data_7BCV # _entry.id 7BCV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.361 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7BCV pdb_00007bcv 10.2210/pdb7bcv/pdb WWPDB D_1292113152 ? ? EMDB EMD-12144 ? ? # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'Brevibacterium linens encapsulin structure' _pdbx_database_related.db_id EMD-12144 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7BCV _pdbx_database_status.recvd_initial_deposition_date 2020-12-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Allende-Ballestero, C.' 1 ? 'Luque, D.' 2 0000-0002-0151-6020 'Klem, R.' 3 ? 'Cornelissen, J.J.L.M.' 4 ? 'Caston, J.R.' 5 0000-0003-2350-9048 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Three-dimensional cryoEM structure of Brevibacterium linens encapsulin' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Allende-Ballestero, C.' 1 ? primary 'Luque, D.' 2 0000-0002-0151-6020 primary 'Klem, R.' 3 ? primary 'Cornelissen, J.J.L.M.' 4 ? primary 'Caston, J.R.' 5 0000-0003-2350-9048 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7BCV _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7BCV _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Linocin-M18 _entity.formula_weight 28590.695 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.4.-.- _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Encapsulin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VNNLYRELAPIPGPAWAEIEEEARRTFKRNIAGRRIVDVAGPTGFETSAVTTGHIRDVQSETSGLQVKQRIVQEYIELRT PFTVTRQAIDDVARGSGDSDWQPVKDAATTIAMAEDRAILHGLDAAGIGGIVPGSSNAAVAIPDAVEDFADAVAQALSVL RTVGVDGPYSLLLSSAEYTKVSESTDHGYPIREHLSRQLGAGEIIWAPALEGALLVSTRGGDYELHLGQDLSIGYYSHDS ETVELYLQETFGFLALTDESSVPLSL ; _entity_poly.pdbx_seq_one_letter_code_can ;VNNLYRELAPIPGPAWAEIEEEARRTFKRNIAGRRIVDVAGPTGFETSAVTTGHIRDVQSETSGLQVKQRIVQEYIELRT PFTVTRQAIDDVARGSGDSDWQPVKDAATTIAMAEDRAILHGLDAAGIGGIVPGSSNAAVAIPDAVEDFADAVAQALSVL RTVGVDGPYSLLLSSAEYTKVSESTDHGYPIREHLSRQLGAGEIIWAPALEGALLVSTRGGDYELHLGQDLSIGYYSHDS ETVELYLQETFGFLALTDESSVPLSL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 ASN n 1 3 ASN n 1 4 LEU n 1 5 TYR n 1 6 ARG n 1 7 GLU n 1 8 LEU n 1 9 ALA n 1 10 PRO n 1 11 ILE n 1 12 PRO n 1 13 GLY n 1 14 PRO n 1 15 ALA n 1 16 TRP n 1 17 ALA n 1 18 GLU n 1 19 ILE n 1 20 GLU n 1 21 GLU n 1 22 GLU n 1 23 ALA n 1 24 ARG n 1 25 ARG n 1 26 THR n 1 27 PHE n 1 28 LYS n 1 29 ARG n 1 30 ASN n 1 31 ILE n 1 32 ALA n 1 33 GLY n 1 34 ARG n 1 35 ARG n 1 36 ILE n 1 37 VAL n 1 38 ASP n 1 39 VAL n 1 40 ALA n 1 41 GLY n 1 42 PRO n 1 43 THR n 1 44 GLY n 1 45 PHE n 1 46 GLU n 1 47 THR n 1 48 SER n 1 49 ALA n 1 50 VAL n 1 51 THR n 1 52 THR n 1 53 GLY n 1 54 HIS n 1 55 ILE n 1 56 ARG n 1 57 ASP n 1 58 VAL n 1 59 GLN n 1 60 SER n 1 61 GLU n 1 62 THR n 1 63 SER n 1 64 GLY n 1 65 LEU n 1 66 GLN n 1 67 VAL n 1 68 LYS n 1 69 GLN n 1 70 ARG n 1 71 ILE n 1 72 VAL n 1 73 GLN n 1 74 GLU n 1 75 TYR n 1 76 ILE n 1 77 GLU n 1 78 LEU n 1 79 ARG n 1 80 THR n 1 81 PRO n 1 82 PHE n 1 83 THR n 1 84 VAL n 1 85 THR n 1 86 ARG n 1 87 GLN n 1 88 ALA n 1 89 ILE n 1 90 ASP n 1 91 ASP n 1 92 VAL n 1 93 ALA n 1 94 ARG n 1 95 GLY n 1 96 SER n 1 97 GLY n 1 98 ASP n 1 99 SER n 1 100 ASP n 1 101 TRP n 1 102 GLN n 1 103 PRO n 1 104 VAL n 1 105 LYS n 1 106 ASP n 1 107 ALA n 1 108 ALA n 1 109 THR n 1 110 THR n 1 111 ILE n 1 112 ALA n 1 113 MET n 1 114 ALA n 1 115 GLU n 1 116 ASP n 1 117 ARG n 1 118 ALA n 1 119 ILE n 1 120 LEU n 1 121 HIS n 1 122 GLY n 1 123 LEU n 1 124 ASP n 1 125 ALA n 1 126 ALA n 1 127 GLY n 1 128 ILE n 1 129 GLY n 1 130 GLY n 1 131 ILE n 1 132 VAL n 1 133 PRO n 1 134 GLY n 1 135 SER n 1 136 SER n 1 137 ASN n 1 138 ALA n 1 139 ALA n 1 140 VAL n 1 141 ALA n 1 142 ILE n 1 143 PRO n 1 144 ASP n 1 145 ALA n 1 146 VAL n 1 147 GLU n 1 148 ASP n 1 149 PHE n 1 150 ALA n 1 151 ASP n 1 152 ALA n 1 153 VAL n 1 154 ALA n 1 155 GLN n 1 156 ALA n 1 157 LEU n 1 158 SER n 1 159 VAL n 1 160 LEU n 1 161 ARG n 1 162 THR n 1 163 VAL n 1 164 GLY n 1 165 VAL n 1 166 ASP n 1 167 GLY n 1 168 PRO n 1 169 TYR n 1 170 SER n 1 171 LEU n 1 172 LEU n 1 173 LEU n 1 174 SER n 1 175 SER n 1 176 ALA n 1 177 GLU n 1 178 TYR n 1 179 THR n 1 180 LYS n 1 181 VAL n 1 182 SER n 1 183 GLU n 1 184 SER n 1 185 THR n 1 186 ASP n 1 187 HIS n 1 188 GLY n 1 189 TYR n 1 190 PRO n 1 191 ILE n 1 192 ARG n 1 193 GLU n 1 194 HIS n 1 195 LEU n 1 196 SER n 1 197 ARG n 1 198 GLN n 1 199 LEU n 1 200 GLY n 1 201 ALA n 1 202 GLY n 1 203 GLU n 1 204 ILE n 1 205 ILE n 1 206 TRP n 1 207 ALA n 1 208 PRO n 1 209 ALA n 1 210 LEU n 1 211 GLU n 1 212 GLY n 1 213 ALA n 1 214 LEU n 1 215 LEU n 1 216 VAL n 1 217 SER n 1 218 THR n 1 219 ARG n 1 220 GLY n 1 221 GLY n 1 222 ASP n 1 223 TYR n 1 224 GLU n 1 225 LEU n 1 226 HIS n 1 227 LEU n 1 228 GLY n 1 229 GLN n 1 230 ASP n 1 231 LEU n 1 232 SER n 1 233 ILE n 1 234 GLY n 1 235 TYR n 1 236 TYR n 1 237 SER n 1 238 HIS n 1 239 ASP n 1 240 SER n 1 241 GLU n 1 242 THR n 1 243 VAL n 1 244 GLU n 1 245 LEU n 1 246 TYR n 1 247 LEU n 1 248 GLN n 1 249 GLU n 1 250 THR n 1 251 PHE n 1 252 GLY n 1 253 PHE n 1 254 LEU n 1 255 ALA n 1 256 LEU n 1 257 THR n 1 258 ASP n 1 259 GLU n 1 260 SER n 1 261 SER n 1 262 VAL n 1 263 PRO n 1 264 LEU n 1 265 SER n 1 266 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 266 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene lin _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Brevibacterium linens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1703 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LIN18_BRELN _struct_ref.pdbx_db_accession Q45296 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NNLYRELAPIPGPAWAEIEEEARRTFKRNIAGRRIVDVAGPTGFETSAVTTGHIRDVQSETSGLQVKQRIVQEYIELRTP FTVTRQAIDDVARGSGDSDWQPVKDAATTIAMAEDRAILHGLDAAGIGGIVPGSSNAAVAIPDAVEDFADAVAQALSVLR TVGVDGPYSLLLSSAEYTKVSESTDHGYPIREHLSRQLGAGEIIWAPALEGALLVSTRGGDYELHLGQDLSIGYYSHDSE TVELYLQETFGFLALTDESSVPLSL ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7BCV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 266 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q45296 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 266 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 266 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7BCV _struct_ref_seq_dif.mon_id VAL _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q45296 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7BCV _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _struct.entry_id 7BCV _struct.title 'Brevibacterium linens encapsulin structure' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7BCV _struct_keywords.text 'Bacterial protein compartment, STRUCTURAL PROTEIN' _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TYR A 5 ? ALA A 9 ? TYR A 5 ALA A 9 5 ? 5 HELX_P HELX_P2 AA2 PRO A 12 ? ILE A 31 ? PRO A 12 ILE A 31 1 ? 20 HELX_P HELX_P3 AA3 ALA A 32 ? ILE A 36 ? ALA A 32 ILE A 36 5 ? 5 HELX_P HELX_P4 AA4 ARG A 86 ? ALA A 93 ? ARG A 86 ALA A 93 1 ? 8 HELX_P HELX_P5 AA5 TRP A 101 ? GLY A 122 ? TRP A 101 GLY A 122 1 ? 22 HELX_P HELX_P6 AA6 ALA A 145 ? GLU A 147 ? ALA A 145 GLU A 147 5 ? 3 HELX_P HELX_P7 AA7 ASP A 148 ? VAL A 163 ? ASP A 148 VAL A 163 1 ? 16 HELX_P HELX_P8 AA8 SER A 174 ? GLU A 183 ? SER A 174 GLU A 183 1 ? 10 HELX_P HELX_P9 AA9 PRO A 190 ? GLY A 200 ? PRO A 190 GLY A 200 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? AA3 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 38 ? ALA A 40 ? ASP A 38 ALA A 40 AA1 2 TYR A 223 ? HIS A 238 ? TYR A 223 HIS A 238 AA1 3 THR A 242 ? ALA A 255 ? THR A 242 ALA A 255 AA1 4 ILE A 76 ? THR A 85 ? ILE A 76 THR A 85 AA2 1 ALA A 49 ? VAL A 58 ? ALA A 49 VAL A 58 AA2 2 VAL A 67 ? GLU A 74 ? VAL A 67 GLU A 74 AA3 1 VAL A 140 ? ALA A 141 ? VAL A 140 ALA A 141 AA3 2 SER A 261 ? SER A 265 ? SER A 261 SER A 265 AA3 3 ALA A 213 ? SER A 217 ? ALA A 213 SER A 217 AA3 4 TYR A 169 ? LEU A 173 ? TYR A 169 LEU A 173 AA3 5 ILE A 204 ? TRP A 206 ? ILE A 204 TRP A 206 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 38 ? N ASP A 38 O LEU A 225 ? O LEU A 225 AA1 2 3 N SER A 237 ? N SER A 237 O GLU A 244 ? O GLU A 244 AA1 3 4 O VAL A 243 ? O VAL A 243 N VAL A 84 ? N VAL A 84 AA2 1 2 N VAL A 50 ? N VAL A 50 O GLN A 73 ? O GLN A 73 AA3 1 2 N VAL A 140 ? N VAL A 140 O PRO A 263 ? O PRO A 263 AA3 2 3 O LEU A 264 ? O LEU A 264 N ALA A 213 ? N ALA A 213 AA3 3 4 O LEU A 214 ? O LEU A 214 N LEU A 172 ? N LEU A 172 AA3 4 5 N LEU A 173 ? N LEU A 173 O ILE A 205 ? O ILE A 205 # _atom_sites.entry_id 7BCV _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 TRP 101 101 101 TRP TRP A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 MET 113 113 113 MET MET A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 HIS 121 121 121 HIS HIS A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 SER 135 135 135 SER SER A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 PHE 149 149 149 PHE PHE A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ARG 161 161 161 ARG ARG A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 VAL 163 163 163 VAL VAL A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 PRO 168 168 168 PRO PRO A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 TYR 178 178 178 TYR TYR A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 LYS 180 180 180 LYS LYS A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 SER 182 182 182 SER SER A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 SER 184 184 184 SER SER A . n A 1 185 THR 185 185 185 THR THR A . n A 1 186 ASP 186 186 186 ASP ASP A . n A 1 187 HIS 187 187 187 HIS HIS A . n A 1 188 GLY 188 188 188 GLY GLY A . n A 1 189 TYR 189 189 189 TYR TYR A . n A 1 190 PRO 190 190 190 PRO PRO A . n A 1 191 ILE 191 191 191 ILE ILE A . n A 1 192 ARG 192 192 192 ARG ARG A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 HIS 194 194 194 HIS HIS A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 ARG 197 197 197 ARG ARG A . n A 1 198 GLN 198 198 198 GLN GLN A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 GLY 200 200 200 GLY GLY A . n A 1 201 ALA 201 201 201 ALA ALA A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 ILE 204 204 204 ILE ILE A . n A 1 205 ILE 205 205 205 ILE ILE A . n A 1 206 TRP 206 206 206 TRP TRP A . n A 1 207 ALA 207 207 207 ALA ALA A . n A 1 208 PRO 208 208 208 PRO PRO A . n A 1 209 ALA 209 209 209 ALA ALA A . n A 1 210 LEU 210 210 210 LEU LEU A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 GLY 212 212 212 GLY GLY A . n A 1 213 ALA 213 213 213 ALA ALA A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 VAL 216 216 216 VAL VAL A . n A 1 217 SER 217 217 217 SER SER A . n A 1 218 THR 218 218 218 THR THR A . n A 1 219 ARG 219 219 219 ARG ARG A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 GLY 221 221 221 GLY GLY A . n A 1 222 ASP 222 222 222 ASP ASP A . n A 1 223 TYR 223 223 223 TYR TYR A . n A 1 224 GLU 224 224 224 GLU GLU A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 HIS 226 226 226 HIS HIS A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 GLY 228 228 228 GLY GLY A . n A 1 229 GLN 229 229 229 GLN GLN A . n A 1 230 ASP 230 230 230 ASP ASP A . n A 1 231 LEU 231 231 231 LEU LEU A . n A 1 232 SER 232 232 232 SER SER A . n A 1 233 ILE 233 233 233 ILE ILE A . n A 1 234 GLY 234 234 234 GLY GLY A . n A 1 235 TYR 235 235 235 TYR TYR A . n A 1 236 TYR 236 236 236 TYR TYR A . n A 1 237 SER 237 237 237 SER SER A . n A 1 238 HIS 238 238 238 HIS HIS A . n A 1 239 ASP 239 239 239 ASP ASP A . n A 1 240 SER 240 240 240 SER SER A . n A 1 241 GLU 241 241 241 GLU GLU A . n A 1 242 THR 242 242 242 THR THR A . n A 1 243 VAL 243 243 243 VAL VAL A . n A 1 244 GLU 244 244 244 GLU GLU A . n A 1 245 LEU 245 245 245 LEU LEU A . n A 1 246 TYR 246 246 246 TYR TYR A . n A 1 247 LEU 247 247 247 LEU LEU A . n A 1 248 GLN 248 248 248 GLN GLN A . n A 1 249 GLU 249 249 249 GLU GLU A . n A 1 250 THR 250 250 250 THR THR A . n A 1 251 PHE 251 251 251 PHE PHE A . n A 1 252 GLY 252 252 252 GLY GLY A . n A 1 253 PHE 253 253 253 PHE PHE A . n A 1 254 LEU 254 254 254 LEU LEU A . n A 1 255 ALA 255 255 255 ALA ALA A . n A 1 256 LEU 256 256 256 LEU LEU A . n A 1 257 THR 257 257 257 THR THR A . n A 1 258 ASP 258 258 258 ASP ASP A . n A 1 259 GLU 259 259 259 GLU GLU A . n A 1 260 SER 260 260 260 SER SER A . n A 1 261 SER 261 261 261 SER SER A . n A 1 262 VAL 262 262 262 VAL VAL A . n A 1 263 PRO 263 263 263 PRO PRO A . n A 1 264 LEU 264 264 264 LEU LEU A . n A 1 265 SER 265 265 265 SER SER A . n A 1 266 LEU 266 266 266 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details 60-MERIC _pdbx_struct_assembly.oligomeric_count 60 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression ;1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54,55,56,57,58,59,60 ; _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.000000 0.000000 0.000000 0.00000 0.000000 1.000000 0.000000 0.00000 0.000000 0.000000 1.000000 0.00000 2 'point symmetry operation' ? ? 0.500000 -0.809017 0.309017 0.00000 0.809017 0.309017 -0.500000 0.00000 0.309017 0.500000 0.809017 0.00000 3 'point symmetry operation' ? ? -0.309017 -0.500000 0.809017 0.00000 0.500000 -0.809017 -0.309017 0.00000 0.809017 0.309017 0.500000 0.00000 4 'point symmetry operation' ? ? -0.309017 0.500000 0.809017 0.00000 -0.500000 -0.809017 0.309017 0.00000 0.809017 -0.309017 0.500000 0.00000 5 'point symmetry operation' ? ? 0.500000 0.809017 0.309017 0.00000 -0.809017 0.309017 0.500000 0.00000 0.309017 -0.500000 0.809017 0.00000 6 'point symmetry operation' ? ? -0.809017 0.309017 0.500000 0.00000 0.309017 -0.500000 0.809017 0.00000 0.500000 0.809017 0.309017 0.00000 7 'point symmetry operation' ? ? 0.000000 1.000000 0.000000 0.00000 0.000000 0.000000 1.000000 0.00000 1.000000 0.000000 0.000000 0.00000 8 'point symmetry operation' ? ? 0.809017 0.309017 -0.500000 0.00000 0.309017 0.500000 0.809017 0.00000 0.500000 -0.809017 0.309017 0.00000 9 'point symmetry operation' ? ? 0.500000 -0.809017 -0.309017 0.00000 0.809017 0.309017 0.500000 0.00000 -0.309017 -0.500000 0.809017 0.00000 10 'point symmetry operation' ? ? -0.500000 -0.809017 0.309017 0.00000 0.809017 -0.309017 0.500000 0.00000 -0.309017 0.500000 0.809017 0.00000 11 'point symmetry operation' ? ? -0.500000 -0.809017 0.309017 0.00000 -0.809017 0.309017 -0.500000 0.00000 0.309017 -0.500000 -0.809017 0.00000 12 'point symmetry operation' ? ? -0.809017 0.309017 0.500000 0.00000 -0.309017 0.500000 -0.809017 0.00000 -0.500000 -0.809017 -0.309017 0.00000 13 'point symmetry operation' ? ? 0.000000 1.000000 0.000000 0.00000 0.000000 0.000000 -1.000000 0.00000 -1.000000 0.000000 0.000000 0.00000 14 'point symmetry operation' ? ? 0.809017 0.309017 -0.500000 0.00000 -0.309017 -0.500000 -0.809017 0.00000 -0.500000 0.809017 -0.309017 0.00000 15 'point symmetry operation' ? ? 0.500000 -0.809017 -0.309017 0.00000 -0.809017 -0.309017 -0.500000 0.00000 0.309017 0.500000 -0.809017 0.00000 16 'point symmetry operation' ? ? 0.309017 0.500000 -0.809017 0.00000 0.500000 -0.809017 -0.309017 0.00000 -0.809017 -0.309017 -0.500000 0.00000 17 'point symmetry operation' ? ? 0.309017 -0.500000 -0.809017 0.00000 -0.500000 -0.809017 0.309017 0.00000 -0.809017 0.309017 -0.500000 0.00000 18 'point symmetry operation' ? ? -0.500000 -0.809017 -0.309017 0.00000 -0.809017 0.309017 0.500000 0.00000 -0.309017 0.500000 -0.809017 0.00000 19 'point symmetry operation' ? ? -1.000000 0.000000 0.000000 0.00000 0.000000 1.000000 0.000000 0.00000 0.000000 0.000000 -1.000000 0.00000 20 'point symmetry operation' ? ? -0.500000 0.809017 -0.309017 0.00000 0.809017 0.309017 -0.500000 0.00000 -0.309017 -0.500000 -0.809017 0.00000 21 'point symmetry operation' ? ? -0.500000 -0.809017 -0.309017 0.00000 0.809017 -0.309017 -0.500000 0.00000 0.309017 -0.500000 0.809017 0.00000 22 'point symmetry operation' ? ? -1.000000 0.000000 0.000000 0.00000 0.000000 -1.000000 0.000000 0.00000 0.000000 0.000000 1.000000 0.00000 23 'point symmetry operation' ? ? -0.500000 0.809017 -0.309017 0.00000 -0.809017 -0.309017 0.500000 0.00000 0.309017 0.500000 0.809017 0.00000 24 'point symmetry operation' ? ? 0.309017 0.500000 -0.809017 0.00000 -0.500000 0.809017 0.309017 0.00000 0.809017 0.309017 0.500000 0.00000 25 'point symmetry operation' ? ? 0.309017 -0.500000 -0.809017 0.00000 0.500000 0.809017 -0.309017 0.00000 0.809017 -0.309017 0.500000 0.00000 26 'point symmetry operation' ? ? 0.000000 0.000000 -1.000000 0.00000 -1.000000 0.000000 0.000000 0.00000 0.000000 1.000000 0.000000 0.00000 27 'point symmetry operation' ? ? -0.309017 -0.500000 -0.809017 0.00000 -0.500000 0.809017 -0.309017 0.00000 0.809017 0.309017 -0.500000 0.00000 28 'point symmetry operation' ? ? -0.809017 -0.309017 -0.500000 0.00000 0.309017 0.500000 -0.809017 0.00000 0.500000 -0.809017 -0.309017 0.00000 29 'point symmetry operation' ? ? -0.809017 0.309017 -0.500000 0.00000 0.309017 -0.500000 -0.809017 0.00000 -0.500000 -0.809017 0.309017 0.00000 30 'point symmetry operation' ? ? -0.309017 0.500000 -0.809017 0.00000 -0.500000 -0.809017 -0.309017 0.00000 -0.809017 0.309017 0.500000 0.00000 31 'point symmetry operation' ? ? 0.809017 0.309017 0.500000 0.00000 -0.309017 -0.500000 0.809017 0.00000 0.500000 -0.809017 -0.309017 0.00000 32 'point symmetry operation' ? ? 0.809017 -0.309017 0.500000 0.00000 -0.309017 0.500000 0.809017 0.00000 -0.500000 -0.809017 0.309017 0.00000 33 'point symmetry operation' ? ? 0.309017 -0.500000 0.809017 0.00000 0.500000 0.809017 0.309017 0.00000 -0.809017 0.309017 0.500000 0.00000 34 'point symmetry operation' ? ? 0.000000 0.000000 1.000000 0.00000 1.000000 0.000000 0.000000 0.00000 0.000000 1.000000 0.000000 0.00000 35 'point symmetry operation' ? ? 0.309017 0.500000 0.809017 0.00000 0.500000 -0.809017 0.309017 0.00000 0.809017 0.309017 -0.500000 0.00000 36 'point symmetry operation' ? ? -0.309017 0.500000 0.809017 0.00000 0.500000 0.809017 -0.309017 0.00000 -0.809017 0.309017 -0.500000 0.00000 37 'point symmetry operation' ? ? 0.500000 0.809017 0.309017 0.00000 0.809017 -0.309017 -0.500000 0.00000 -0.309017 0.500000 -0.809017 0.00000 38 'point symmetry operation' ? ? 1.000000 0.000000 0.000000 0.00000 0.000000 -1.000000 0.000000 0.00000 0.000000 0.000000 -1.000000 0.00000 39 'point symmetry operation' ? ? 0.500000 -0.809017 0.309017 0.00000 -0.809017 -0.309017 0.500000 0.00000 -0.309017 -0.500000 -0.809017 0.00000 40 'point symmetry operation' ? ? -0.309017 -0.500000 0.809017 0.00000 -0.500000 0.809017 0.309017 0.00000 -0.809017 -0.309017 -0.500000 0.00000 41 'point symmetry operation' ? ? -0.500000 0.809017 0.309017 0.00000 -0.809017 -0.309017 -0.500000 0.00000 -0.309017 -0.500000 0.809017 0.00000 42 'point symmetry operation' ? ? 0.500000 0.809017 -0.309017 0.00000 -0.809017 0.309017 -0.500000 0.00000 -0.309017 0.500000 0.809017 0.00000 43 'point symmetry operation' ? ? 0.809017 -0.309017 -0.500000 0.00000 -0.309017 0.500000 -0.809017 0.00000 0.500000 0.809017 0.309017 0.00000 44 'point symmetry operation' ? ? 0.000000 -1.000000 0.000000 0.00000 0.000000 0.000000 -1.000000 0.00000 1.000000 0.000000 0.000000 0.00000 45 'point symmetry operation' ? ? -0.809017 -0.309017 0.500000 0.00000 -0.309017 -0.500000 -0.809017 0.00000 0.500000 -0.809017 0.309017 0.00000 46 'point symmetry operation' ? ? 0.809017 -0.309017 0.500000 0.00000 0.309017 -0.500000 -0.809017 0.00000 0.500000 0.809017 -0.309017 0.00000 47 'point symmetry operation' ? ? 0.309017 -0.500000 0.809017 0.00000 -0.500000 -0.809017 -0.309017 0.00000 0.809017 -0.309017 -0.500000 0.00000 48 'point symmetry operation' ? ? 0.000000 0.000000 1.000000 0.00000 -1.000000 0.000000 0.000000 0.00000 0.000000 -1.000000 0.000000 0.00000 49 'point symmetry operation' ? ? 0.309017 0.500000 0.809017 0.00000 -0.500000 0.809017 -0.309017 0.00000 -0.809017 -0.309017 0.500000 0.00000 50 'point symmetry operation' ? ? 0.809017 0.309017 0.500000 0.00000 0.309017 0.500000 -0.809017 0.00000 -0.500000 0.809017 0.309017 0.00000 51 'point symmetry operation' ? ? -0.309017 0.500000 -0.809017 0.00000 0.500000 0.809017 0.309017 0.00000 0.809017 -0.309017 -0.500000 0.00000 52 'point symmetry operation' ? ? 0.000000 0.000000 -1.000000 0.00000 1.000000 0.000000 0.000000 0.00000 0.000000 -1.000000 0.000000 0.00000 53 'point symmetry operation' ? ? -0.309017 -0.500000 -0.809017 0.00000 0.500000 -0.809017 0.309017 0.00000 -0.809017 -0.309017 0.500000 0.00000 54 'point symmetry operation' ? ? -0.809017 -0.309017 -0.500000 0.00000 -0.309017 -0.500000 0.809017 0.00000 -0.500000 0.809017 0.309017 0.00000 55 'point symmetry operation' ? ? -0.809017 0.309017 -0.500000 0.00000 -0.309017 0.500000 0.809017 0.00000 0.500000 0.809017 -0.309017 0.00000 56 'point symmetry operation' ? ? 0.000000 -1.000000 0.000000 0.00000 0.000000 0.000000 1.000000 0.00000 -1.000000 0.000000 0.000000 0.00000 57 'point symmetry operation' ? ? -0.809017 -0.309017 0.500000 0.00000 0.309017 0.500000 0.809017 0.00000 -0.500000 0.809017 -0.309017 0.00000 58 'point symmetry operation' ? ? -0.500000 0.809017 0.309017 0.00000 0.809017 0.309017 0.500000 0.00000 0.309017 0.500000 -0.809017 0.00000 59 'point symmetry operation' ? ? 0.500000 0.809017 -0.309017 0.00000 0.809017 -0.309017 0.500000 0.00000 0.309017 -0.500000 -0.809017 0.00000 60 'point symmetry operation' ? ? 0.809017 -0.309017 -0.500000 0.00000 0.309017 -0.500000 0.809017 0.00000 -0.500000 -0.809017 -0.309017 0.00000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2022-10-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _em_3d_fitting.entry_id 7BCV _em_3d_fitting.id 1 _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_protocol ? _em_3d_fitting.ref_space ? _em_3d_fitting.target_criteria ? _em_3d_fitting.method ? # _em_3d_reconstruction.entry_id 7BCV _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm 'FOURIER SPACE' _em_3d_reconstruction.details ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages 3 _em_3d_reconstruction.num_particles 233829 _em_3d_reconstruction.resolution 2.28 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.symmetry_type POINT _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.details ? _em_buffer.pH 7.5 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details ? _em_entity_assembly.name Encapsulin _em_entity_assembly.source RECOMBINANT _em_entity_assembly.type COMPLEX _em_entity_assembly.entity_id_list 1 _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # _em_imaging.id 1 _em_imaging.entry_id 7BCV _em_imaging.accelerating_voltage 300 _em_imaging.alignment_procedure 'COMA FREE' _em_imaging.c2_aperture_diameter ? _em_imaging.calibrated_defocus_max 3200 _em_imaging.calibrated_defocus_min 1000 _em_imaging.calibrated_magnification ? _em_imaging.cryogen NITROGEN _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs 2.7 _em_imaging.nominal_defocus_max 3200 _em_imaging.nominal_defocus_min 1000 _em_imaging.nominal_magnification ? _em_imaging.recording_temperature_maximum ? _em_imaging.recording_temperature_minimum ? _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model 'FEI TITAN KRIOS AUTOGRID HOLDER' _em_imaging.specimen_id 1 _em_imaging.citation_id ? _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? _em_imaging.specimen_holder_type ? # _em_sample_support.id 1 _em_sample_support.specimen_id 1 _em_sample_support.details ? _em_sample_support.grid_material COPPER/RHODIUM _em_sample_support.grid_mesh_size 400 _em_sample_support.grid_type 'Quantifoil R2/2' _em_sample_support.method ? _em_sample_support.film_material ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature 295 _em_vitrification.cryogen_name ETHANE _em_vitrification.details ? _em_vitrification.humidity 95 _em_vitrification.instrument 'FEI VITROBOT MARK IV' _em_vitrification.entry_id 7BCV _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 7BCV _em_experiment.id 1 _em_experiment.aggregation_state PARTICLE _em_experiment.reconstruction_method 'SINGLE PARTICLE' _em_experiment.entity_assembly_id 1 # _em_single_particle_entity.entry_id 7BCV _em_single_particle_entity.id 1 _em_single_particle_entity.image_processing_id 1 _em_single_particle_entity.point_symmetry I # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 2 ? ? -116.74 -169.26 2 1 ALA A 201 ? ? 78.36 -1.83 3 1 THR A 218 ? ? -95.34 50.03 4 1 ASP A 239 ? ? -125.06 -165.40 # loop_ _em_buffer_component.buffer_id _em_buffer_component.id _em_buffer_component.concentration _em_buffer_component.concentration_units _em_buffer_component.formula _em_buffer_component.name 1 1 20 mM ? Tris 1 2 150 mM ? 'Ammonium Chloride' # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' _em_ctf_correction.details ? # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.experimental_flag NO _em_entity_assembly_molwt.units MEGADALTONS _em_entity_assembly_molwt.value 1.8 # _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.ncbi_tax_id 1703 _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organism 'Brevibacterium linens' _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_entity_assembly_recombinant.id 2 _em_entity_assembly_recombinant.entity_assembly_id 1 _em_entity_assembly_recombinant.cell ? _em_entity_assembly_recombinant.ncbi_tax_id 562 _em_entity_assembly_recombinant.organism 'Escherichia coli' _em_entity_assembly_recombinant.plasmid ? _em_entity_assembly_recombinant.strain ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 38.85 _em_image_recording.average_exposure_time ? _em_image_recording.details ? _em_image_recording.detector_mode COUNTING _em_image_recording.film_or_detector_model 'GATAN K2 SUMMIT (4k x 4k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # _em_particle_selection.id 1 _em_particle_selection.image_processing_id 1 _em_particle_selection.details ? _em_particle_selection.method ? _em_particle_selection.num_particles_selected 309778 _em_particle_selection.reference_model ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'PARTICLE SELECTION' ? Xmipp ? 1 ? ? 2 'IMAGE ACQUISITION' ? EPU ? ? ? 1 3 MASKING ? ? ? ? ? ? 4 'CTF CORRECTION' ? CTFFIND 4 1 ? ? 5 'CTF CORRECTION' ? RELION 3 1 ? ? 6 'LAYERLINE INDEXING' ? ? ? ? ? ? 7 'DIFFRACTION INDEXING' ? ? ? ? ? ? 8 'MODEL FITTING' ? ? ? ? ? ? 9 'MODEL REFINEMENT' ? ? ? ? ? ? 10 OTHER ? ? ? ? ? ? 11 'INITIAL EULER ASSIGNMENT' ? RELION 3 1 ? ? 12 'FINAL EULER ASSIGNMENT' ? RELION 3 1 ? ? 13 CLASSIFICATION ? RELION 3 1 ? ? 14 RECONSTRUCTION ? RELION 3 1 ? ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support microscopy _pdbx_struct_assembly_auth_evidence.details ? #