2 H N N 95 GLU HXT H N N 96 HIS N N N N 97 HIS CA C N S 98 HIS C C N N 99 HIS O O N N 100 HIS CB C N N 101 HIS CG C Y N 102 HIS ND1 N Y N 103 HIS CD2 C Y N 104 HIS CE1 C Y N 105 HIS NE2 N Y N 106 HIS OXT O N N 107 HIS H H N N 108 HIS H2 H N N 109 HIS HA H N N 110 HIS HB2 H N N 111 HIS HB3 H N N 112 HIS HD1 H N N 113 HIS HD2 H N N 114 HIS HE1 H N N 115 HIS HE2 H N N 116 HIS HXT H N N 117 LEU N N N N 118 LEU CA C N S 119 LEU C C N N 120 LEU O O N N 121 LEU CB C N N 122 LEU CG C N N 123 LEU CD1 C N N 124 LEU CD2 C N N 125 LEU OXT O N N 126 LEU H H N N 127 LEU H2 H N N 128 LEU HA H N N 129 LEU HB2 H N N 130 LEU HB3 H N N 131 LEU HG H N N 132 LEU HD11 H N N 133 LEU HD12 H N N 134 LEU HD13 H N N 135 LEU HD21 H N N 136 LEU HD22 H N N 137 LEU HD23 H N N 138 LEU HXT H N N 139 LYS N N N N 140 LYS CA C N S 141 LYS C C N N 142 LYS O O N N 143 LYS CB C N N 144 LYS CG C N N 145 LYS CD C N N 146 LYS CE C N N 147 LYS NZ N N N 148 LYS OXT O N N 149 LYS H H N N 150 LYS H2 H N N 151 LYS HA H N N 152 LYS HB2 H N N 153 LYS HB3 H N N 154 LYS HG2 H N N 155 LYS HG3 H N N 156 LYS HD2 H N N 157 LYS HD3 H N N 158 LYS HE2 H N N 159 LYS HE3 H N N 160 LYS HZ1 H N N 161 LYS HZ2 H N N 162 LYS HZ3 H N N 163 LYS HXT H N N 164 MET N N N N 165 MET CA C N S 166 MET C C N N 167 MET O O N N 168 MET CB C N N 169 MET CG C N N 170 MET SD S N N 171 MET CE C N N 172 MET OXT O N N 173 MET H H N N 174 MET H2 H N N 175 MET HA H N N 176 MET HB2 H N N 177 MET HB3 H N N 178 MET HG2 H N N 179 MET HG3 H N N 180 MET HE1 H N N 181 MET HE2 H N N 182 MET HE3 H N N 183 MET HXT H N N 184 PRO N N N N 185 PRO CA C N S 186 PRO C C N N 187 PRO O O N N 188 PRO CB C N N 189 PRO CG C N N 190 PRO CD C N N 191 PRO OXT O N N 192 PRO H H N N 193 PRO HA H N N 194 PRO HB2 H N N 195 PRO HB3 H N N 196 PRO HG2 H N N 197 PRO HG3 H N N 198 PRO HD2 H N N 199 PRO HD3 H N N 200 PRO HXT H N N 201 SER N N N N 202 SER CA C N S 203 SER C C N N 204 SER O O N N 205 SER CB C N N 206 SER OG O N N 207 SER OXT O N N 208 SER H H N N 209 SER H2 H N N 210 SER HA H N N 211 SER HB2 H N N 212 SER HB3 H N N 213 SER HG H N N 214 SER HXT H N N 215 THR N N N N 216 THR CA C N S 217 THR C C N N 218 THR O O N N 219 THR CB C N R 220 THR OG1 O N N 221 THR CG2 C N N 222 THR OXT O N N 223 THR H H N N 224 THR H2 H N N 225 THR HA H N N 226 THR HB H N N 227 THR HG1 H N N 228 THR HG21 H N N 229 THR HG22 H N N 230 THR HG23 H N N 231 THR HXT H N N 232 TYR N N N N 233 TYR CA C N S 234 TYR C C N N 235 TYR O O N N 236 TYR CB C N N 237 TYR CG C Y N 238 TYR CD1 C Y N 239 TYR CD2 C Y N 240 TYR CE1 C Y N 241 TYR CE2 C Y N 242 TYR CZ C Y N 243 TYR OH O N N 244 TYR OXT O N N 245 TYR H H N N 246 TYR H2 H N N 247 TYR HA H N N 248 TYR HB2 H N N 249 TYR HB3 H N N 250 TYR HD1 H N N 251 TYR HD2 H N N 252 TYR HE1 H N N 253 TYR HE2 H N N 254 TYR HH H N N 255 TYR HXT H N N 256 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 GLN N CA sing N N 55 GLN N H sing N N 56 GLN N H2 sing N N 57 GLN CA C sing N N 58 GLN CA CB sing N N 59 GLN CA HA sing N N 60 GLN C O doub N N 61 GLN C OXT sing N N 62 GLN CB CG sing N N 63 GLN CB HB2 sing N N 64 GLN CB HB3 sing N N 65 GLN CG CD sing N N 66 GLN CG HG2 sing N N 67 GLN CG HG3 sing N N 68 GLN CD OE1 doub N N 69 GLN CD NE2 sing N N 70 GLN NE2 HE21 sing N N 71 GLN NE2 HE22 sing N N 72 GLN OXT HXT sing N N 73 GLU N CA sing N N 74 GLU N H sing N N 75 GLU N H2 sing N N 76 GLU CA C sing N N 77 GLU CA CB sing N N 78 GLU CA HA sing N N 79 GLU C O doub N N 80 GLU C OXT sing N N 81 GLU CB CG sing N N 82 GLU CB HB2 sing N N 83 GLU CB HB3 sing N N 84 GLU CG CD sing N N 85 GLU CG HG2 sing N N 86 GLU CG HG3 sing N N 87 GLU CD OE1 doub N N 88 GLU CD OE2 sing N N 89 GLU OE2 HE2 sing N N 90 GLU OXT HXT sing N N 91 HIS N CA sing N N 92 HIS N H sing N N 93 HIS N H2 sing N N 94 HIS CA C sing N N 95 HIS CA CB sing N N 96 HIS CA HA sing N N 97 HIS C O doub N N 98 HIS C OXT sing N N 99 HIS CB CG sing N N 100 HIS CB HB2 sing N N 101 HIS CB HB3 sing N N 102 HIS CG ND1 sing Y N 103 HIS CG CD2 doub Y N 104 HIS ND1 CE1 doub Y N 105 HIS ND1 HD1 sing N N 106 HIS CD2 NE2 sing Y N 107 HIS CD2 HD2 sing N N 108 HIS CE1 NE2 sing Y N 109 HIS CE1 HE1 sing N N 110 HIS NE2 HE2 sing N N 111 HIS OXT HXT sing N N 112 LEU N CA sing N N 113 LEU N H sing N N 114 LEU N H2 sing N N 115 LEU CA C sing N N 116 LEU CA CB sing N N 117 LEU CA HA sing N N 118 LEU C O doub N N 119 LEU C OXT sing N N 120 LEU CB CG sing N N 121 LEU CB HB2 sing N N 122 LEU CB HB3 sing N N 123 LEU CG CD1 sing N N 124 LEU CG CD2 sing N N 125 LEU CG HG sing N N 126 LEU CD1 HD11 sing N N 127 LEU CD1 HD12 sing N N 128 LEU CD1 HD13 sing N N 129 LEU CD2 HD21 sing N N 130 LEU CD2 HD22 sing N N 131 LEU CD2 HD23 sing N N 132 LEU OXT HXT sing N N 133 LYS N CA sing N N 134 LYS N H sing N N 135 LYS N H2 sing N N 136 LYS CA C sing N N 137 LYS CA CB sing N N 138 LYS CA HA sing N N 139 LYS C O doub N N 140 LYS C OXT sing N N 141 LYS CB CG sing N N 142 LYS CB HB2 sing N N 143 LYS CB HB3 sing N N 144 LYS CG CD sing N N 145 LYS CG HG2 sing N N 146 LYS CG HG3 sing N N 147 LYS CD CE sing N N 148 LYS CD HD2 sing N N 149 LYS CD HD3 sing N N 150 LYS CE NZ sing N N 151 LYS CE HE2 sing N N 152 LYS CE HE3 sing N N 153 LYS NZ HZ1 sing N N 154 LYS NZ HZ2 sing N N 155 LYS NZ HZ3 sing N N 156 LYS OXT HXT sing N N 157 MET N CA sing N N 158 MET N H sing N N 159 MET N H2 sing N N 160 MET CA C sing N N 161 MET CA CB sing N N 162 MET CA HA sing N N 163 MET C O doub N N 164 MET C OXT sing N N 165 MET CB CG sing N N 166 MET CB HB2 sing N N 167 MET CB HB3 sing N N 168 MET CG SD sing N N 169 MET CG HG2 sing N N 170 MET CG HG3 sing N N 171 MET SD CE sing N N 172 MET CE HE1 sing N N 173 MET CE HE2 sing N N 174 MET CE HE3 sing N N 175 MET OXT HXT sing N N 176 PRO N CA sing N N 177 PRO N CD sing N N 178 PRO N H sing N N 179 PRO CA C sing N N 180 PRO CA CB sing N N 181 PRO CA HA sing N N 182 PRO C O doub N N 183 PRO C OXT sing N N 184 PRO CB CG sing N N 185 PRO CB HB2 sing N N 186 PRO CB HB3 sing N N 187 PRO CG CD sing N N 188 PRO CG HG2 sing N N 189 PRO CG HG3 sing N N 190 PRO CD HD2 sing N N 191 PRO CD HD3 sing N N 192 PRO OXT HXT sing N N 193 SER N CA sing N N 194 SER N H sing N N 195 SER N H2 sing N N 196 SER CA C sing N N 197 SER CA CB sing N N 198 SER CA HA sing N N 199 SER C O doub N N 200 SER C OXT sing N N 201 SER CB OG sing N N 202 SER CB HB2 sing N N 203 SER CB HB3 sing N N 204 SER OG HG sing N N 205 SER OXT HXT sing N N 206 THR N CA sing N N 207 THR N H sing N N 208 THR N H2 sing N N 209 THR CA C sing N N 210 THR CA CB sing N N 211 THR CA HA sing N N 212 THR C O doub N N 213 THR C OXT sing N N 214 THR CB OG1 sing N N 215 THR CB CG2 sing N N 216 THR CB HB sing N N 217 THR OG1 HG1 sing N N 218 THR CG2 HG21 sing N N 219 THR CG2 HG22 sing N N 220 THR CG2 HG23 sing N N 221 THR OXT HXT sing N N 222 TYR N CA sing N N 223 TYR N H sing N N 224 TYR N H2 sing N N 225 TYR CA C sing N N 226 TYR CA CB sing N N 227 TYR CA HA sing N N 228 TYR C O doub N N 229 TYR C OXT sing N N 230 TYR CB CG sing N N 231 TYR CB HB2 sing N N 232 TYR CB HB3 sing N N 233 TYR CG CD1 doub Y N 234 TYR CG CD2 sing Y N 235 TYR CD1 CE1 sing Y N 236 TYR CD1 HD1 sing N N 237 TYR CD2 CE2 doub Y N 238 TYR CD2 HD2 sing N N 239 TYR CE1 CZ doub Y N 240 TYR CE1 HE1 sing N N 241 TYR CE2 CZ sing Y N 242 TYR CE2 HE2 sing N N 243 TYR CZ OH sing N N 244 TYR OH HH sing N N 245 TYR OXT HXT sing N N 246 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III HD' ? Bruker 800 ? 2 'AVANCE II' ? Bruker 600 ? 3 'AVANCE III HD' ? Bruker 700 ? # _atom_sites.entry_id 7B2F _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_