data_7BCJ # _entry.id 7BCJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7BCJ pdb_00007bcj 10.2210/pdb7bcj/pdb WWPDB D_1292111797 ? ? BMRB 34585 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution Structure of RoxP' _pdbx_database_related.db_id 34585 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7BCJ _pdbx_database_status.recvd_initial_deposition_date 2020-12-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category FoldIt _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Stoedkilde, K.' 1 0000-0002-7324-305X 'Nielsen, J.T.' 2 0000-0002-9554-4662 'Mulder, F.A.A.' 3 0000-0001-9427-8406 'Andersen, C.B.F.' 4 0000-0001-6182-2436 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Front Cell Infect Microbiol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2235-2988 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 803004 _citation.page_last 803004 _citation.title 'Solution Structure of the Cutibacterium acnes -Specific Protein RoxP and Insights Into Its Antioxidant Activity.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3389/fcimb.2022.803004 _citation.pdbx_database_id_PubMed 35223541 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Stodkilde, K.' 1 ? primary 'Nielsen, J.T.' 2 ? primary 'Petersen, S.V.' 3 ? primary 'Paetzold, B.' 4 ? primary 'Bruggemann, H.' 5 ? primary 'Mulder, F.A.A.' 6 ? primary 'Andersen, C.B.F.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Radical Oxygenase of Propionibacterium acnes' _entity.formula_weight 15977.760 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTPIDESQLPVGPQVSVTDSAQHTGPFAASSPLTITVKPGAPCVRADGYQESMVTRVLDDKGHQVWTGTFDESKLIGGTG LGTATFHVGSPAAAFNFHGSERTTYRTLSYCAYPHYVNGTRERLSQVSVKTFMVDPALNLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MTPIDESQLPVGPQVSVTDSAQHTGPFAASSPLTITVKPGAPCVRADGYQESMVTRVLDDKGHQVWTGTFDESKLIGGTG LGTATFHVGSPAAAFNFHGSERTTYRTLSYCAYPHYVNGTRERLSQVSVKTFMVDPALNLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 PRO n 1 4 ILE n 1 5 ASP n 1 6 GLU n 1 7 SER n 1 8 GLN n 1 9 LEU n 1 10 PRO n 1 11 VAL n 1 12 GLY n 1 13 PRO n 1 14 GLN n 1 15 VAL n 1 16 SER n 1 17 VAL n 1 18 THR n 1 19 ASP n 1 20 SER n 1 21 ALA n 1 22 GLN n 1 23 HIS n 1 24 THR n 1 25 GLY n 1 26 PRO n 1 27 PHE n 1 28 ALA n 1 29 ALA n 1 30 SER n 1 31 SER n 1 32 PRO n 1 33 LEU n 1 34 THR n 1 35 ILE n 1 36 THR n 1 37 VAL n 1 38 LYS n 1 39 PRO n 1 40 GLY n 1 41 ALA n 1 42 PRO n 1 43 CYS n 1 44 VAL n 1 45 ARG n 1 46 ALA n 1 47 ASP n 1 48 GLY n 1 49 TYR n 1 50 GLN n 1 51 GLU n 1 52 SER n 1 53 MET n 1 54 VAL n 1 55 THR n 1 56 ARG n 1 57 VAL n 1 58 LEU n 1 59 ASP n 1 60 ASP n 1 61 LYS n 1 62 GLY n 1 63 HIS n 1 64 GLN n 1 65 VAL n 1 66 TRP n 1 67 THR n 1 68 GLY n 1 69 THR n 1 70 PHE n 1 71 ASP n 1 72 GLU n 1 73 SER n 1 74 LYS n 1 75 LEU n 1 76 ILE n 1 77 GLY n 1 78 GLY n 1 79 THR n 1 80 GLY n 1 81 LEU n 1 82 GLY n 1 83 THR n 1 84 ALA n 1 85 THR n 1 86 PHE n 1 87 HIS n 1 88 VAL n 1 89 GLY n 1 90 SER n 1 91 PRO n 1 92 ALA n 1 93 ALA n 1 94 ALA n 1 95 PHE n 1 96 ASN n 1 97 PHE n 1 98 HIS n 1 99 GLY n 1 100 SER n 1 101 GLU n 1 102 ARG n 1 103 THR n 1 104 THR n 1 105 TYR n 1 106 ARG n 1 107 THR n 1 108 LEU n 1 109 SER n 1 110 TYR n 1 111 CYS n 1 112 ALA n 1 113 TYR n 1 114 PRO n 1 115 HIS n 1 116 TYR n 1 117 VAL n 1 118 ASN n 1 119 GLY n 1 120 THR n 1 121 ARG n 1 122 GLU n 1 123 ARG n 1 124 LEU n 1 125 SER n 1 126 GLN n 1 127 VAL n 1 128 SER n 1 129 VAL n 1 130 LYS n 1 131 THR n 1 132 PHE n 1 133 MET n 1 134 VAL n 1 135 ASP n 1 136 PRO n 1 137 ALA n 1 138 LEU n 1 139 ASN n 1 140 LEU n 1 141 GLU n 1 142 HIS n 1 143 HIS n 1 144 HIS n 1 145 HIS n 1 146 HIS n 1 147 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 147 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PPA1939, cbac_10500' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSM 16379 / KPA171202' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Cutibacterium acnes (strain DSM 16379 / KPA171202)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 267747 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET22b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6A6F6_CUTAK _struct_ref.pdbx_db_accession Q6A6F6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TPIDESQLPVGPQVSVTDSAQHTGPFAASSPLTITVKPGAPCVRADGYQESMVTRVLDDKGHQVWTGTFDESKLIGGTGL GTATFHVGSPAAAFNFHGSERTTYRTLSYCAYPHYVNGTRERLSQVSVKTFMVDPALN ; _struct_ref.pdbx_align_begin 24 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7BCJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 139 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6A6F6 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 161 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 24 _struct_ref_seq.pdbx_auth_seq_align_end 161 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7BCJ MET A 1 ? UNP Q6A6F6 ? ? 'initiating methionine' 23 1 1 7BCJ LEU A 140 ? UNP Q6A6F6 ? ? 'expression tag' 162 2 1 7BCJ GLU A 141 ? UNP Q6A6F6 ? ? 'expression tag' 163 3 1 7BCJ HIS A 142 ? UNP Q6A6F6 ? ? 'expression tag' 164 4 1 7BCJ HIS A 143 ? UNP Q6A6F6 ? ? 'expression tag' 165 5 1 7BCJ HIS A 144 ? UNP Q6A6F6 ? ? 'expression tag' 166 6 1 7BCJ HIS A 145 ? UNP Q6A6F6 ? ? 'expression tag' 167 7 1 7BCJ HIS A 146 ? UNP Q6A6F6 ? ? 'expression tag' 168 8 1 7BCJ HIS A 147 ? UNP Q6A6F6 ? ? 'expression tag' 169 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-13C HSQC' 1 isotropic 2 1 1 '2D 1H-15N HSQC' 1 isotropic 3 1 1 '3D HNCO' 1 isotropic 4 1 1 '2D 1H-15N TROSY' 1 isotropic 5 1 1 '2D HBCBCGCDHD' 1 isotropic 6 1 1 '2D HBCBCGCDCEHE' 1 isotropic 7 1 1 '3D HNCACB' 1 isotropic 8 1 1 '3D H(CCO)NH' 1 isotropic 9 1 1 '3D HN(CA)CO' 1 isotropic 10 1 1 '3D C(CO)NH' 1 isotropic 11 1 1 '3D HCCH-TOCSY' 1 isotropic 12 1 1 '3D 15N-separated NOESY' 1 isotropic 13 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 14 1 1 '4D 13C-separated NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label condition1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.2 mM [U-98% 13C; U-98% 15N] RoxP, 93% H2O/7% D2O' _pdbx_nmr_sample_details.solvent_system '93% H2O/7% D2O' _pdbx_nmr_sample_details.label 13C_15N_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AM _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 950 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 7BCJ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # _pdbx_nmr_ensemble.entry_id 7BCJ _pdbx_nmr_ensemble.conformers_calculated_total_number 2000 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7BCJ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift calculation' TALOS-N ? 'Shen Y, Bax A' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 4 'chemical shift assignment' Sparky ? Goddard # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7BCJ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7BCJ _struct.title 'Solution Structure of RoxP' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7BCJ _struct_keywords.text 'Ig-like, reductase, I2-set, Antioxidant, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 71 ? LEU A 75 ? ASP A 93 LEU A 97 5 ? 5 HELX_P HELX_P2 AA2 SER A 90 ? PHE A 95 ? SER A 112 PHE A 117 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 43 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 111 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 65 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 133 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.121 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 25 A . ? GLY 47 A PRO 26 A ? PRO 48 A 1 0.08 2 GLY 25 A . ? GLY 47 A PRO 26 A ? PRO 48 A 2 0.03 3 GLY 25 A . ? GLY 47 A PRO 26 A ? PRO 48 A 3 0.10 4 GLY 25 A . ? GLY 47 A PRO 26 A ? PRO 48 A 4 0.11 5 GLY 25 A . ? GLY 47 A PRO 26 A ? PRO 48 A 5 0.06 6 GLY 25 A . ? GLY 47 A PRO 26 A ? PRO 48 A 6 0.05 7 GLY 25 A . ? GLY 47 A PRO 26 A ? PRO 48 A 7 0.08 8 GLY 25 A . ? GLY 47 A PRO 26 A ? PRO 48 A 8 0.09 9 GLY 25 A . ? GLY 47 A PRO 26 A ? PRO 48 A 9 0.03 10 GLY 25 A . ? GLY 47 A PRO 26 A ? PRO 48 A 10 0.06 11 GLY 25 A . ? GLY 47 A PRO 26 A ? PRO 48 A 11 0.10 12 GLY 25 A . ? GLY 47 A PRO 26 A ? PRO 48 A 12 0.02 13 GLY 25 A . ? GLY 47 A PRO 26 A ? PRO 48 A 13 0.08 14 GLY 25 A . ? GLY 47 A PRO 26 A ? PRO 48 A 14 -0.03 15 GLY 25 A . ? GLY 47 A PRO 26 A ? PRO 48 A 15 0.05 16 GLY 25 A . ? GLY 47 A PRO 26 A ? PRO 48 A 16 0.09 17 GLY 25 A . ? GLY 47 A PRO 26 A ? PRO 48 A 17 0.05 18 GLY 25 A . ? GLY 47 A PRO 26 A ? PRO 48 A 18 0.12 19 GLY 25 A . ? GLY 47 A PRO 26 A ? PRO 48 A 19 0.08 20 GLY 25 A . ? GLY 47 A PRO 26 A ? PRO 48 A 20 0.03 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 14 ? ASP A 19 ? GLN A 36 ASP A 41 AA1 2 LEU A 33 ? LYS A 38 ? LEU A 55 LYS A 60 AA1 3 ALA A 84 ? GLY A 89 ? ALA A 106 GLY A 111 AA2 1 PHE A 27 ? ALA A 28 ? PHE A 49 ALA A 50 AA2 2 SER A 128 ? ASP A 135 ? SER A 150 ASP A 157 AA2 3 THR A 103 ? TYR A 110 ? THR A 125 TYR A 132 AA2 4 MET A 53 ? LEU A 58 ? MET A 75 LEU A 80 AA2 5 GLN A 64 ? PHE A 70 ? GLN A 86 PHE A 92 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 16 ? N SER A 38 O THR A 36 ? O THR A 58 AA1 2 3 N VAL A 37 ? N VAL A 59 O ALA A 84 ? O ALA A 106 AA2 1 2 N PHE A 27 ? N PHE A 49 O ASP A 135 ? O ASP A 157 AA2 2 3 O PHE A 132 ? O PHE A 154 N TYR A 105 ? N TYR A 127 AA2 3 4 O ARG A 106 ? O ARG A 128 N LEU A 58 ? N LEU A 80 AA2 4 5 N MET A 53 ? N MET A 75 O PHE A 70 ? O PHE A 92 # _atom_sites.entry_id 7BCJ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 23 23 MET MET A . n A 1 2 THR 2 24 24 THR THR A . n A 1 3 PRO 3 25 25 PRO PRO A . n A 1 4 ILE 4 26 26 ILE ILE A . n A 1 5 ASP 5 27 27 ASP ASP A . n A 1 6 GLU 6 28 28 GLU GLU A . n A 1 7 SER 7 29 29 SER SER A . n A 1 8 GLN 8 30 30 GLN GLN A . n A 1 9 LEU 9 31 31 LEU LEU A . n A 1 10 PRO 10 32 32 PRO PRO A . n A 1 11 VAL 11 33 33 VAL VAL A . n A 1 12 GLY 12 34 34 GLY GLY A . n A 1 13 PRO 13 35 35 PRO PRO A . n A 1 14 GLN 14 36 36 GLN GLN A . n A 1 15 VAL 15 37 37 VAL VAL A . n A 1 16 SER 16 38 38 SER SER A . n A 1 17 VAL 17 39 39 VAL VAL A . n A 1 18 THR 18 40 40 THR THR A . n A 1 19 ASP 19 41 41 ASP ASP A . n A 1 20 SER 20 42 42 SER SER A . n A 1 21 ALA 21 43 43 ALA ALA A . n A 1 22 GLN 22 44 44 GLN GLN A . n A 1 23 HIS 23 45 45 HIS HIS A . n A 1 24 THR 24 46 46 THR THR A . n A 1 25 GLY 25 47 47 GLY GLY A . n A 1 26 PRO 26 48 48 PRO PRO A . n A 1 27 PHE 27 49 49 PHE PHE A . n A 1 28 ALA 28 50 50 ALA ALA A . n A 1 29 ALA 29 51 51 ALA ALA A . n A 1 30 SER 30 52 52 SER SER A . n A 1 31 SER 31 53 53 SER SER A . n A 1 32 PRO 32 54 54 PRO PRO A . n A 1 33 LEU 33 55 55 LEU LEU A . n A 1 34 THR 34 56 56 THR THR A . n A 1 35 ILE 35 57 57 ILE ILE A . n A 1 36 THR 36 58 58 THR THR A . n A 1 37 VAL 37 59 59 VAL VAL A . n A 1 38 LYS 38 60 60 LYS LYS A . n A 1 39 PRO 39 61 61 PRO PRO A . n A 1 40 GLY 40 62 62 GLY GLY A . n A 1 41 ALA 41 63 63 ALA ALA A . n A 1 42 PRO 42 64 64 PRO PRO A . n A 1 43 CYS 43 65 65 CYS CYS A . n A 1 44 VAL 44 66 66 VAL VAL A . n A 1 45 ARG 45 67 67 ARG ARG A . n A 1 46 ALA 46 68 68 ALA ALA A . n A 1 47 ASP 47 69 69 ASP ASP A . n A 1 48 GLY 48 70 70 GLY GLY A . n A 1 49 TYR 49 71 71 TYR TYR A . n A 1 50 GLN 50 72 72 GLN GLN A . n A 1 51 GLU 51 73 73 GLU GLU A . n A 1 52 SER 52 74 74 SER SER A . n A 1 53 MET 53 75 75 MET MET A . n A 1 54 VAL 54 76 76 VAL VAL A . n A 1 55 THR 55 77 77 THR THR A . n A 1 56 ARG 56 78 78 ARG ARG A . n A 1 57 VAL 57 79 79 VAL VAL A . n A 1 58 LEU 58 80 80 LEU LEU A . n A 1 59 ASP 59 81 81 ASP ASP A . n A 1 60 ASP 60 82 82 ASP ASP A . n A 1 61 LYS 61 83 83 LYS LYS A . n A 1 62 GLY 62 84 84 GLY GLY A . n A 1 63 HIS 63 85 85 HIS HIS A . n A 1 64 GLN 64 86 86 GLN GLN A . n A 1 65 VAL 65 87 87 VAL VAL A . n A 1 66 TRP 66 88 88 TRP TRP A . n A 1 67 THR 67 89 89 THR THR A . n A 1 68 GLY 68 90 90 GLY GLY A . n A 1 69 THR 69 91 91 THR THR A . n A 1 70 PHE 70 92 92 PHE PHE A . n A 1 71 ASP 71 93 93 ASP ASP A . n A 1 72 GLU 72 94 94 GLU GLU A . n A 1 73 SER 73 95 95 SER SER A . n A 1 74 LYS 74 96 96 LYS LYS A . n A 1 75 LEU 75 97 97 LEU LEU A . n A 1 76 ILE 76 98 98 ILE ILE A . n A 1 77 GLY 77 99 99 GLY GLY A . n A 1 78 GLY 78 100 100 GLY GLY A . n A 1 79 THR 79 101 101 THR THR A . n A 1 80 GLY 80 102 102 GLY GLY A . n A 1 81 LEU 81 103 103 LEU LEU A . n A 1 82 GLY 82 104 104 GLY GLY A . n A 1 83 THR 83 105 105 THR THR A . n A 1 84 ALA 84 106 106 ALA ALA A . n A 1 85 THR 85 107 107 THR THR A . n A 1 86 PHE 86 108 108 PHE PHE A . n A 1 87 HIS 87 109 109 HIS HIS A . n A 1 88 VAL 88 110 110 VAL VAL A . n A 1 89 GLY 89 111 111 GLY GLY A . n A 1 90 SER 90 112 112 SER SER A . n A 1 91 PRO 91 113 113 PRO PRO A . n A 1 92 ALA 92 114 114 ALA ALA A . n A 1 93 ALA 93 115 115 ALA ALA A . n A 1 94 ALA 94 116 116 ALA ALA A . n A 1 95 PHE 95 117 117 PHE PHE A . n A 1 96 ASN 96 118 118 ASN ASN A . n A 1 97 PHE 97 119 119 PHE PHE A . n A 1 98 HIS 98 120 120 HIS HIS A . n A 1 99 GLY 99 121 121 GLY GLY A . n A 1 100 SER 100 122 122 SER SER A . n A 1 101 GLU 101 123 123 GLU GLU A . n A 1 102 ARG 102 124 124 ARG ARG A . n A 1 103 THR 103 125 125 THR THR A . n A 1 104 THR 104 126 126 THR THR A . n A 1 105 TYR 105 127 127 TYR TYR A . n A 1 106 ARG 106 128 128 ARG ARG A . n A 1 107 THR 107 129 129 THR THR A . n A 1 108 LEU 108 130 130 LEU LEU A . n A 1 109 SER 109 131 131 SER SER A . n A 1 110 TYR 110 132 132 TYR TYR A . n A 1 111 CYS 111 133 133 CYS CYS A . n A 1 112 ALA 112 134 134 ALA ALA A . n A 1 113 TYR 113 135 135 TYR TYR A . n A 1 114 PRO 114 136 136 PRO PRO A . n A 1 115 HIS 115 137 137 HIS HIS A . n A 1 116 TYR 116 138 138 TYR TYR A . n A 1 117 VAL 117 139 139 VAL VAL A . n A 1 118 ASN 118 140 140 ASN ASN A . n A 1 119 GLY 119 141 141 GLY GLY A . n A 1 120 THR 120 142 142 THR THR A . n A 1 121 ARG 121 143 143 ARG ARG A . n A 1 122 GLU 122 144 144 GLU GLU A . n A 1 123 ARG 123 145 145 ARG ARG A . n A 1 124 LEU 124 146 146 LEU LEU A . n A 1 125 SER 125 147 147 SER SER A . n A 1 126 GLN 126 148 148 GLN GLN A . n A 1 127 VAL 127 149 149 VAL VAL A . n A 1 128 SER 128 150 150 SER SER A . n A 1 129 VAL 129 151 151 VAL VAL A . n A 1 130 LYS 130 152 152 LYS LYS A . n A 1 131 THR 131 153 153 THR THR A . n A 1 132 PHE 132 154 154 PHE PHE A . n A 1 133 MET 133 155 155 MET MET A . n A 1 134 VAL 134 156 156 VAL VAL A . n A 1 135 ASP 135 157 157 ASP ASP A . n A 1 136 PRO 136 158 158 PRO PRO A . n A 1 137 ALA 137 159 159 ALA ALA A . n A 1 138 LEU 138 160 160 LEU LEU A . n A 1 139 ASN 139 161 161 ASN ASN A . n A 1 140 LEU 140 162 162 LEU LEU A . n A 1 141 GLU 141 163 163 GLU GLU A . n A 1 142 HIS 142 164 164 HIS HIS A . n A 1 143 HIS 143 165 ? ? ? A . n A 1 144 HIS 144 166 ? ? ? A . n A 1 145 HIS 145 167 ? ? ? A . n A 1 146 HIS 146 168 ? ? ? A . n A 1 147 HIS 147 169 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8890 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-11-24 2 'Structure model' 1 1 2022-03-16 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' 13 2 'Structure model' '_citation_author.name' 14 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component RoxP _pdbx_nmr_exptl_sample.concentration 1.2 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-98% 13C; U-98% 15N]' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PHE 117 ? ? N A PHE 119 ? ? 1.96 2 2 O A PHE 117 ? ? N A PHE 119 ? ? 1.95 3 3 O A PHE 117 ? ? N A PHE 119 ? ? 1.95 4 4 O A PHE 117 ? ? N A PHE 119 ? ? 1.94 5 5 O A PHE 117 ? ? N A PHE 119 ? ? 1.94 6 6 O A PHE 117 ? ? N A PHE 119 ? ? 1.94 7 7 O A PHE 117 ? ? N A PHE 119 ? ? 1.94 8 8 O A PHE 117 ? ? N A PHE 119 ? ? 1.94 9 9 O A PHE 117 ? ? N A PHE 119 ? ? 1.95 10 10 O A PHE 117 ? ? N A PHE 119 ? ? 1.94 11 11 O A PHE 117 ? ? N A PHE 119 ? ? 1.94 12 12 O A PHE 117 ? ? N A PHE 119 ? ? 1.94 13 13 O A PHE 117 ? ? N A PHE 119 ? ? 1.94 14 14 O A PHE 117 ? ? N A PHE 119 ? ? 1.95 15 15 O A PHE 117 ? ? N A PHE 119 ? ? 1.95 16 16 O A PHE 117 ? ? N A PHE 119 ? ? 1.94 17 17 O A PHE 117 ? ? N A PHE 119 ? ? 1.96 18 18 O A PHE 117 ? ? N A PHE 119 ? ? 1.95 19 19 O A PHE 117 ? ? N A PHE 119 ? ? 1.96 20 20 O A PHE 117 ? ? N A PHE 119 ? ? 1.95 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 32 ? ? -69.78 -177.26 2 1 PRO A 61 ? ? -69.70 -87.76 3 1 PRO A 64 ? ? -69.77 93.33 4 1 GLU A 73 ? ? -112.05 -74.70 5 1 THR A 89 ? ? -170.56 134.51 6 1 PHE A 117 ? ? -102.44 41.07 7 1 ASN A 118 ? ? 9.94 42.29 8 1 PHE A 119 ? ? -61.27 95.31 9 1 HIS A 120 ? ? -109.14 64.32 10 1 GLN A 148 ? ? -53.19 175.21 11 1 GLU A 163 ? ? -55.54 173.69 12 2 PRO A 25 ? ? -69.74 -164.86 13 2 PRO A 32 ? ? -69.80 -174.47 14 2 PRO A 61 ? ? -69.79 -88.68 15 2 PRO A 64 ? ? -69.74 95.11 16 2 GLU A 73 ? ? -104.97 -83.78 17 2 THR A 89 ? ? -172.01 121.73 18 2 PHE A 117 ? ? -103.32 41.34 19 2 ASN A 118 ? ? 9.01 42.57 20 2 PHE A 119 ? ? -60.93 95.31 21 2 HIS A 120 ? ? -108.02 64.40 22 2 TYR A 135 ? ? -51.03 108.82 23 2 ARG A 143 ? ? -170.17 128.65 24 2 GLN A 148 ? ? -52.69 174.46 25 2 GLU A 163 ? ? -170.79 147.80 26 3 PRO A 25 ? ? -69.75 -165.15 27 3 PRO A 32 ? ? -69.72 -173.65 28 3 PRO A 61 ? ? -69.73 -88.10 29 3 PRO A 64 ? ? -69.74 98.98 30 3 GLU A 73 ? ? -111.89 -80.87 31 3 PHE A 117 ? ? -103.68 41.22 32 3 ASN A 118 ? ? 9.42 42.61 33 3 PHE A 119 ? ? -60.15 96.58 34 3 HIS A 120 ? ? -108.91 64.44 35 3 TYR A 135 ? ? -51.45 109.14 36 3 GLN A 148 ? ? -53.90 176.72 37 3 GLU A 163 ? ? -100.05 -73.83 38 4 PRO A 32 ? ? -69.72 -172.80 39 4 PRO A 61 ? ? -69.75 -88.59 40 4 PRO A 64 ? ? -69.69 97.51 41 4 THR A 89 ? ? -174.68 117.74 42 4 PHE A 117 ? ? -103.72 41.00 43 4 ASN A 118 ? ? 8.77 42.84 44 4 PHE A 119 ? ? -60.13 95.83 45 4 HIS A 120 ? ? -108.54 63.88 46 4 GLN A 148 ? ? -53.61 175.41 47 5 PRO A 25 ? ? -69.78 -164.83 48 5 PRO A 32 ? ? -69.77 -176.98 49 5 PRO A 61 ? ? -69.81 -88.03 50 5 PRO A 64 ? ? -69.74 94.79 51 5 GLU A 73 ? ? -109.06 -80.36 52 5 THR A 89 ? ? -176.11 128.56 53 5 PHE A 117 ? ? -103.23 40.94 54 5 ASN A 118 ? ? 9.15 42.40 55 5 PHE A 119 ? ? -59.95 96.97 56 5 HIS A 120 ? ? -108.20 51.87 57 5 HIS A 137 ? ? -56.56 170.78 58 5 ASN A 140 ? ? -60.55 -70.28 59 5 GLN A 148 ? ? -53.57 175.75 60 5 GLU A 163 ? ? -51.58 104.68 61 6 PRO A 25 ? ? -69.71 -164.67 62 6 PRO A 32 ? ? -69.72 -176.48 63 6 PRO A 61 ? ? -69.79 -88.84 64 6 PRO A 64 ? ? -69.80 91.41 65 6 GLU A 73 ? ? -105.61 -74.18 66 6 THR A 89 ? ? -172.66 131.32 67 6 PHE A 117 ? ? -103.55 41.66 68 6 ASN A 118 ? ? 8.79 42.68 69 6 PHE A 119 ? ? -60.26 95.77 70 6 HIS A 120 ? ? -108.97 64.30 71 6 VAL A 139 ? ? -170.37 133.64 72 6 ASN A 140 ? ? -56.53 104.57 73 6 GLN A 148 ? ? -53.79 177.60 74 7 THR A 24 ? ? 46.82 74.46 75 7 PRO A 32 ? ? -69.80 -176.86 76 7 PRO A 61 ? ? -69.69 -88.39 77 7 PRO A 64 ? ? -69.72 95.98 78 7 GLU A 73 ? ? -113.94 -81.30 79 7 THR A 89 ? ? -174.73 123.53 80 7 PHE A 117 ? ? -103.02 41.49 81 7 ASN A 118 ? ? 8.38 42.99 82 7 PHE A 119 ? ? -59.21 95.53 83 7 HIS A 120 ? ? -108.45 64.23 84 7 VAL A 139 ? ? -104.25 -70.80 85 7 GLN A 148 ? ? -52.60 173.60 86 7 GLU A 163 ? ? -83.50 -70.81 87 8 THR A 24 ? ? 46.75 73.97 88 8 PRO A 32 ? ? -69.75 -173.85 89 8 PRO A 61 ? ? -69.78 -88.37 90 8 PRO A 64 ? ? -69.75 95.61 91 8 THR A 89 ? ? -173.12 129.82 92 8 PHE A 117 ? ? -102.96 41.03 93 8 ASN A 118 ? ? 8.83 42.59 94 8 PHE A 119 ? ? -59.47 95.92 95 8 HIS A 120 ? ? -108.06 64.58 96 8 GLN A 148 ? ? -54.58 179.28 97 9 PRO A 25 ? ? -69.74 -165.18 98 9 PRO A 32 ? ? -69.74 -175.79 99 9 PRO A 61 ? ? -69.72 -88.53 100 9 PRO A 64 ? ? -69.72 94.47 101 9 GLU A 73 ? ? -93.05 -85.32 102 9 SER A 74 ? ? -174.77 146.62 103 9 THR A 89 ? ? -172.75 135.39 104 9 PHE A 117 ? ? -103.40 41.17 105 9 ASN A 118 ? ? 9.21 42.68 106 9 PHE A 119 ? ? -60.01 96.62 107 9 HIS A 120 ? ? -109.40 64.49 108 9 ASN A 140 ? ? -110.80 58.41 109 9 GLN A 148 ? ? -53.74 176.96 110 9 LEU A 162 ? ? -162.79 107.25 111 10 PRO A 25 ? ? -69.74 -165.43 112 10 PRO A 32 ? ? -69.77 -176.62 113 10 PRO A 61 ? ? -69.73 -88.77 114 10 PRO A 64 ? ? -69.70 95.17 115 10 GLU A 73 ? ? -115.70 -83.03 116 10 THR A 89 ? ? -173.79 123.27 117 10 PHE A 117 ? ? -102.93 41.25 118 10 ASN A 118 ? ? 8.37 43.10 119 10 PHE A 119 ? ? -59.60 96.36 120 10 HIS A 120 ? ? -108.44 64.61 121 10 TYR A 135 ? ? -50.90 108.81 122 10 GLN A 148 ? ? -52.19 173.35 123 11 PRO A 25 ? ? -69.78 71.91 124 11 PRO A 32 ? ? -69.76 -173.17 125 11 PRO A 61 ? ? -69.70 -87.88 126 11 PRO A 64 ? ? -69.77 95.00 127 11 GLU A 73 ? ? -87.92 -73.40 128 11 THR A 89 ? ? -175.41 128.75 129 11 PHE A 117 ? ? -103.74 41.17 130 11 ASN A 118 ? ? 9.27 42.31 131 11 PHE A 119 ? ? -59.86 96.47 132 11 HIS A 120 ? ? -107.69 53.38 133 11 TYR A 135 ? ? -51.55 109.17 134 11 GLN A 148 ? ? -53.99 176.41 135 11 GLU A 163 ? ? -88.96 -71.13 136 12 THR A 24 ? ? 46.72 74.46 137 12 PRO A 32 ? ? -69.82 -176.68 138 12 PRO A 61 ? ? -69.82 -87.26 139 12 PRO A 64 ? ? -69.70 99.78 140 12 GLU A 73 ? ? -101.94 -86.23 141 12 SER A 74 ? ? -174.13 143.60 142 12 THR A 89 ? ? -174.49 138.91 143 12 PHE A 117 ? ? -102.49 41.06 144 12 ASN A 118 ? ? 8.46 43.15 145 12 PHE A 119 ? ? -59.03 97.40 146 12 HIS A 120 ? ? -107.86 54.68 147 12 ASN A 140 ? ? -171.15 110.10 148 12 GLN A 148 ? ? -53.45 175.25 149 12 LEU A 162 ? ? -77.91 -72.17 150 13 PRO A 32 ? ? -69.75 -177.64 151 13 PRO A 61 ? ? -69.77 -87.75 152 13 PRO A 64 ? ? -69.74 93.16 153 13 GLU A 73 ? ? -111.84 -78.98 154 13 SER A 74 ? ? -176.01 138.07 155 13 THR A 89 ? ? -173.74 124.71 156 13 PHE A 117 ? ? -102.97 40.99 157 13 ASN A 118 ? ? 8.90 42.73 158 13 PHE A 119 ? ? -60.61 96.09 159 13 HIS A 120 ? ? -108.57 64.43 160 13 CYS A 133 ? ? -104.58 76.52 161 13 HIS A 137 ? ? -55.62 -77.93 162 13 GLU A 144 ? ? -176.99 128.27 163 13 GLN A 148 ? ? -52.06 172.76 164 14 THR A 24 ? ? -117.06 74.23 165 14 PRO A 32 ? ? -69.73 -175.90 166 14 PRO A 61 ? ? -69.72 -88.58 167 14 PRO A 64 ? ? -69.81 94.28 168 14 GLU A 73 ? ? -72.85 -160.68 169 14 THR A 89 ? ? -174.37 132.34 170 14 PHE A 117 ? ? -102.88 41.12 171 14 ASN A 118 ? ? 9.10 42.49 172 14 PHE A 119 ? ? -60.45 95.84 173 14 HIS A 120 ? ? -109.11 64.44 174 14 GLN A 148 ? ? -55.51 179.53 175 15 THR A 24 ? ? 46.86 73.91 176 15 PRO A 32 ? ? -69.78 -178.03 177 15 PRO A 61 ? ? -69.74 -88.16 178 15 PRO A 64 ? ? -69.79 95.54 179 15 GLU A 73 ? ? -110.91 -74.48 180 15 THR A 89 ? ? -170.92 124.51 181 15 PHE A 117 ? ? -101.63 41.08 182 15 ASN A 118 ? ? 8.97 42.73 183 15 PHE A 119 ? ? -59.50 96.62 184 15 HIS A 120 ? ? -108.94 64.57 185 15 TYR A 135 ? ? -51.38 109.18 186 15 ASN A 140 ? ? -116.78 74.38 187 15 ARG A 143 ? ? -93.21 -65.06 188 15 GLN A 148 ? ? -52.56 173.84 189 15 LEU A 162 ? ? -172.81 102.80 190 16 PRO A 32 ? ? -69.71 -175.88 191 16 PRO A 61 ? ? -69.80 -88.94 192 16 PRO A 64 ? ? -69.76 96.79 193 16 GLU A 73 ? ? -104.95 -85.67 194 16 THR A 89 ? ? -173.69 125.54 195 16 LEU A 103 ? ? -115.08 57.79 196 16 PHE A 117 ? ? -103.67 41.32 197 16 ASN A 118 ? ? 8.86 42.57 198 16 PHE A 119 ? ? -60.02 96.39 199 16 HIS A 120 ? ? -108.84 64.55 200 16 GLU A 144 ? ? -102.27 -71.14 201 16 GLN A 148 ? ? -53.18 176.61 202 16 LEU A 162 ? ? -168.92 103.27 203 17 PRO A 32 ? ? -69.82 -177.37 204 17 PRO A 61 ? ? -69.80 -88.33 205 17 PRO A 64 ? ? -69.74 93.94 206 17 GLU A 73 ? ? -80.42 -157.69 207 17 THR A 89 ? ? -171.82 133.49 208 17 PHE A 117 ? ? -102.08 41.11 209 17 ASN A 118 ? ? 9.89 42.24 210 17 PHE A 119 ? ? -61.07 92.96 211 17 HIS A 120 ? ? -106.68 45.28 212 17 GLN A 148 ? ? -53.28 176.34 213 17 ALA A 159 ? ? -151.44 64.84 214 18 THR A 24 ? ? 62.67 155.14 215 18 PRO A 25 ? ? -69.71 89.05 216 18 PRO A 32 ? ? -69.74 -178.96 217 18 PRO A 61 ? ? -69.80 -89.16 218 18 PRO A 64 ? ? -69.76 96.04 219 18 GLU A 73 ? ? -104.01 -83.87 220 18 THR A 89 ? ? -172.21 123.48 221 18 PHE A 117 ? ? -102.99 41.27 222 18 ASN A 118 ? ? 9.00 42.88 223 18 PHE A 119 ? ? -60.79 92.76 224 18 HIS A 120 ? ? -105.57 46.58 225 18 TYR A 135 ? ? -50.81 108.77 226 18 VAL A 139 ? ? 36.98 44.00 227 18 GLN A 148 ? ? -52.79 173.96 228 18 LEU A 162 ? ? -97.54 39.39 229 19 THR A 24 ? ? 46.82 74.61 230 19 PRO A 32 ? ? -69.77 -174.26 231 19 PRO A 61 ? ? -69.80 -87.97 232 19 PRO A 64 ? ? -69.74 94.59 233 19 GLU A 73 ? ? -104.85 -82.50 234 19 SER A 74 ? ? -173.45 145.27 235 19 PHE A 117 ? ? -101.27 41.13 236 19 ASN A 118 ? ? 9.37 42.97 237 19 PHE A 119 ? ? -59.65 92.99 238 19 HIS A 120 ? ? -108.04 64.03 239 19 CYS A 133 ? ? -102.39 75.92 240 19 GLN A 148 ? ? -53.31 175.68 241 19 ALA A 159 ? ? -151.14 65.89 242 20 PRO A 32 ? ? -69.74 -177.27 243 20 PRO A 61 ? ? -69.74 -89.12 244 20 PRO A 64 ? ? -69.75 99.99 245 20 ARG A 67 ? ? -77.79 -169.01 246 20 GLU A 73 ? ? -107.03 -82.00 247 20 THR A 89 ? ? -173.52 127.79 248 20 PHE A 117 ? ? -103.23 41.31 249 20 ASN A 118 ? ? 8.49 43.26 250 20 PHE A 119 ? ? -60.28 96.26 251 20 HIS A 120 ? ? -108.58 64.39 252 20 TYR A 135 ? ? -50.89 108.75 253 20 HIS A 137 ? ? -58.47 179.80 254 20 VAL A 139 ? ? -174.76 137.91 255 20 GLN A 148 ? ? -53.18 177.89 256 20 LEU A 162 ? ? -173.80 108.65 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 165 ? A HIS 143 2 1 Y 1 A HIS 166 ? A HIS 144 3 1 Y 1 A HIS 167 ? A HIS 145 4 1 Y 1 A HIS 168 ? A HIS 146 5 1 Y 1 A HIS 169 ? A HIS 147 6 2 Y 1 A HIS 165 ? A HIS 143 7 2 Y 1 A HIS 166 ? A HIS 144 8 2 Y 1 A HIS 167 ? A HIS 145 9 2 Y 1 A HIS 168 ? A HIS 146 10 2 Y 1 A HIS 169 ? A HIS 147 11 3 Y 1 A HIS 165 ? A HIS 143 12 3 Y 1 A HIS 166 ? A HIS 144 13 3 Y 1 A HIS 167 ? A HIS 145 14 3 Y 1 A HIS 168 ? A HIS 146 15 3 Y 1 A HIS 169 ? A HIS 147 16 4 Y 1 A HIS 165 ? A HIS 143 17 4 Y 1 A HIS 166 ? A HIS 144 18 4 Y 1 A HIS 167 ? A HIS 145 19 4 Y 1 A HIS 168 ? A HIS 146 20 4 Y 1 A HIS 169 ? A HIS 147 21 5 Y 1 A HIS 165 ? A HIS 143 22 5 Y 1 A HIS 166 ? A HIS 144 23 5 Y 1 A HIS 167 ? A HIS 145 24 5 Y 1 A HIS 168 ? A HIS 146 25 5 Y 1 A HIS 169 ? A HIS 147 26 6 Y 1 A HIS 165 ? A HIS 143 27 6 Y 1 A HIS 166 ? A HIS 144 28 6 Y 1 A HIS 167 ? A HIS 145 29 6 Y 1 A HIS 168 ? A HIS 146 30 6 Y 1 A HIS 169 ? A HIS 147 31 7 Y 1 A HIS 165 ? A HIS 143 32 7 Y 1 A HIS 166 ? A HIS 144 33 7 Y 1 A HIS 167 ? A HIS 145 34 7 Y 1 A HIS 168 ? A HIS 146 35 7 Y 1 A HIS 169 ? A HIS 147 36 8 Y 1 A HIS 165 ? A HIS 143 37 8 Y 1 A HIS 166 ? A HIS 144 38 8 Y 1 A HIS 167 ? A HIS 145 39 8 Y 1 A HIS 168 ? A HIS 146 40 8 Y 1 A HIS 169 ? A HIS 147 41 9 Y 1 A HIS 165 ? A HIS 143 42 9 Y 1 A HIS 166 ? A HIS 144 43 9 Y 1 A HIS 167 ? A HIS 145 44 9 Y 1 A HIS 168 ? A HIS 146 45 9 Y 1 A HIS 169 ? A HIS 147 46 10 Y 1 A HIS 165 ? A HIS 143 47 10 Y 1 A HIS 166 ? A HIS 144 48 10 Y 1 A HIS 167 ? A HIS 145 49 10 Y 1 A HIS 168 ? A HIS 146 50 10 Y 1 A HIS 169 ? A HIS 147 51 11 Y 1 A HIS 165 ? A HIS 143 52 11 Y 1 A HIS 166 ? A HIS 144 53 11 Y 1 A HIS 167 ? A HIS 145 54 11 Y 1 A HIS 168 ? A HIS 146 55 11 Y 1 A HIS 169 ? A HIS 147 56 12 Y 1 A HIS 165 ? A HIS 143 57 12 Y 1 A HIS 166 ? A HIS 144 58 12 Y 1 A HIS 167 ? A HIS 145 59 12 Y 1 A HIS 168 ? A HIS 146 60 12 Y 1 A HIS 169 ? A HIS 147 61 13 Y 1 A HIS 165 ? A HIS 143 62 13 Y 1 A HIS 166 ? A HIS 144 63 13 Y 1 A HIS 167 ? A HIS 145 64 13 Y 1 A HIS 168 ? A HIS 146 65 13 Y 1 A HIS 169 ? A HIS 147 66 14 Y 1 A HIS 165 ? A HIS 143 67 14 Y 1 A HIS 166 ? A HIS 144 68 14 Y 1 A HIS 167 ? A HIS 145 69 14 Y 1 A HIS 168 ? A HIS 146 70 14 Y 1 A HIS 169 ? A HIS 147 71 15 Y 1 A HIS 165 ? A HIS 143 72 15 Y 1 A HIS 166 ? A HIS 144 73 15 Y 1 A HIS 167 ? A HIS 145 74 15 Y 1 A HIS 168 ? A HIS 146 75 15 Y 1 A HIS 169 ? A HIS 147 76 16 Y 1 A HIS 165 ? A HIS 143 77 16 Y 1 A HIS 166 ? A HIS 144 78 16 Y 1 A HIS 167 ? A HIS 145 79 16 Y 1 A HIS 168 ? A HIS 146 80 16 Y 1 A HIS 169 ? A HIS 147 81 17 Y 1 A HIS 165 ? A HIS 143 82 17 Y 1 A HIS 166 ? A HIS 144 83 17 Y 1 A HIS 167 ? A HIS 145 84 17 Y 1 A HIS 168 ? A HIS 146 85 17 Y 1 A HIS 169 ? A HIS 147 86 18 Y 1 A HIS 165 ? A HIS 143 87 18 Y 1 A HIS 166 ? A HIS 144 88 18 Y 1 A HIS 167 ? A HIS 145 89 18 Y 1 A HIS 168 ? A HIS 146 90 18 Y 1 A HIS 169 ? A HIS 147 91 19 Y 1 A HIS 165 ? A HIS 143 92 19 Y 1 A HIS 166 ? A HIS 144 93 19 Y 1 A HIS 167 ? A HIS 145 94 19 Y 1 A HIS 168 ? A HIS 146 95 19 Y 1 A HIS 169 ? A HIS 147 96 20 Y 1 A HIS 165 ? A HIS 143 97 20 Y 1 A HIS 166 ? A HIS 144 98 20 Y 1 A HIS 167 ? A HIS 145 99 20 Y 1 A HIS 168 ? A HIS 146 100 20 Y 1 A HIS 169 ? A HIS 147 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Novo Nordisk Foundation' Denmark NNF18OC0053172 1 'Novo Nordisk Foundation' Denmark NNF16OC0022788 2 # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'light scattering' ? 2 1 'gel filtration' ? #