data_7B3J # _entry.id 7B3J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.352 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7B3J pdb_00007b3j 10.2210/pdb7b3j/pdb WWPDB D_1292112070 ? ? BMRB 34577 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'Based on this structure' 1ze7 unspecified PDB 'Based on this structure' 2llm unspecified BMRB 'Dynamic complex between all-D-enantiomeric peptide D3 with wild-type amyloid precursor protein 672-726 fragment (amyloid beta 1-55)' 34577 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7B3J _pdbx_database_status.recvd_initial_deposition_date 2020-12-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bocharov, E.V.' 1 0000-0002-3635-1609 'Volynsky, P.E.' 2 0000-0002-0471-4188 'Okhrimenko, I.S.' 3 0000-0002-1053-2778 'Urban, A.S.' 4 0000-0001-6372-758X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 64 _citation.language ? _citation.page_first 16464 _citation.page_last 16479 _citation.title ;All - d - Enantiomeric Peptide D3 Designed for Alzheimer's Disease Treatment Dynamically Interacts with Membrane-Bound Amyloid-beta Precursors. ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.1c00632 _citation.pdbx_database_id_PubMed 34739758 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bocharov, E.V.' 1 ? primary 'Gremer, L.' 2 ? primary 'Urban, A.S.' 3 ? primary 'Okhrimenko, I.S.' 4 ? primary 'Volynsky, P.E.' 5 ? primary 'Nadezhdin, K.D.' 6 ? primary 'Bocharova, O.V.' 7 ? primary 'Kornilov, D.A.' 8 ? primary 'Zagryadskaya, Y.A.' 9 ? primary 'Kamynina, A.V.' 10 ? primary 'Kuzmichev, P.K.' 11 ? primary 'Kutzsche, J.' 12 ? primary 'Bolakhrif, N.' 13 ? primary 'Muller-Schiffmann, A.' 14 ? primary 'Dencher, N.A.' 15 ? primary 'Arseniev, A.S.' 16 ? primary 'Efremov, R.G.' 17 ? primary 'Gordeliy, V.I.' 18 ? primary 'Willbold, D.' 19 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Isoform L-APP677 of Amyloid-beta precursor protein' 5991.052 1 ? ? ? ? 2 polymer syn 'D3 all D-enantimeric peptide' 1606.861 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;APP,ABPP,APPI,Alzheimer disease amyloid protein,Amyloid precursor protein,Amyloid-beta A4 protein,Cerebral vascular amyloid peptide,CVAP,PreA4,Protease nexin-II,PN-II ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK A ? 2 'polypeptide(D)' no yes '(DAR)(DPR)(DAR)(2TL)(DAR)(DLE)(DHI)(2TL)(DHI)(DAR)(DSG)(DAR)' RPRTRLHTHRNR B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 ALA n 1 3 GLU n 1 4 PHE n 1 5 ARG n 1 6 HIS n 1 7 ASP n 1 8 SER n 1 9 GLY n 1 10 TYR n 1 11 GLU n 1 12 VAL n 1 13 HIS n 1 14 HIS n 1 15 GLN n 1 16 LYS n 1 17 LEU n 1 18 VAL n 1 19 PHE n 1 20 PHE n 1 21 ALA n 1 22 GLU n 1 23 ASP n 1 24 VAL n 1 25 GLY n 1 26 SER n 1 27 ASN n 1 28 LYS n 1 29 GLY n 1 30 ALA n 1 31 ILE n 1 32 ILE n 1 33 GLY n 1 34 LEU n 1 35 MET n 1 36 VAL n 1 37 GLY n 1 38 GLY n 1 39 VAL n 1 40 VAL n 1 41 ILE n 1 42 ALA n 1 43 THR n 1 44 VAL n 1 45 ILE n 1 46 VAL n 1 47 ILE n 1 48 THR n 1 49 LEU n 1 50 VAL n 1 51 MET n 1 52 LEU n 1 53 LYS n 1 54 LYS n 1 55 LYS n 2 1 DAR n 2 2 DPR n 2 3 DAR n 2 4 2TL n 2 5 DAR n 2 6 DLE n 2 7 DHI n 2 8 2TL n 2 9 DHI n 2 10 DAR n 2 11 DSG n 2 12 DAR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 55 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'APP, A4, AD1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue 'Cell free expression' _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEMEX1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 12 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP A4_HUMAN P05067 P05067-3 1 DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK 579 2 PDB 7B3J 7B3J ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7B3J A 1 ? 55 ? P05067 579 ? 633 ? 1 55 2 2 7B3J B 1 ? 12 ? 7B3J 101 ? 112 ? 101 112 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 2TL 'D-peptide linking' . D-allothreonine ? 'C4 H9 N O3' 119.119 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 DAR 'D-peptide linking' . D-ARGININE ? 'C6 H15 N4 O2 1' 175.209 DHI 'D-peptide linking' . D-HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 DLE 'D-peptide linking' . D-LEUCINE ? 'C6 H13 N O2' 131.173 DPR 'D-peptide linking' . D-PROLINE ? 'C5 H9 N O2' 115.130 DSG 'D-peptide linking' . D-ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 5 H/15N-HSQC 1 isotropic 10 1 6 H/15N-HSQC 1 isotropic 9 1 6 H/15N-HSQC 1 isotropic 2 1 5 1H/15N-TROSY 2 isotropic 12 1 7 1H/15N-TROSY 2 isotropic 11 1 7 1H/15N-TROSY 2 isotropic 3 1 5 1H/13C/15N-HNCA 1 isotropic 4 1 5 '1H/13C/15N-HN(CO)CA' 1 isotropic 5 1 5 1H/13C/15N-HNCO 1 isotropic 6 1 5 1H/13C-HCCH-TOCSY 2 isotropic 7 1 5 '13C-edited NOESY-HSQC' 1 isotropic 8 1 5 '15N-edited NOESY-HSQC' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.9 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 5 '0.2 mM [U-13C; U-15N] APP672-726, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C_15N micelle ;The APP TM fragments were solubilized in an aqueous suspension of or d38-dodecylphosphocholine micelles under monomeric conditions with the protein/lipid ratio of 1/200. ; 6 '0.2 mM [U-13C; U-15N] APP672-726, 0.2 mM D3cys(MTSL), 90% H2O/10% D2O' '90% H2O/10% D2O' 13C_15N micelle ;The APP TM fragments were solubilized in an aqueous suspension of or d38-dodecylphosphocholine micelles under monomeric conditions with the protein/lipid ratio of 1/200. ; 7 '0.2 mM [U-13C; U-15N] APP672-726, 0.2 mM (MTSL)cysD3, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C_15N micelle ;The APP TM fragments were solubilized in an aqueous suspension of or d38-dodecylphosphocholine micelles under monomeric conditions with the protein/lipid ratio of 1/200. ; # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 'Equipped with Cryoprobe' 2 'AVANCE III' ? Bruker 800 'Equipped with Cryoprobe' # _pdbx_nmr_refine.entry_id 7B3J _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 7 # _pdbx_nmr_ensemble.entry_id 7B3J _pdbx_nmr_ensemble.conformers_calculated_total_number 10 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with acceptable covalent geometry' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7B3J _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 processing qMDD ? 'Kazimierczuk & Orekhov' 3 'chemical shift assignment' CARA ? 'Keller and Wuthrich' 4 'peak picking' CARA ? 'Keller and Wuthrich' 5 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 6 'structure calculation' GROMACS ? 'Abraham et al' 7 refinement GROMACS ? 'Abraham et al' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7B3J _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7B3J _struct.title 'Dynamic complex between all-D-enantiomeric peptide D3 with wild-type amyloid precursor protein 672-726 fragment (amyloid beta 1-55)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7B3J _struct_keywords.text 'D-peptide, amyloid-beta, complex, transmembrane, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 11 ? GLY A 25 ? GLU A 11 GLY A 25 1 ? 15 HELX_P HELX_P2 AA2 LYS A 28 ? LYS A 53 ? LYS A 28 LYS A 53 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B DAR 1 C ? ? ? 1_555 B DPR 2 N ? ? B DAR 101 B DPR 102 1_555 ? ? ? ? ? ? ? 1.380 ? ? covale2 covale both ? B DPR 2 C ? ? ? 1_555 B DAR 3 N ? ? B DPR 102 B DAR 103 1_555 ? ? ? ? ? ? ? 1.387 ? ? covale3 covale both ? B DAR 3 C ? ? ? 1_555 B 2TL 4 N ? ? B DAR 103 B 2TL 104 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale4 covale both ? B 2TL 4 C ? ? ? 1_555 B DAR 5 N ? ? B 2TL 104 B DAR 105 1_555 ? ? ? ? ? ? ? 1.301 ? ? covale5 covale both ? B DAR 5 C ? ? ? 1_555 B DLE 6 N ? ? B DAR 105 B DLE 106 1_555 ? ? ? ? ? ? ? 1.312 ? ? covale6 covale both ? B DLE 6 C ? ? ? 1_555 B DHI 7 N ? ? B DLE 106 B DHI 107 1_555 ? ? ? ? ? ? ? 1.352 ? ? covale7 covale both ? B DHI 7 C ? ? ? 1_555 B 2TL 8 N ? ? B DHI 107 B 2TL 108 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale8 covale both ? B 2TL 8 C ? ? ? 1_555 B DHI 9 N ? ? B 2TL 108 B DHI 109 1_555 ? ? ? ? ? ? ? 1.368 ? ? covale9 covale both ? B DHI 9 C ? ? ? 1_555 B DAR 10 N ? ? B DHI 109 B DAR 110 1_555 ? ? ? ? ? ? ? 1.360 ? ? covale10 covale both ? B DAR 10 C ? ? ? 1_555 B DSG 11 N ? ? B DAR 110 B DSG 111 1_555 ? ? ? ? ? ? ? 1.385 ? ? covale11 covale both ? B DSG 11 C ? ? ? 1_555 B DAR 12 N ? ? B DSG 111 B DAR 112 1_555 ? ? ? ? ? ? ? 1.361 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 DPR 2 B . ? DPR 102 B DAR 3 B ? DAR 103 B 2 1.17 2 VAL 12 A . ? VAL 12 A HIS 13 A ? HIS 13 A 4 7.64 3 DAR 1 B . ? DAR 101 B DPR 2 B ? DPR 102 B 5 13.20 # _atom_sites.entry_id 7B3J _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LYS 55 55 55 LYS LYS A . n B 2 1 DAR 1 101 101 DAR DAR B . n B 2 2 DPR 2 102 102 DPR DPR B . n B 2 3 DAR 3 103 103 DAR DAR B . n B 2 4 2TL 4 104 104 2TL 2TL B . n B 2 5 DAR 5 105 105 DAR DAR B . n B 2 6 DLE 6 106 106 DLE DLE B . n B 2 7 DHI 7 107 107 DHI DHI B . n B 2 8 2TL 8 108 108 2TL 2TL B . n B 2 9 DHI 9 109 109 DHI DHI B . n B 2 10 DAR 10 110 110 DAR DAR B . n B 2 11 DSG 11 111 111 DSG DSG B . n B 2 12 DAR 12 112 112 DAR DAR B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 850 ? 1 MORE -1 ? 1 'SSA (A^2)' 6510 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-01-13 2 'Structure model' 1 1 2021-11-10 3 'Structure model' 1 2 2021-11-17 4 'Structure model' 2 0 2021-12-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Atomic model' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' database_2 3 2 'Structure model' pdbx_database_proc 4 3 'Structure model' citation 5 3 'Structure model' citation_author 6 3 'Structure model' pdbx_database_proc 7 4 'Structure model' atom_site 8 4 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.year' 8 2 'Structure model' '_database_2.pdbx_DOI' 9 2 'Structure model' '_database_2.pdbx_database_accession' 10 3 'Structure model' '_citation.pdbx_database_id_PubMed' 11 3 'Structure model' '_citation.title' 12 4 'Structure model' '_atom_site.Cartn_x' 13 4 'Structure model' '_atom_site.Cartn_y' 14 4 'Structure model' '_atom_site.Cartn_z' 15 4 'Structure model' '_atom_site.auth_atom_id' 16 4 'Structure model' '_atom_site.label_atom_id' 17 4 'Structure model' '_citation.journal_volume' 18 4 'Structure model' '_citation.page_first' 19 4 'Structure model' '_citation.page_last' # _pdbx_entry_details.entry_id 7B3J _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 5 APP672-726 0.2 ? mM '[U-13C; U-15N]' 6 APP672-726 0.2 ? mM '[U-13C; U-15N]' 6 'D3cys(MTSL)' 0.2 ? mM 'natural abundance' 7 APP672-726 0.2 ? mM '[U-13C; U-15N]' 7 '(MTSL)cysD3' 0.2 ? mM 'natural abundance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 7 O A VAL 39 ? ? HG1 A THR 43 ? ? 1.49 2 8 O A VAL 39 ? ? HG1 A THR 43 ? ? 1.55 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CZ A TYR 10 ? ? CE2 A TYR 10 ? ? 1.480 1.381 0.099 0.013 N 2 1 CA A GLY 25 ? ? C A GLY 25 ? ? 1.612 1.514 0.098 0.016 N 3 2 CG B DHI 107 ? ? CD2 B DHI 107 ? ? 1.414 1.354 0.060 0.009 N 4 4 CZ B DAR 101 ? ? NH2 B DAR 101 ? ? 1.242 1.326 -0.084 0.013 N 5 6 CG A GLU 22 ? ? CD A GLU 22 ? ? 1.607 1.515 0.092 0.015 N 6 7 CZ A ARG 5 ? ? NH2 A ARG 5 ? ? 1.237 1.326 -0.089 0.013 N 7 7 CG A HIS 6 ? ? CD2 A HIS 6 ? ? 1.414 1.354 0.060 0.009 N 8 9 CE1 A TYR 10 ? ? CZ A TYR 10 ? ? 1.460 1.381 0.079 0.013 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 1 ? ? CG A ASP 1 ? ? OD2 A ASP 1 ? ? 123.83 118.30 5.53 0.90 N 2 1 CB A TYR 10 ? ? CG A TYR 10 ? ? CD1 A TYR 10 ? ? 117.18 121.00 -3.82 0.60 N 3 1 CG1 A VAL 44 ? ? CB A VAL 44 ? ? CG2 A VAL 44 ? ? 101.10 110.90 -9.80 1.60 N 4 1 CA A VAL 46 ? ? CB A VAL 46 ? ? CG1 A VAL 46 ? ? 120.75 110.90 9.85 1.50 N 5 1 NH1 B DAR 110 ? ? CZ B DAR 110 ? ? NH2 B DAR 110 ? ? 112.64 119.40 -6.76 1.10 N 6 1 NE B DAR 110 ? ? CZ B DAR 110 ? ? NH1 B DAR 110 ? ? 116.23 120.30 -4.07 0.50 N 7 1 NE B DAR 110 ? ? CZ B DAR 110 ? ? NH2 B DAR 110 ? ? 130.56 120.30 10.26 0.50 N 8 1 NE B DAR 112 ? ? CZ B DAR 112 ? ? NH1 B DAR 112 ? ? 123.56 120.30 3.26 0.50 N 9 2 CB A TYR 10 ? ? CG A TYR 10 ? ? CD1 A TYR 10 ? ? 117.30 121.00 -3.70 0.60 N 10 2 CG1 A VAL 12 ? ? CB A VAL 12 ? ? CG2 A VAL 12 ? ? 100.33 110.90 -10.57 1.60 N 11 2 CB A PHE 19 ? ? CG A PHE 19 ? ? CD2 A PHE 19 ? ? 112.10 120.80 -8.70 0.70 N 12 2 CB A PHE 19 ? ? CG A PHE 19 ? ? CD1 A PHE 19 ? ? 127.12 120.80 6.32 0.70 N 13 2 CB A ASP 23 ? ? CG A ASP 23 ? ? OD2 A ASP 23 ? ? 125.90 118.30 7.60 0.90 N 14 2 NE B DAR 103 ? ? CZ B DAR 103 ? ? NH2 B DAR 103 ? ? 126.62 120.30 6.32 0.50 N 15 2 CD B DAR 105 ? ? NE B DAR 105 ? ? CZ B DAR 105 ? ? 132.13 123.60 8.53 1.40 N 16 2 NE B DAR 110 ? ? CZ B DAR 110 ? ? NH1 B DAR 110 ? ? 115.61 120.30 -4.69 0.50 N 17 2 NE B DAR 110 ? ? CZ B DAR 110 ? ? NH2 B DAR 110 ? ? 124.38 120.30 4.08 0.50 N 18 2 OD1 B DSG 111 ? ? CG B DSG 111 ? ? ND2 B DSG 111 ? ? 107.74 121.90 -14.16 2.30 N 19 2 NE B DAR 112 ? ? CZ B DAR 112 ? ? NH1 B DAR 112 ? ? 126.98 120.30 6.68 0.50 N 20 2 NE B DAR 112 ? ? CZ B DAR 112 ? ? NH2 B DAR 112 ? ? 115.32 120.30 -4.98 0.50 N 21 3 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH2 A ARG 5 ? ? 124.40 120.30 4.10 0.50 N 22 3 CB A PHE 20 ? ? CG A PHE 20 ? ? CD2 A PHE 20 ? ? 127.18 120.80 6.38 0.70 N 23 3 CB A PHE 20 ? ? CG A PHE 20 ? ? CD1 A PHE 20 ? ? 115.72 120.80 -5.08 0.70 N 24 3 CB A ALA 21 ? ? CA A ALA 21 ? ? C A ALA 21 ? ? 120.31 110.10 10.21 1.50 N 25 3 CG1 A VAL 39 ? ? CB A VAL 39 ? ? CG2 A VAL 39 ? ? 100.25 110.90 -10.65 1.60 N 26 3 NE B DAR 101 ? ? CZ B DAR 101 ? ? NH1 B DAR 101 ? ? 126.62 120.30 6.32 0.50 N 27 3 CD B DAR 105 ? ? NE B DAR 105 ? ? CZ B DAR 105 ? ? 134.52 123.60 10.92 1.40 N 28 3 NE B DAR 105 ? ? CZ B DAR 105 ? ? NH1 B DAR 105 ? ? 125.24 120.30 4.94 0.50 N 29 3 O B DAR 110 ? ? C B DAR 110 ? ? N B DSG 111 ? ? 112.90 122.70 -9.80 1.60 Y 30 3 NH1 B DAR 112 ? ? CZ B DAR 112 ? ? NH2 B DAR 112 ? ? 112.79 119.40 -6.61 1.10 N 31 3 NE B DAR 112 ? ? CZ B DAR 112 ? ? NH2 B DAR 112 ? ? 124.53 120.30 4.23 0.50 N 32 4 NH1 A ARG 5 ? ? CZ A ARG 5 ? ? NH2 A ARG 5 ? ? 110.00 119.40 -9.40 1.10 N 33 4 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 128.53 120.30 8.23 0.50 N 34 4 O A VAL 12 ? ? C A VAL 12 ? ? N A HIS 13 ? ? 113.08 122.70 -9.62 1.60 Y 35 4 NH1 B DAR 103 ? ? CZ B DAR 103 ? ? NH2 B DAR 103 ? ? 112.18 119.40 -7.22 1.10 N 36 4 NE B DAR 103 ? ? CZ B DAR 103 ? ? NH2 B DAR 103 ? ? 128.13 120.30 7.83 0.50 N 37 4 CD B DAR 105 ? ? NE B DAR 105 ? ? CZ B DAR 105 ? ? 133.81 123.60 10.21 1.40 N 38 4 NE B DAR 105 ? ? CZ B DAR 105 ? ? NH1 B DAR 105 ? ? 117.04 120.30 -3.26 0.50 N 39 4 NE B DAR 110 ? ? CZ B DAR 110 ? ? NH2 B DAR 110 ? ? 123.72 120.30 3.42 0.50 N 40 5 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 117.06 120.30 -3.24 0.50 N 41 5 CB A TYR 10 ? ? CG A TYR 10 ? ? CD1 A TYR 10 ? ? 116.88 121.00 -4.12 0.60 N 42 5 CG1 A VAL 18 ? ? CB A VAL 18 ? ? CG2 A VAL 18 ? ? 101.16 110.90 -9.74 1.60 N 43 5 CA A VAL 18 ? ? CB A VAL 18 ? ? CG1 A VAL 18 ? ? 121.94 110.90 11.04 1.50 N 44 5 CB A PHE 19 ? ? CG A PHE 19 ? ? CD1 A PHE 19 ? ? 126.35 120.80 5.55 0.70 N 45 5 CA A VAL 44 ? ? CB A VAL 44 ? ? CG2 A VAL 44 ? ? 121.41 110.90 10.51 1.50 N 46 5 NE B DAR 103 ? ? CZ B DAR 103 ? ? NH1 B DAR 103 ? ? 115.61 120.30 -4.69 0.50 N 47 5 NE B DAR 103 ? ? CZ B DAR 103 ? ? NH2 B DAR 103 ? ? 124.53 120.30 4.23 0.50 N 48 5 NE B DAR 105 ? ? CZ B DAR 105 ? ? NH2 B DAR 105 ? ? 127.57 120.30 7.27 0.50 N 49 5 NE B DAR 110 ? ? CZ B DAR 110 ? ? NH1 B DAR 110 ? ? 113.57 120.30 -6.73 0.50 N 50 5 NE B DAR 110 ? ? CZ B DAR 110 ? ? NH2 B DAR 110 ? ? 129.44 120.30 9.14 0.50 N 51 5 NE B DAR 112 ? ? CZ B DAR 112 ? ? NH1 B DAR 112 ? ? 126.24 120.30 5.94 0.50 N 52 5 NE B DAR 112 ? ? CZ B DAR 112 ? ? NH2 B DAR 112 ? ? 116.60 120.30 -3.70 0.50 N 53 6 CD A ARG 5 ? ? NE A ARG 5 ? ? CZ A ARG 5 ? ? 132.41 123.60 8.81 1.40 N 54 6 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH2 A ARG 5 ? ? 126.09 120.30 5.79 0.50 N 55 6 CB A TYR 10 ? ? CG A TYR 10 ? ? CD2 A TYR 10 ? ? 124.68 121.00 3.68 0.60 N 56 6 CB A TYR 10 ? ? CG A TYR 10 ? ? CD1 A TYR 10 ? ? 115.05 121.00 -5.95 0.60 N 57 6 CG A TYR 10 ? ? CD1 A TYR 10 ? ? CE1 A TYR 10 ? ? 116.32 121.30 -4.98 0.80 N 58 6 CB A LEU 17 ? ? CG A LEU 17 ? ? CD2 A LEU 17 ? ? 100.79 111.00 -10.21 1.70 N 59 6 NE B DAR 101 ? ? CZ B DAR 101 ? ? NH1 B DAR 101 ? ? 125.45 120.30 5.15 0.50 N 60 6 NE B DAR 103 ? ? CZ B DAR 103 ? ? NH1 B DAR 103 ? ? 115.50 120.30 -4.80 0.50 N 61 6 NE B DAR 103 ? ? CZ B DAR 103 ? ? NH2 B DAR 103 ? ? 125.05 120.30 4.75 0.50 N 62 6 NH1 B DAR 105 ? ? CZ B DAR 105 ? ? NH2 B DAR 105 ? ? 111.40 119.40 -8.00 1.10 N 63 6 NE B DAR 105 ? ? CZ B DAR 105 ? ? NH1 B DAR 105 ? ? 125.03 120.30 4.73 0.50 N 64 6 NE B DAR 105 ? ? CZ B DAR 105 ? ? NH2 B DAR 105 ? ? 123.57 120.30 3.27 0.50 N 65 6 CB B DLE 106 ? ? CG B DLE 106 ? ? CD2 B DLE 106 ? ? 121.70 111.00 10.70 1.70 N 66 6 NE B DAR 110 ? ? CZ B DAR 110 ? ? NH1 B DAR 110 ? ? 125.17 120.30 4.87 0.50 N 67 6 NH1 B DAR 112 ? ? CZ B DAR 112 ? ? NH2 B DAR 112 ? ? 109.80 119.40 -9.60 1.10 N 68 6 NE B DAR 112 ? ? CZ B DAR 112 ? ? NH1 B DAR 112 ? ? 123.41 120.30 3.11 0.50 N 69 6 NE B DAR 112 ? ? CZ B DAR 112 ? ? NH2 B DAR 112 ? ? 126.67 120.30 6.37 0.50 N 70 7 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.96 120.30 4.66 0.50 N 71 7 CB A TYR 10 ? ? CG A TYR 10 ? ? CD2 A TYR 10 ? ? 116.06 121.00 -4.94 0.60 N 72 7 CB A TYR 10 ? ? CG A TYR 10 ? ? CD1 A TYR 10 ? ? 124.99 121.00 3.99 0.60 N 73 7 CB A ASP 23 ? ? CG A ASP 23 ? ? OD1 A ASP 23 ? ? 123.73 118.30 5.43 0.90 N 74 7 CG1 A VAL 24 ? ? CB A VAL 24 ? ? CG2 A VAL 24 ? ? 100.80 110.90 -10.10 1.60 N 75 7 NE B DAR 101 ? ? CZ B DAR 101 ? ? NH1 B DAR 101 ? ? 125.94 120.30 5.64 0.50 N 76 7 NE B DAR 101 ? ? CZ B DAR 101 ? ? NH2 B DAR 101 ? ? 117.23 120.30 -3.07 0.50 N 77 7 CA B DPR 102 ? ? N B DPR 102 ? ? CD B DPR 102 ? ? 102.79 111.70 -8.91 1.40 N 78 7 NE B DAR 103 ? ? CZ B DAR 103 ? ? NH1 B DAR 103 ? ? 124.48 120.30 4.18 0.50 N 79 7 NE B DAR 110 ? ? CZ B DAR 110 ? ? NH1 B DAR 110 ? ? 115.38 120.30 -4.92 0.50 N 80 7 NE B DAR 110 ? ? CZ B DAR 110 ? ? NH2 B DAR 110 ? ? 124.62 120.30 4.32 0.50 N 81 7 NE B DAR 112 ? ? CZ B DAR 112 ? ? NH2 B DAR 112 ? ? 123.33 120.30 3.03 0.50 N 82 8 CB A PHE 4 ? ? CG A PHE 4 ? ? CD2 A PHE 4 ? ? 115.11 120.80 -5.69 0.70 N 83 8 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 126.72 120.30 6.42 0.50 N 84 8 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH2 A ARG 5 ? ? 117.20 120.30 -3.10 0.50 N 85 8 CB A ASP 7 ? ? CG A ASP 7 ? ? OD1 A ASP 7 ? ? 124.38 118.30 6.08 0.90 N 86 8 CA A VAL 12 ? ? CB A VAL 12 ? ? CG1 A VAL 12 ? ? 100.56 110.90 -10.34 1.50 N 87 8 CA A VAL 24 ? ? CB A VAL 24 ? ? CG1 A VAL 24 ? ? 121.55 110.90 10.65 1.50 N 88 8 NE B DAR 101 ? ? CZ B DAR 101 ? ? NH1 B DAR 101 ? ? 126.79 120.30 6.49 0.50 N 89 8 NE B DAR 101 ? ? CZ B DAR 101 ? ? NH2 B DAR 101 ? ? 117.08 120.30 -3.22 0.50 N 90 8 NE B DAR 110 ? ? CZ B DAR 110 ? ? NH1 B DAR 110 ? ? 124.61 120.30 4.31 0.50 N 91 8 NE B DAR 110 ? ? CZ B DAR 110 ? ? NH2 B DAR 110 ? ? 117.09 120.30 -3.21 0.50 N 92 8 NE B DAR 112 ? ? CZ B DAR 112 ? ? NH1 B DAR 112 ? ? 123.39 120.30 3.09 0.50 N 93 9 CB A ASP 1 ? ? CG A ASP 1 ? ? OD1 A ASP 1 ? ? 109.22 118.30 -9.08 0.90 N 94 9 CD A ARG 5 ? ? NE A ARG 5 ? ? CZ A ARG 5 ? ? 132.18 123.60 8.58 1.40 N 95 9 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 125.85 120.30 5.55 0.50 N 96 9 CB A TYR 10 ? ? CG A TYR 10 ? ? CD2 A TYR 10 ? ? 116.18 121.00 -4.82 0.60 N 97 9 CB A TYR 10 ? ? CG A TYR 10 ? ? CD1 A TYR 10 ? ? 124.67 121.00 3.67 0.60 N 98 9 CG1 A VAL 36 ? ? CB A VAL 36 ? ? CG2 A VAL 36 ? ? 99.72 110.90 -11.18 1.60 N 99 9 CA A VAL 36 ? ? CB A VAL 36 ? ? CG2 A VAL 36 ? ? 121.25 110.90 10.35 1.50 N 100 9 NE B DAR 101 ? ? CZ B DAR 101 ? ? NH2 B DAR 101 ? ? 125.89 120.30 5.59 0.50 N 101 9 NE B DAR 103 ? ? CZ B DAR 103 ? ? NH1 B DAR 103 ? ? 124.19 120.30 3.89 0.50 N 102 9 NE B DAR 103 ? ? CZ B DAR 103 ? ? NH2 B DAR 103 ? ? 115.58 120.30 -4.72 0.50 N 103 9 NE B DAR 105 ? ? CZ B DAR 105 ? ? NH2 B DAR 105 ? ? 123.72 120.30 3.42 0.50 N 104 9 NE B DAR 110 ? ? CZ B DAR 110 ? ? NH1 B DAR 110 ? ? 113.70 120.30 -6.60 0.50 N 105 9 NE B DAR 110 ? ? CZ B DAR 110 ? ? NH2 B DAR 110 ? ? 124.63 120.30 4.33 0.50 N 106 9 NE B DAR 112 ? ? CZ B DAR 112 ? ? NH1 B DAR 112 ? ? 124.72 120.30 4.42 0.50 N 107 10 CB A PHE 4 ? ? CG A PHE 4 ? ? CD1 A PHE 4 ? ? 115.24 120.80 -5.56 0.70 N 108 10 OE1 A GLU 11 ? ? CD A GLU 11 ? ? OE2 A GLU 11 ? ? 111.53 123.30 -11.77 1.20 N 109 10 NE B DAR 103 ? ? CZ B DAR 103 ? ? NH1 B DAR 103 ? ? 126.04 120.30 5.74 0.50 N 110 10 NE B DAR 105 ? ? CZ B DAR 105 ? ? NH1 B DAR 105 ? ? 128.66 120.30 8.36 0.50 N 111 10 NE B DAR 105 ? ? CZ B DAR 105 ? ? NH2 B DAR 105 ? ? 116.81 120.30 -3.49 0.50 N 112 10 NH1 B DAR 110 ? ? CZ B DAR 110 ? ? NH2 B DAR 110 ? ? 112.11 119.40 -7.29 1.10 N 113 10 NE B DAR 110 ? ? CZ B DAR 110 ? ? NH2 B DAR 110 ? ? 125.39 120.30 5.09 0.50 N 114 10 CB B DSG 111 ? ? CA B DSG 111 ? ? C B DSG 111 ? ? 122.67 110.40 12.27 2.00 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 4 ? ? 66.71 -22.50 2 1 HIS A 6 ? ? 65.24 -2.92 3 1 TYR A 10 ? ? -132.07 -39.98 4 1 SER A 26 ? ? -79.10 23.32 5 2 SER A 8 ? ? -139.47 -38.46 6 2 SER A 26 ? ? -82.34 31.38 7 2 2TL B 104 ? ? 143.26 -40.27 8 2 DLE B 106 ? ? -64.85 9.37 9 2 DAR B 110 ? ? -54.39 -78.85 10 2 DSG B 111 ? ? 160.78 34.22 11 3 TYR A 10 ? ? -150.19 -32.81 12 3 SER A 26 ? ? -146.66 44.49 13 3 2TL B 104 ? ? 143.50 18.97 14 3 DHI B 109 ? ? 63.89 -2.41 15 4 HIS A 6 ? ? -152.03 65.13 16 4 TYR A 10 ? ? -69.75 1.88 17 4 ASN A 27 ? ? -162.08 -14.65 18 4 DAR B 103 ? ? 68.78 -67.82 19 4 DLE B 106 ? ? -56.91 60.05 20 4 DHI B 109 ? ? 143.28 28.17 21 4 DAR B 110 ? ? 150.93 34.18 22 6 ALA A 2 ? ? -69.86 4.89 23 6 HIS A 6 ? ? 47.80 18.32 24 6 VAL A 12 ? ? -145.64 -33.25 25 6 DAR B 103 ? ? -50.34 112.64 26 7 ARG A 5 ? ? -92.25 42.84 27 7 LYS A 28 ? ? -69.28 4.28 28 8 HIS A 6 ? ? -142.37 -11.67 29 8 TYR A 10 ? ? -110.61 -75.21 30 8 HIS A 13 ? ? 51.78 -13.88 31 8 SER A 26 ? ? 179.09 135.48 32 8 2TL B 108 ? ? 144.18 73.91 33 9 SER A 26 ? ? -145.49 -33.74 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 3 HIS A 6 ? ? -10.03 2 3 LYS A 28 ? ? -11.63 3 4 THR A 43 ? ? -10.86 4 8 HIS A 6 ? ? -11.01 5 9 MET A 35 ? ? -12.22 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 3 TYR A 10 ? ? 0.076 'SIDE CHAIN' 2 4 TYR A 10 ? ? 0.136 'SIDE CHAIN' 3 5 TYR A 10 ? ? 0.095 'SIDE CHAIN' 4 6 TYR A 10 ? ? 0.081 'SIDE CHAIN' 5 6 PHE A 19 ? ? 0.092 'SIDE CHAIN' 6 9 PHE A 4 ? ? 0.062 'SIDE CHAIN' # _pdbx_audit_support.funding_organization 'Russian Science Foundation' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number 20-64-46027 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 DSG ? ? DSG ? ? 'SUBJECT OF INVESTIGATION' ? 2 DPR ? ? DPR ? ? 'SUBJECT OF INVESTIGATION' ? 3 DLE ? ? DLE ? ? 'SUBJECT OF INVESTIGATION' ? 4 DAR ? ? DAR ? ? 'SUBJECT OF INVESTIGATION' ? 5 DHI ? ? DHI ? ? 'SUBJECT OF INVESTIGATION' ? 6 2TL ? ? 2TL ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'NMR relaxation study' ? 2 1 none 'microscale themophoresis' #