data_7B7O # _entry.id 7B7O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7B7O pdb_00007b7o 10.2210/pdb7b7o/pdb WWPDB D_1292111529 ? ? BMRB 34582 ? 10.13018/BMR34582 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-01-13 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7B7O _pdbx_database_status.recvd_initial_deposition_date 2020-12-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of A. thaliana core TatA in DHPC micelles' _pdbx_database_related.db_id 34582 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pettersson, P.' 1 0000-0003-2503-3119 'Ye, W.' 2 0000-0001-8071-0499 'Jakob, M.' 3 ? 'Tannert, F.' 4 ? 'Klosgen, R.B.' 5 0000-0002-0555-0234 'Maler, L.' 6 0000-0002-9464-4311 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'FEBS J' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1742-4658 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 285 _citation.language ? _citation.page_first 1886 _citation.page_last 1906 _citation.title 'Structure and dynamics of plant TatA in micelles and lipid bilayers studied by solution NMR.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/febs.14452 _citation.pdbx_database_id_PubMed 29654717 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pettersson, P.' 1 ? primary 'Ye, W.' 2 ? primary 'Jakob, M.' 3 ? primary 'Tannert, F.' 4 ? primary 'Klosgen, R.B.' 5 ? primary 'Maler, L.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Sec-independent protein translocase protein TATA, chloroplastic' _entity.formula_weight 5535.536 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein THYLAKOID ASSEMBLY 4,Protein TWIN-ARGININE TRANSLOCATION A' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKT _entity_poly.pdbx_seq_one_letter_code_can ALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKT _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 LEU n 1 3 PHE n 1 4 GLY n 1 5 LEU n 1 6 GLY n 1 7 VAL n 1 8 PRO n 1 9 GLU n 1 10 LEU n 1 11 ALA n 1 12 VAL n 1 13 ILE n 1 14 ALA n 1 15 GLY n 1 16 VAL n 1 17 ALA n 1 18 ALA n 1 19 LEU n 1 20 LEU n 1 21 PHE n 1 22 GLY n 1 23 PRO n 1 24 LYS n 1 25 LYS n 1 26 LEU n 1 27 PRO n 1 28 GLU n 1 29 ILE n 1 30 GLY n 1 31 LYS n 1 32 SER n 1 33 ILE n 1 34 GLY n 1 35 LYS n 1 36 THR n 1 37 VAL n 1 38 LYS n 1 39 SER n 1 40 PHE n 1 41 GLN n 1 42 GLN n 1 43 ALA n 1 44 ALA n 1 45 LYS n 1 46 GLU n 1 47 PHE n 1 48 GLU n 1 49 SER n 1 50 GLU n 1 51 LEU n 1 52 LYS n 1 53 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 53 _entity_src_gen.gene_src_common_name 'Mouse-ear cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TATA, THA4, At5g28750, T32B20.e' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 THR 53 53 53 THR THR A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7B7O _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7B7O _struct.title 'Solution structure of A. thaliana core TatA in DHPC micelles' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7B7O _struct_keywords.text 'twin-arginine translocase, micelles, bitopic membrane protein, amphiphilic helix, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TATA_ARATH _struct_ref.pdbx_db_accession Q9LKU2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKT _struct_ref.pdbx_align_begin 62 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7B7O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 53 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9LKU2 _struct_ref_seq.db_align_beg 62 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 114 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 53 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 5580 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR relaxation study' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 6 ? GLY A 22 ? GLY A 6 GLY A 22 1 ? 17 HELX_P HELX_P2 AA2 PRO A 27 ? ILE A 33 ? PRO A 27 ILE A 33 1 ? 7 HELX_P HELX_P3 AA3 ILE A 33 ? GLU A 48 ? ILE A 33 GLU A 48 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 23 ? ? -69.79 -174.71 2 1 LEU A 26 ? ? 54.30 73.43 3 1 LYS A 52 ? ? 69.23 -75.35 4 2 LEU A 2 ? ? 59.91 -171.74 5 2 LYS A 24 ? ? -175.46 80.71 6 2 LEU A 26 ? ? -177.81 68.43 7 3 PRO A 23 ? ? -69.69 -172.63 8 3 LEU A 26 ? ? 51.98 73.32 9 3 LEU A 51 ? ? -160.58 26.01 10 4 PHE A 3 ? ? -141.85 33.41 11 4 PRO A 23 ? ? -69.77 -171.49 12 4 LYS A 24 ? ? 62.78 84.17 13 4 LEU A 26 ? ? -177.17 68.99 14 4 PRO A 27 ? ? -69.82 1.38 15 5 PHE A 3 ? ? 72.91 -67.33 16 5 LEU A 26 ? ? -150.01 67.89 17 5 GLU A 50 ? ? -173.25 -38.99 18 5 LEU A 51 ? ? -174.57 32.44 19 5 LYS A 52 ? ? -179.11 110.53 20 6 GLU A 50 ? ? -147.23 -74.46 21 6 LEU A 51 ? ? -170.51 -38.67 22 7 LEU A 2 ? ? -91.68 58.12 23 7 LYS A 24 ? ? -156.60 -46.32 24 7 LYS A 25 ? ? -179.01 -35.01 25 7 LEU A 26 ? ? -114.30 73.31 26 7 THR A 36 ? ? -90.00 -62.94 27 7 LYS A 52 ? ? 67.99 -76.79 28 8 PRO A 23 ? ? -69.82 -177.22 29 8 LYS A 24 ? ? -173.60 84.36 30 8 LEU A 26 ? ? 53.72 72.44 31 8 PRO A 27 ? ? -69.76 3.35 32 8 GLU A 50 ? ? 61.55 91.32 33 8 LEU A 51 ? ? -174.37 -36.97 34 8 LYS A 52 ? ? 52.20 83.92 35 10 PHE A 3 ? ? -97.28 46.87 36 10 LYS A 24 ? ? 63.18 84.40 37 10 LYS A 25 ? ? -158.75 30.47 38 10 LEU A 26 ? ? 57.44 73.21 # _pdbx_nmr_ensemble.entry_id 7B7O _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7B7O _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria medoid # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '200 uM [U-13C; U-15N] core AthTatA, 120 mM NA DHPC-d22, 20 mM NA sodium phosphate, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C_15N_sample micelle ? 2 '200 uM [U-15N] core AthTatA, 120 mM NA DHPC-d22, 20 mM NA sodium phosphate, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_sample micelle ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'core AthTatA' 200 ? uM '[U-13C; U-15N]' 1 DHPC-d22 120 ? mM NA 1 'sodium phosphate' 20 ? mM NA 2 'core AthTatA' 200 ? uM '[U-15N]' 2 DHPC-d22 120 ? mM NA 2 'sodium phosphate' 20 ? mM NA # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC' 1 isotropic 3 1 1 '3D CBCANH' 1 isotropic 4 1 1 '3D CBCA(CO)NH' 1 isotropic 8 1 1 '3D HNCO' 1 isotropic 9 1 1 '3D HNCACO' 1 isotropic 10 1 1 '3D 1H-15N NOESY' 1 isotropic 17 1 1 '3D 1H-13C NOESY' 1 isotropic 11 1 1 '3D 1H-15N TOCSY' 1 isotropic 16 1 1 '3D 1H-15N TOCSY' 4 isotropic 12 1 1 '3D H(CCO)NH' 1 isotropic 13 1 1 '3D C(CO)NH' 1 isotropic 14 1 1 '3D HCCH-TOCSY' 1 isotropic 15 1 2 '3D HNHA' 3 isotropic # _pdbx_nmr_refine.entry_id 7B7O _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CYANA ? 'Guntert P.' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 'peak picking' 'CcpNmr Analysis' ? CCPN # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 GLN N N N N 14 GLN CA C N S 15 GLN C C N N 16 GLN O O N N 17 GLN CB C N N 18 GLN CG C N N 19 GLN CD C N N 20 GLN OE1 O N N 21 GLN NE2 N N N 22 GLN OXT O N N 23 GLN H H N N 24 GLN H2 H N N 25 GLN HA H N N 26 GLN HB2 H N N 27 GLN HB3 H N N 28 GLN HG2 H N N 29 GLN HG3 H N N 30 GLN HE21 H N N 31 GLN HE22 H N N 32 GLN HXT H N N 33 GLU N N N N 34 GLU CA C N S 35 GLU C C N N 36 GLU O O N N 37 GLU CB C N N 38 GLU CG C N N 39 GLU CD C N N 40 GLU OE1 O N N 41 GLU OE2 O N N 42 GLU OXT O N N 43 GLU H H N N 44 GLU H2 H N N 45 GLU HA H N N 46 GLU HB2 H N N 47 GLU HB3 H N N 48 GLU HG2 H N N 49 GLU HG3 H N N 50 GLU HE2 H N N 51 GLU HXT H N N 52 GLY N N N N 53 GLY CA C N N 54 GLY C C N N 55 GLY O O N N 56 GLY OXT O N N 57 GLY H H N N 58 GLY H2 H N N 59 GLY HA2 H N N 60 GLY HA3 H N N 61 GLY HXT H N N 62 ILE N N N N 63 ILE CA C N S 64 ILE C C N N 65 ILE O O N N 66 ILE CB C N S 67 ILE CG1 C N N 68 ILE CG2 C N N 69 ILE CD1 C N N 70 ILE OXT O N N 71 ILE H H N N 72 ILE H2 H N N 73 ILE HA H N N 74 ILE HB H N N 75 ILE HG12 H N N 76 ILE HG13 H N N 77 ILE HG21 H N N 78 ILE HG22 H N N 79 ILE HG23 H N N 80 ILE HD11 H N N 81 ILE HD12 H N N 82 ILE HD13 H N N 83 ILE HXT H N N 84 LEU N N N N 85 LEU CA C N S 86 LEU C C N N 87 LEU O O N N 88 LEU CB C N N 89 LEU CG C N N 90 LEU CD1 C N N 91 LEU CD2 C N N 92 LEU OXT O N N 93 LEU H H N N 94 LEU H2 H N N 95 LEU HA H N N 96 LEU HB2 H N N 97 LEU HB3 H N N 98 LEU HG H N N 99 LEU HD11 H N N 100 LEU HD12 H N N 101 LEU HD13 H N N 102 LEU HD21 H N N 103 LEU HD22 H N N 104 LEU HD23 H N N 105 LEU HXT H N N 106 LYS N N N N 107 LYS CA C N S 108 LYS C C N N 109 LYS O O N N 110 LYS CB C N N 111 LYS CG C N N 112 LYS CD C N N 113 LYS CE C N N 114 LYS NZ N N N 115 LYS OXT O N N 116 LYS H H N N 117 LYS H2 H N N 118 LYS HA H N N 119 LYS HB2 H N N 120 LYS HB3 H N N 121 LYS HG2 H N N 122 LYS HG3 H N N 123 LYS HD2 H N N 124 LYS HD3 H N N 125 LYS HE2 H N N 126 LYS HE3 H N N 127 LYS HZ1 H N N 128 LYS HZ2 H N N 129 LYS HZ3 H N N 130 LYS HXT H N N 131 PHE N N N N 132 PHE CA C N S 133 PHE C C N N 134 PHE O O N N 135 PHE CB C N N 136 PHE CG C Y N 137 PHE CD1 C Y N 138 PHE CD2 C Y N 139 PHE CE1 C Y N 140 PHE CE2 C Y N 141 PHE CZ C Y N 142 PHE OXT O N N 143 PHE H H N N 144 PHE H2 H N N 145 PHE HA H N N 146 PHE HB2 H N N 147 PHE HB3 H N N 148 PHE HD1 H N N 149 PHE HD2 H N N 150 PHE HE1 H N N 151 PHE HE2 H N N 152 PHE HZ H N N 153 PHE HXT H N N 154 PRO N N N N 155 PRO CA C N S 156 PRO C C N N 157 PRO O O N N 158 PRO CB C N N 159 PRO CG C N N 160 PRO CD C N N 161 PRO OXT O N N 162 PRO H H N N 163 PRO HA H N N 164 PRO HB2 H N N 165 PRO HB3 H N N 166 PRO HG2 H N N 167 PRO HG3 H N N 168 PRO HD2 H N N 169 PRO HD3 H N N 170 PRO HXT H N N 171 SER N N N N 172 SER CA C N S 173 SER C C N N 174 SER O O N N 175 SER CB C N N 176 SER OG O N N 177 SER OXT O N N 178 SER H H N N 179 SER H2 H N N 180 SER HA H N N 181 SER HB2 H N N 182 SER HB3 H N N 183 SER HG H N N 184 SER HXT H N N 185 THR N N N N 186 THR CA C N S 187 THR C C N N 188 THR O O N N 189 THR CB C N R 190 THR OG1 O N N 191 THR CG2 C N N 192 THR OXT O N N 193 THR H H N N 194 THR H2 H N N 195 THR HA H N N 196 THR HB H N N 197 THR HG1 H N N 198 THR HG21 H N N 199 THR HG22 H N N 200 THR HG23 H N N 201 THR HXT H N N 202 VAL N N N N 203 VAL CA C N S 204 VAL C C N N 205 VAL O O N N 206 VAL CB C N N 207 VAL CG1 C N N 208 VAL CG2 C N N 209 VAL OXT O N N 210 VAL H H N N 211 VAL H2 H N N 212 VAL HA H N N 213 VAL HB H N N 214 VAL HG11 H N N 215 VAL HG12 H N N 216 VAL HG13 H N N 217 VAL HG21 H N N 218 VAL HG22 H N N 219 VAL HG23 H N N 220 VAL HXT H N N 221 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 GLN N CA sing N N 13 GLN N H sing N N 14 GLN N H2 sing N N 15 GLN CA C sing N N 16 GLN CA CB sing N N 17 GLN CA HA sing N N 18 GLN C O doub N N 19 GLN C OXT sing N N 20 GLN CB CG sing N N 21 GLN CB HB2 sing N N 22 GLN CB HB3 sing N N 23 GLN CG CD sing N N 24 GLN CG HG2 sing N N 25 GLN CG HG3 sing N N 26 GLN CD OE1 doub N N 27 GLN CD NE2 sing N N 28 GLN NE2 HE21 sing N N 29 GLN NE2 HE22 sing N N 30 GLN OXT HXT sing N N 31 GLU N CA sing N N 32 GLU N H sing N N 33 GLU N H2 sing N N 34 GLU CA C sing N N 35 GLU CA CB sing N N 36 GLU CA HA sing N N 37 GLU C O doub N N 38 GLU C OXT sing N N 39 GLU CB CG sing N N 40 GLU CB HB2 sing N N 41 GLU CB HB3 sing N N 42 GLU CG CD sing N N 43 GLU CG HG2 sing N N 44 GLU CG HG3 sing N N 45 GLU CD OE1 doub N N 46 GLU CD OE2 sing N N 47 GLU OE2 HE2 sing N N 48 GLU OXT HXT sing N N 49 GLY N CA sing N N 50 GLY N H sing N N 51 GLY N H2 sing N N 52 GLY CA C sing N N 53 GLY CA HA2 sing N N 54 GLY CA HA3 sing N N 55 GLY C O doub N N 56 GLY C OXT sing N N 57 GLY OXT HXT sing N N 58 ILE N CA sing N N 59 ILE N H sing N N 60 ILE N H2 sing N N 61 ILE CA C sing N N 62 ILE CA CB sing N N 63 ILE CA HA sing N N 64 ILE C O doub N N 65 ILE C OXT sing N N 66 ILE CB CG1 sing N N 67 ILE CB CG2 sing N N 68 ILE CB HB sing N N 69 ILE CG1 CD1 sing N N 70 ILE CG1 HG12 sing N N 71 ILE CG1 HG13 sing N N 72 ILE CG2 HG21 sing N N 73 ILE CG2 HG22 sing N N 74 ILE CG2 HG23 sing N N 75 ILE CD1 HD11 sing N N 76 ILE CD1 HD12 sing N N 77 ILE CD1 HD13 sing N N 78 ILE OXT HXT sing N N 79 LEU N CA sing N N 80 LEU N H sing N N 81 LEU N H2 sing N N 82 LEU CA C sing N N 83 LEU CA CB sing N N 84 LEU CA HA sing N N 85 LEU C O doub N N 86 LEU C OXT sing N N 87 LEU CB CG sing N N 88 LEU CB HB2 sing N N 89 LEU CB HB3 sing N N 90 LEU CG CD1 sing N N 91 LEU CG CD2 sing N N 92 LEU CG HG sing N N 93 LEU CD1 HD11 sing N N 94 LEU CD1 HD12 sing N N 95 LEU CD1 HD13 sing N N 96 LEU CD2 HD21 sing N N 97 LEU CD2 HD22 sing N N 98 LEU CD2 HD23 sing N N 99 LEU OXT HXT sing N N 100 LYS N CA sing N N 101 LYS N H sing N N 102 LYS N H2 sing N N 103 LYS CA C sing N N 104 LYS CA CB sing N N 105 LYS CA HA sing N N 106 LYS C O doub N N 107 LYS C OXT sing N N 108 LYS CB CG sing N N 109 LYS CB HB2 sing N N 110 LYS CB HB3 sing N N 111 LYS CG CD sing N N 112 LYS CG HG2 sing N N 113 LYS CG HG3 sing N N 114 LYS CD CE sing N N 115 LYS CD HD2 sing N N 116 LYS CD HD3 sing N N 117 LYS CE NZ sing N N 118 LYS CE HE2 sing N N 119 LYS CE HE3 sing N N 120 LYS NZ HZ1 sing N N 121 LYS NZ HZ2 sing N N 122 LYS NZ HZ3 sing N N 123 LYS OXT HXT sing N N 124 PHE N CA sing N N 125 PHE N H sing N N 126 PHE N H2 sing N N 127 PHE CA C sing N N 128 PHE CA CB sing N N 129 PHE CA HA sing N N 130 PHE C O doub N N 131 PHE C OXT sing N N 132 PHE CB CG sing N N 133 PHE CB HB2 sing N N 134 PHE CB HB3 sing N N 135 PHE CG CD1 doub Y N 136 PHE CG CD2 sing Y N 137 PHE CD1 CE1 sing Y N 138 PHE CD1 HD1 sing N N 139 PHE CD2 CE2 doub Y N 140 PHE CD2 HD2 sing N N 141 PHE CE1 CZ doub Y N 142 PHE CE1 HE1 sing N N 143 PHE CE2 CZ sing Y N 144 PHE CE2 HE2 sing N N 145 PHE CZ HZ sing N N 146 PHE OXT HXT sing N N 147 PRO N CA sing N N 148 PRO N CD sing N N 149 PRO N H sing N N 150 PRO CA C sing N N 151 PRO CA CB sing N N 152 PRO CA HA sing N N 153 PRO C O doub N N 154 PRO C OXT sing N N 155 PRO CB CG sing N N 156 PRO CB HB2 sing N N 157 PRO CB HB3 sing N N 158 PRO CG CD sing N N 159 PRO CG HG2 sing N N 160 PRO CG HG3 sing N N 161 PRO CD HD2 sing N N 162 PRO CD HD3 sing N N 163 PRO OXT HXT sing N N 164 SER N CA sing N N 165 SER N H sing N N 166 SER N H2 sing N N 167 SER CA C sing N N 168 SER CA CB sing N N 169 SER CA HA sing N N 170 SER C O doub N N 171 SER C OXT sing N N 172 SER CB OG sing N N 173 SER CB HB2 sing N N 174 SER CB HB3 sing N N 175 SER OG HG sing N N 176 SER OXT HXT sing N N 177 THR N CA sing N N 178 THR N H sing N N 179 THR N H2 sing N N 180 THR CA C sing N N 181 THR CA CB sing N N 182 THR CA HA sing N N 183 THR C O doub N N 184 THR C OXT sing N N 185 THR CB OG1 sing N N 186 THR CB CG2 sing N N 187 THR CB HB sing N N 188 THR OG1 HG1 sing N N 189 THR CG2 HG21 sing N N 190 THR CG2 HG22 sing N N 191 THR CG2 HG23 sing N N 192 THR OXT HXT sing N N 193 VAL N CA sing N N 194 VAL N H sing N N 195 VAL N H2 sing N N 196 VAL CA C sing N N 197 VAL CA CB sing N N 198 VAL CA HA sing N N 199 VAL C O doub N N 200 VAL C OXT sing N N 201 VAL CB CG1 sing N N 202 VAL CB CG2 sing N N 203 VAL CB HB sing N N 204 VAL CG1 HG11 sing N N 205 VAL CG1 HG12 sing N N 206 VAL CG1 HG13 sing N N 207 VAL CG2 HG21 sing N N 208 VAL CG2 HG22 sing N N 209 VAL CG2 HG23 sing N N 210 VAL OXT HXT sing N N 211 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Swedish Research Council' Sweden 621-2014-3706 1 'German Research Foundation (DFG)' Germany 'KL 862/6-1' 2 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 700 ? 4 AVANCE ? Bruker 600 ? 3 AVANCE ? Bruker 500 ? # _atom_sites.entry_id 7B7O _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_