data_7BGZ # _entry.id 7BGZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7BGZ pdb_00007bgz 10.2210/pdb7bgz/pdb WWPDB D_1292113378 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-01-27 2 'Structure model' 1 1 2021-03-31 3 'Structure model' 1 2 2024-01-31 4 'Structure model' 1 3 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' atom_type 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' database_2 7 3 'Structure model' pdbx_initial_refinement_model 8 4 'Structure model' pdbx_entry_details 9 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 3 'Structure model' '_atom_type.pdbx_N_electrons' 14 3 'Structure model' '_atom_type.pdbx_scat_Z' 15 3 'Structure model' '_database_2.pdbx_DOI' 16 3 'Structure model' '_database_2.pdbx_database_accession' 17 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7BGZ _pdbx_database_status.recvd_initial_deposition_date 2021-01-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Loch, J.I.' 1 0000-0002-7345-4527 'Siuda, M.K.' 2 ? 'Lewinski, K.' 3 0000-0003-3074-7175 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country PL _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Biochim.Pol.' _citation.journal_id_ASTM ABPLAF _citation.journal_id_CSD 1139 _citation.journal_id_ISSN 0001-527X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 68 _citation.language ? _citation.page_first 23 _citation.page_last 28 _citation.title ;Interactions of new lactoglobulin variants with tetracaine: crystallographic studies of ligand binding to lactoglobulin mutants possessing single substitution in the binding pocket. ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.18388/abp.2020_5593 _citation.pdbx_database_id_PubMed 33719368 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Loch, J.' 1 ? primary 'Bonarek, P.' 2 ? primary 'Siuda, M.' 3 ? primary 'Wrobel, P.' 4 ? primary 'Lewinski, K.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Beta-lactoglobulin 18249.037 1 ? 'L1A, I2S, L39K' ? ? 2 non-polymer syn 'DECANOIC ACID' 172.265 1 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 4 water nat water 18.015 49 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Beta-LG # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ASVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPKRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPA VFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQC HI ; _entity_poly.pdbx_seq_one_letter_code_can ;ASVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPKRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPA VFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQC HI ; _entity_poly.pdbx_strand_id AAA _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'DECANOIC ACID' DKA 3 1,2-ETHANEDIOL EDO 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 SER n 1 3 VAL n 1 4 THR n 1 5 GLN n 1 6 THR n 1 7 MET n 1 8 LYS n 1 9 GLY n 1 10 LEU n 1 11 ASP n 1 12 ILE n 1 13 GLN n 1 14 LYS n 1 15 VAL n 1 16 ALA n 1 17 GLY n 1 18 THR n 1 19 TRP n 1 20 TYR n 1 21 SER n 1 22 LEU n 1 23 ALA n 1 24 MET n 1 25 ALA n 1 26 ALA n 1 27 SER n 1 28 ASP n 1 29 ILE n 1 30 SER n 1 31 LEU n 1 32 LEU n 1 33 ASP n 1 34 ALA n 1 35 GLN n 1 36 SER n 1 37 ALA n 1 38 PRO n 1 39 LYS n 1 40 ARG n 1 41 VAL n 1 42 TYR n 1 43 VAL n 1 44 GLU n 1 45 GLU n 1 46 LEU n 1 47 LYS n 1 48 PRO n 1 49 THR n 1 50 PRO n 1 51 GLU n 1 52 GLY n 1 53 ASP n 1 54 LEU n 1 55 GLU n 1 56 ILE n 1 57 LEU n 1 58 LEU n 1 59 GLN n 1 60 LYS n 1 61 TRP n 1 62 GLU n 1 63 ASN n 1 64 GLY n 1 65 GLU n 1 66 CYS n 1 67 ALA n 1 68 GLN n 1 69 LYS n 1 70 LYS n 1 71 ILE n 1 72 ILE n 1 73 ALA n 1 74 GLU n 1 75 LYS n 1 76 THR n 1 77 LYS n 1 78 ILE n 1 79 PRO n 1 80 ALA n 1 81 VAL n 1 82 PHE n 1 83 LYS n 1 84 ILE n 1 85 ASP n 1 86 ALA n 1 87 LEU n 1 88 ASN n 1 89 GLU n 1 90 ASN n 1 91 LYS n 1 92 VAL n 1 93 LEU n 1 94 VAL n 1 95 LEU n 1 96 ASP n 1 97 THR n 1 98 ASP n 1 99 TYR n 1 100 LYS n 1 101 LYS n 1 102 TYR n 1 103 LEU n 1 104 LEU n 1 105 PHE n 1 106 CYS n 1 107 MET n 1 108 GLU n 1 109 ASN n 1 110 SER n 1 111 ALA n 1 112 GLU n 1 113 PRO n 1 114 GLU n 1 115 GLN n 1 116 SER n 1 117 LEU n 1 118 ALA n 1 119 CYS n 1 120 GLN n 1 121 CYS n 1 122 LEU n 1 123 VAL n 1 124 ARG n 1 125 THR n 1 126 PRO n 1 127 GLU n 1 128 VAL n 1 129 ASP n 1 130 ASP n 1 131 GLU n 1 132 ALA n 1 133 LEU n 1 134 GLU n 1 135 LYS n 1 136 PHE n 1 137 ASP n 1 138 LYS n 1 139 ALA n 1 140 LEU n 1 141 LYS n 1 142 ALA n 1 143 LEU n 1 144 PRO n 1 145 MET n 1 146 HIS n 1 147 ILE n 1 148 ARG n 1 149 LEU n 1 150 SER n 1 151 PHE n 1 152 ASN n 1 153 PRO n 1 154 THR n 1 155 GLN n 1 156 LEU n 1 157 GLU n 1 158 GLU n 1 159 GLN n 1 160 CYS n 1 161 HIS n 1 162 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 162 _entity_src_gen.gene_src_common_name cattle _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene LGB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant 'Origami B (DE3)' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-Duet-1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DKA non-polymer . 'DECANOIC ACID' ? 'C10 H20 O2' 172.265 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? AAA . n A 1 2 SER 2 2 ? ? ? AAA . n A 1 3 VAL 3 3 3 VAL VAL AAA . n A 1 4 THR 4 4 4 THR THR AAA . n A 1 5 GLN 5 5 5 GLN GLN AAA . n A 1 6 THR 6 6 6 THR THR AAA . n A 1 7 MET 7 7 7 MET MET AAA . n A 1 8 LYS 8 8 8 LYS LYS AAA . n A 1 9 GLY 9 9 9 GLY GLY AAA . n A 1 10 LEU 10 10 10 LEU LEU AAA . n A 1 11 ASP 11 11 11 ASP ASP AAA . n A 1 12 ILE 12 12 12 ILE ILE AAA . n A 1 13 GLN 13 13 13 GLN GLN AAA . n A 1 14 LYS 14 14 14 LYS LYS AAA . n A 1 15 VAL 15 15 15 VAL VAL AAA . n A 1 16 ALA 16 16 16 ALA ALA AAA . n A 1 17 GLY 17 17 17 GLY GLY AAA . n A 1 18 THR 18 18 18 THR THR AAA . n A 1 19 TRP 19 19 19 TRP TRP AAA . n A 1 20 TYR 20 20 20 TYR TYR AAA . n A 1 21 SER 21 21 21 SER SER AAA . n A 1 22 LEU 22 22 22 LEU LEU AAA . n A 1 23 ALA 23 23 23 ALA ALA AAA . n A 1 24 MET 24 24 24 MET MET AAA . n A 1 25 ALA 25 25 25 ALA ALA AAA . n A 1 26 ALA 26 26 26 ALA ALA AAA . n A 1 27 SER 27 27 27 SER SER AAA . n A 1 28 ASP 28 28 28 ASP ASP AAA . n A 1 29 ILE 29 29 29 ILE ILE AAA . n A 1 30 SER 30 30 30 SER SER AAA . n A 1 31 LEU 31 31 31 LEU LEU AAA . n A 1 32 LEU 32 32 32 LEU LEU AAA . n A 1 33 ASP 33 33 33 ASP ASP AAA . n A 1 34 ALA 34 34 34 ALA ALA AAA . n A 1 35 GLN 35 35 35 GLN GLN AAA . n A 1 36 SER 36 36 36 SER SER AAA . n A 1 37 ALA 37 37 37 ALA ALA AAA . n A 1 38 PRO 38 38 38 PRO PRO AAA . n A 1 39 LYS 39 39 39 LYS LYS AAA . n A 1 40 ARG 40 40 40 ARG ARG AAA . n A 1 41 VAL 41 41 41 VAL VAL AAA . n A 1 42 TYR 42 42 42 TYR TYR AAA . n A 1 43 VAL 43 43 43 VAL VAL AAA . n A 1 44 GLU 44 44 44 GLU GLU AAA . n A 1 45 GLU 45 45 45 GLU GLU AAA . n A 1 46 LEU 46 46 46 LEU LEU AAA . n A 1 47 LYS 47 47 47 LYS LYS AAA . n A 1 48 PRO 48 48 48 PRO PRO AAA . n A 1 49 THR 49 49 49 THR THR AAA . n A 1 50 PRO 50 50 50 PRO PRO AAA . n A 1 51 GLU 51 51 51 GLU GLU AAA . n A 1 52 GLY 52 52 52 GLY GLY AAA . n A 1 53 ASP 53 53 53 ASP ASP AAA . n A 1 54 LEU 54 54 54 LEU LEU AAA . n A 1 55 GLU 55 55 55 GLU GLU AAA . n A 1 56 ILE 56 56 56 ILE ILE AAA . n A 1 57 LEU 57 57 57 LEU LEU AAA . n A 1 58 LEU 58 58 58 LEU LEU AAA . n A 1 59 GLN 59 59 59 GLN GLN AAA . n A 1 60 LYS 60 60 60 LYS LYS AAA . n A 1 61 TRP 61 61 61 TRP TRP AAA . n A 1 62 GLU 62 62 62 GLU GLU AAA . n A 1 63 ASN 63 63 ? ? ? AAA . n A 1 64 GLY 64 64 64 GLY GLY AAA . n A 1 65 GLU 65 65 65 GLU GLU AAA . n A 1 66 CYS 66 66 66 CYS CYS AAA . n A 1 67 ALA 67 67 67 ALA ALA AAA . n A 1 68 GLN 68 68 68 GLN GLN AAA . n A 1 69 LYS 69 69 69 LYS LYS AAA . n A 1 70 LYS 70 70 70 LYS LYS AAA . n A 1 71 ILE 71 71 71 ILE ILE AAA . n A 1 72 ILE 72 72 72 ILE ILE AAA . n A 1 73 ALA 73 73 73 ALA ALA AAA . n A 1 74 GLU 74 74 74 GLU GLU AAA . n A 1 75 LYS 75 75 75 LYS LYS AAA . n A 1 76 THR 76 76 76 THR THR AAA . n A 1 77 LYS 77 77 77 LYS LYS AAA . n A 1 78 ILE 78 78 78 ILE ILE AAA . n A 1 79 PRO 79 79 79 PRO PRO AAA . n A 1 80 ALA 80 80 80 ALA ALA AAA . n A 1 81 VAL 81 81 81 VAL VAL AAA . n A 1 82 PHE 82 82 82 PHE PHE AAA . n A 1 83 LYS 83 83 83 LYS LYS AAA . n A 1 84 ILE 84 84 84 ILE ILE AAA . n A 1 85 ASP 85 85 85 ASP ASP AAA . n A 1 86 ALA 86 86 ? ? ? AAA . n A 1 87 LEU 87 87 ? ? ? AAA . n A 1 88 ASN 88 88 ? ? ? AAA . n A 1 89 GLU 89 89 ? ? ? AAA . n A 1 90 ASN 90 90 90 ASN ASN AAA . n A 1 91 LYS 91 91 91 LYS LYS AAA . n A 1 92 VAL 92 92 92 VAL VAL AAA . n A 1 93 LEU 93 93 93 LEU LEU AAA . n A 1 94 VAL 94 94 94 VAL VAL AAA . n A 1 95 LEU 95 95 95 LEU LEU AAA . n A 1 96 ASP 96 96 96 ASP ASP AAA . n A 1 97 THR 97 97 97 THR THR AAA . n A 1 98 ASP 98 98 98 ASP ASP AAA . n A 1 99 TYR 99 99 99 TYR TYR AAA . n A 1 100 LYS 100 100 100 LYS LYS AAA . n A 1 101 LYS 101 101 101 LYS LYS AAA . n A 1 102 TYR 102 102 102 TYR TYR AAA . n A 1 103 LEU 103 103 103 LEU LEU AAA . n A 1 104 LEU 104 104 104 LEU LEU AAA . n A 1 105 PHE 105 105 105 PHE PHE AAA . n A 1 106 CYS 106 106 106 CYS CYS AAA . n A 1 107 MET 107 107 107 MET MET AAA . n A 1 108 GLU 108 108 108 GLU GLU AAA . n A 1 109 ASN 109 109 109 ASN ASN AAA . n A 1 110 SER 110 110 ? ? ? AAA . n A 1 111 ALA 111 111 ? ? ? AAA . n A 1 112 GLU 112 112 ? ? ? AAA . n A 1 113 PRO 113 113 ? ? ? AAA . n A 1 114 GLU 114 114 ? ? ? AAA . n A 1 115 GLN 115 115 115 GLN GLN AAA . n A 1 116 SER 116 116 116 SER SER AAA . n A 1 117 LEU 117 117 117 LEU LEU AAA . n A 1 118 ALA 118 118 118 ALA ALA AAA . n A 1 119 CYS 119 119 119 CYS CYS AAA . n A 1 120 GLN 120 120 120 GLN GLN AAA . n A 1 121 CYS 121 121 121 CYS CYS AAA . n A 1 122 LEU 122 122 122 LEU LEU AAA . n A 1 123 VAL 123 123 123 VAL VAL AAA . n A 1 124 ARG 124 124 124 ARG ARG AAA . n A 1 125 THR 125 125 125 THR THR AAA . n A 1 126 PRO 126 126 126 PRO PRO AAA . n A 1 127 GLU 127 127 127 GLU GLU AAA . n A 1 128 VAL 128 128 128 VAL VAL AAA . n A 1 129 ASP 129 129 129 ASP ASP AAA . n A 1 130 ASP 130 130 130 ASP ASP AAA . n A 1 131 GLU 131 131 131 GLU GLU AAA . n A 1 132 ALA 132 132 132 ALA ALA AAA . n A 1 133 LEU 133 133 133 LEU LEU AAA . n A 1 134 GLU 134 134 134 GLU GLU AAA . n A 1 135 LYS 135 135 135 LYS LYS AAA . n A 1 136 PHE 136 136 136 PHE PHE AAA . n A 1 137 ASP 137 137 137 ASP ASP AAA . n A 1 138 LYS 138 138 138 LYS LYS AAA . n A 1 139 ALA 139 139 139 ALA ALA AAA . n A 1 140 LEU 140 140 140 LEU LEU AAA . n A 1 141 LYS 141 141 141 LYS LYS AAA . n A 1 142 ALA 142 142 142 ALA ALA AAA . n A 1 143 LEU 143 143 143 LEU LEU AAA . n A 1 144 PRO 144 144 144 PRO PRO AAA . n A 1 145 MET 145 145 145 MET MET AAA . n A 1 146 HIS 146 146 146 HIS HIS AAA . n A 1 147 ILE 147 147 147 ILE ILE AAA . n A 1 148 ARG 148 148 148 ARG ARG AAA . n A 1 149 LEU 149 149 149 LEU LEU AAA . n A 1 150 SER 150 150 150 SER SER AAA . n A 1 151 PHE 151 151 151 PHE PHE AAA . n A 1 152 ASN 152 152 152 ASN ASN AAA . n A 1 153 PRO 153 153 153 PRO PRO AAA . n A 1 154 THR 154 154 154 THR THR AAA . n A 1 155 GLN 155 155 155 GLN GLN AAA . n A 1 156 LEU 156 156 156 LEU LEU AAA . n A 1 157 GLU 157 157 157 GLU GLU AAA . n A 1 158 GLU 158 158 158 GLU GLU AAA . n A 1 159 GLN 159 159 159 GLN GLN AAA . n A 1 160 CYS 160 160 160 CYS CYS AAA . n A 1 161 HIS 161 161 161 HIS HIS AAA . n A 1 162 ILE 162 162 162 ILE ILE AAA . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 DKA 1 201 201 DKA DKA AAA . C 3 EDO 1 202 301 EDO EDO AAA . D 4 HOH 1 301 48 HOH HOH AAA . D 4 HOH 2 302 28 HOH HOH AAA . D 4 HOH 3 303 2 HOH HOH AAA . D 4 HOH 4 304 32 HOH HOH AAA . D 4 HOH 5 305 58 HOH HOH AAA . D 4 HOH 6 306 34 HOH HOH AAA . D 4 HOH 7 307 22 HOH HOH AAA . D 4 HOH 8 308 60 HOH HOH AAA . D 4 HOH 9 309 59 HOH HOH AAA . D 4 HOH 10 310 19 HOH HOH AAA . D 4 HOH 11 311 12 HOH HOH AAA . D 4 HOH 12 312 7 HOH HOH AAA . D 4 HOH 13 313 23 HOH HOH AAA . D 4 HOH 14 314 9 HOH HOH AAA . D 4 HOH 15 315 42 HOH HOH AAA . D 4 HOH 16 316 29 HOH HOH AAA . D 4 HOH 17 317 3 HOH HOH AAA . D 4 HOH 18 318 8 HOH HOH AAA . D 4 HOH 19 319 24 HOH HOH AAA . D 4 HOH 20 320 39 HOH HOH AAA . D 4 HOH 21 321 31 HOH HOH AAA . D 4 HOH 22 322 18 HOH HOH AAA . D 4 HOH 23 323 6 HOH HOH AAA . D 4 HOH 24 324 35 HOH HOH AAA . D 4 HOH 25 325 11 HOH HOH AAA . D 4 HOH 26 326 57 HOH HOH AAA . D 4 HOH 27 327 45 HOH HOH AAA . D 4 HOH 28 328 52 HOH HOH AAA . D 4 HOH 29 329 15 HOH HOH AAA . D 4 HOH 30 330 47 HOH HOH AAA . D 4 HOH 31 331 37 HOH HOH AAA . D 4 HOH 32 332 56 HOH HOH AAA . D 4 HOH 33 333 4 HOH HOH AAA . D 4 HOH 34 334 36 HOH HOH AAA . D 4 HOH 35 335 41 HOH HOH AAA . D 4 HOH 36 336 46 HOH HOH AAA . D 4 HOH 37 337 13 HOH HOH AAA . D 4 HOH 38 338 43 HOH HOH AAA . D 4 HOH 39 339 10 HOH HOH AAA . D 4 HOH 40 340 30 HOH HOH AAA . D 4 HOH 41 341 40 HOH HOH AAA . D 4 HOH 42 342 61 HOH HOH AAA . D 4 HOH 43 343 53 HOH HOH AAA . D 4 HOH 44 344 33 HOH HOH AAA . D 4 HOH 45 345 5 HOH HOH AAA . D 4 HOH 46 346 62 HOH HOH AAA . D 4 HOH 47 347 27 HOH HOH AAA . D 4 HOH 48 348 44 HOH HOH AAA . D 4 HOH 49 349 54 HOH HOH AAA . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 AAA THR 4 ? OG1 ? A THR 4 OG1 2 1 Y 1 AAA THR 4 ? CG2 ? A THR 4 CG2 3 1 Y 1 AAA GLU 65 ? CG ? A GLU 65 CG 4 1 Y 1 AAA GLU 65 ? CD ? A GLU 65 CD 5 1 Y 1 AAA GLU 65 ? OE1 ? A GLU 65 OE1 6 1 Y 1 AAA GLU 65 ? OE2 ? A GLU 65 OE2 7 1 Y 1 AAA GLU 74 ? CD ? A GLU 74 CD 8 1 Y 1 AAA GLU 74 ? OE1 ? A GLU 74 OE1 9 1 Y 1 AAA GLU 74 ? OE2 ? A GLU 74 OE2 10 1 Y 1 AAA LYS 75 ? CG ? A LYS 75 CG 11 1 Y 1 AAA LYS 75 ? CD ? A LYS 75 CD 12 1 Y 1 AAA LYS 75 ? CE ? A LYS 75 CE 13 1 Y 1 AAA LYS 75 ? NZ ? A LYS 75 NZ 14 1 Y 1 AAA LYS 77 ? CG ? A LYS 77 CG 15 1 Y 1 AAA LYS 77 ? CD ? A LYS 77 CD 16 1 Y 1 AAA LYS 77 ? CE ? A LYS 77 CE 17 1 Y 1 AAA LYS 77 ? NZ ? A LYS 77 NZ 18 1 Y 1 AAA LYS 83 ? CG ? A LYS 83 CG 19 1 Y 1 AAA LYS 83 ? CD ? A LYS 83 CD 20 1 Y 1 AAA LYS 83 ? CE ? A LYS 83 CE 21 1 Y 1 AAA LYS 83 ? NZ ? A LYS 83 NZ 22 1 Y 1 AAA ASP 85 ? CG ? A ASP 85 CG 23 1 Y 1 AAA ASP 85 ? OD1 ? A ASP 85 OD1 24 1 Y 1 AAA ASP 85 ? OD2 ? A ASP 85 OD2 25 1 Y 1 AAA LYS 100 ? CD ? A LYS 100 CD 26 1 Y 1 AAA LYS 100 ? CE ? A LYS 100 CE 27 1 Y 1 AAA LYS 100 ? NZ ? A LYS 100 NZ 28 1 Y 1 AAA ASN 109 ? CG ? A ASN 109 CG 29 1 Y 1 AAA ASN 109 ? OD1 ? A ASN 109 OD1 30 1 Y 1 AAA ASN 109 ? ND2 ? A ASN 109 ND2 31 1 Y 1 AAA GLN 115 ? CG ? A GLN 115 CG 32 1 Y 1 AAA GLN 115 ? CD ? A GLN 115 CD 33 1 Y 1 AAA GLN 115 ? OE1 ? A GLN 115 OE1 34 1 Y 1 AAA GLN 115 ? NE2 ? A GLN 115 NE2 35 1 Y 1 AAA LYS 138 ? CD ? A LYS 138 CD 36 1 Y 1 AAA LYS 138 ? CE ? A LYS 138 CE 37 1 Y 1 AAA LYS 138 ? NZ ? A LYS 138 NZ 38 1 Y 1 AAA LYS 141 ? CG ? A LYS 141 CG 39 1 Y 1 AAA LYS 141 ? CD ? A LYS 141 CD 40 1 Y 1 AAA LYS 141 ? CE ? A LYS 141 CE 41 1 Y 1 AAA LYS 141 ? NZ ? A LYS 141 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.3.11 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.6 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrysalisPro ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7BGZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 53.560 _cell.length_a_esd ? _cell.length_b 53.560 _cell.length_b_esd ? _cell.length_c 110.880 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7BGZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7BGZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.52 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.11 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '3.0 M ammonium sulfate in 0.5 M Tris-HCl pH 8.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'AGILENT ATLAS CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-11-06 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'SEALED TUBE' _diffrn_source.target ? _diffrn_source.type 'Agilent SuperNova' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7BGZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.400 _reflns.d_resolution_low 14.260 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7446 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.500 _reflns.pdbx_Rmerge_I_obs 0.057 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.900 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 10 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.067 _reflns.pdbx_Rpim_I_all 0.034 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 26085 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.400 2.490 ? 1.4 1866 ? ? ? 754 97.600 ? ? ? ? 0.653 ? ? ? ? ? ? ? ? 2.500 ? ? ? 1.400 0.830 0.502 ? 1 1 0.714 ? ? 8.980 14.260 ? ? 271 ? ? ? 123 71.000 ? ? ? ? 0.015 ? ? ? ? ? ? ? ? 2.200 ? ? ? 35.700 0.020 0.012 ? 2 1 1.000 ? ? # _refine.aniso_B[1][1] -0.213 _refine.aniso_B[1][2] -0.106 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] -0.213 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 0.690 _refine.B_iso_max ? _refine.B_iso_mean 50.562 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.960 _refine.correlation_coeff_Fo_to_Fc_free 0.918 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7BGZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.401 _refine.ls_d_res_low 13.753 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7437 _refine.ls_number_reflns_R_free 1075 _refine.ls_number_reflns_R_work 6362 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.279 _refine.ls_percent_reflns_R_free 14.455 _refine.ls_R_factor_all 0.204 _refine.ls_R_factor_obs 0.20297 _refine.ls_R_factor_R_free 0.2663 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1938 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1BSY _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.445 _refine.pdbx_overall_ESU_R_Free 0.297 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 21.452 _refine.overall_SU_ML 0.236 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1150 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 16 _refine_hist.number_atoms_solvent 49 _refine_hist.number_atoms_total 1215 _refine_hist.d_res_high 2.401 _refine_hist.d_res_low 13.753 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 0.013 1183 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1157 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.779 1.644 1598 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.233 1.580 2671 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.940 5.000 146 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 37.420 25.000 48 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.301 15.000 208 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 8.348 15.000 3 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.075 0.200 162 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 1288 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 226 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.198 0.200 203 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.200 0.200 1014 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.159 0.200 514 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.086 0.200 576 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.138 0.200 43 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.137 0.200 8 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.243 0.200 27 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.108 0.200 3 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 2.460 3.533 596 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.460 3.532 595 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.972 5.264 738 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.970 5.265 739 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.456 3.782 587 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.454 3.785 588 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 4.000 5.545 860 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.997 5.547 861 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.954 40.189 1175 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 5.950 40.127 1174 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.401 2.461 542 . 97 428 96.8635 . 0.335 . 0.366 . 0.328 . . . . . 0.315 . 20 . 0.780 0.781 'X-RAY DIFFRACTION' 2.461 2.527 513 . 58 437 96.4912 . 0.294 . 0.348 . 0.287 . . . . . 0.274 . 20 . 0.804 0.694 'X-RAY DIFFRACTION' 2.527 2.597 496 . 51 430 96.9758 . 0.295 . 0.485 . 0.275 . . . . . 0.252 . 20 . 0.864 0.789 'X-RAY DIFFRACTION' 2.597 2.674 519 . 66 438 97.1098 . 0.290 . 0.361 . 0.279 . . . . . 0.254 . 20 . 0.864 0.825 'X-RAY DIFFRACTION' 2.674 2.758 459 . 78 369 97.3856 . 0.258 . 0.343 . 0.240 . . . . . 0.213 . 20 . 0.883 0.844 'X-RAY DIFFRACTION' 2.758 2.851 473 . 67 394 97.4630 . 0.241 . 0.337 . 0.225 . . . . . 0.201 . 20 . 0.895 0.860 'X-RAY DIFFRACTION' 2.851 2.954 453 . 76 368 98.0132 . 0.216 . 0.279 . 0.204 . . . . . 0.177 . 20 . 0.926 0.901 'X-RAY DIFFRACTION' 2.954 3.069 430 . 64 358 98.1395 . 0.237 . 0.318 . 0.222 . . . . . 0.200 . 20 . 0.903 0.867 'X-RAY DIFFRACTION' 3.069 3.198 418 . 54 356 98.0861 . 0.221 . 0.285 . 0.210 . . . . . 0.188 . 20 . 0.916 0.900 'X-RAY DIFFRACTION' 3.198 3.345 420 . 48 365 98.3333 . 0.225 . 0.280 . 0.218 . . . . . 0.201 . 20 . 0.917 0.892 'X-RAY DIFFRACTION' 3.345 3.514 373 . 48 319 98.3914 . 0.216 . 0.291 . 0.205 . . . . . 0.193 . 20 . 0.931 0.903 'X-RAY DIFFRACTION' 3.514 3.712 385 . 62 318 98.7013 . 0.200 . 0.236 . 0.192 . . . . . 0.181 . 20 . 0.948 0.947 'X-RAY DIFFRACTION' 3.712 3.948 342 . 43 295 98.8304 . 0.199 . 0.260 . 0.190 . . . . . 0.178 . 20 . 0.946 0.925 'X-RAY DIFFRACTION' 3.948 4.236 336 . 66 267 99.1071 . 0.162 . 0.198 . 0.152 . . . . . 0.142 . 20 . 0.970 0.952 'X-RAY DIFFRACTION' 4.236 4.596 302 . 42 259 99.6689 . 0.120 . 0.151 . 0.114 . . . . . 0.111 . 20 . 0.980 0.979 'X-RAY DIFFRACTION' 4.596 5.069 289 . 28 260 99.6540 . 0.137 . 0.209 . 0.130 . . . . . 0.132 . 20 . 0.978 0.962 'X-RAY DIFFRACTION' 5.069 5.725 258 . 30 226 99.2248 . 0.231 . 0.377 . 0.213 . . . . . 0.205 . 20 . 0.938 0.877 'X-RAY DIFFRACTION' 5.725 6.726 237 . 33 201 98.7342 . 0.238 . 0.419 . 0.214 . . . . . 0.209 . 20 . 0.938 0.861 'X-RAY DIFFRACTION' 6.726 8.545 191 . 36 153 98.9529 . 0.165 . 0.214 . 0.153 . . . . . 0.159 . 20 . 0.966 0.959 'X-RAY DIFFRACTION' 8.545 13.753 150 . 26 117 95.3333 . 0.193 . 0.227 . 0.184 . . . . . 0.202 . 20 . 0.965 0.953 # _struct.entry_id 7BGZ _struct.title 'Mutant L39K of recombinant beta-lactoglobulin in complex with endogenous ligand' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7BGZ _struct_keywords.text 'beta-lactoglobulin, lipocalin, mutation, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LACB_BOVIN _struct_ref.pdbx_db_accession P02754 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPA VFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQC HI ; _struct_ref.pdbx_align_begin 17 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7BGZ _struct_ref_seq.pdbx_strand_id AAA _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 162 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02754 _struct_ref_seq.db_align_beg 17 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 178 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 162 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7BGZ ALA AAA 1 ? UNP P02754 LEU 17 'engineered mutation' 1 1 1 7BGZ SER AAA 2 ? UNP P02754 ILE 18 'engineered mutation' 2 2 1 7BGZ LYS AAA 39 ? UNP P02754 LEU 55 'engineered mutation' 39 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D 1 2 A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 x-y,-y,-z+1/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 36.9600000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 11 ? ALA A 16 ? ASP AAA 11 ALA AAA 16 5 ? 6 HELX_P HELX_P2 AA2 ASP A 28 ? LEU A 32 ? ASP AAA 28 LEU AAA 32 5 ? 5 HELX_P HELX_P3 AA3 ASP A 129 ? ALA A 142 ? ASP AAA 129 ALA AAA 142 1 ? 14 HELX_P HELX_P4 AA4 ASN A 152 ? GLU A 157 ? ASN AAA 152 GLU AAA 157 1 ? 6 HELX_P HELX_P5 AA5 GLU A 158 ? ILE A 162 ? GLU AAA 158 ILE AAA 162 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 66 SG ? ? ? 1_555 A CYS 160 SG ? ? AAA CYS 66 AAA CYS 160 1_555 ? ? ? ? ? ? ? 2.050 ? ? disulf2 disulf ? ? A CYS 106 SG ? ? ? 1_555 A CYS 119 SG ? ? AAA CYS 106 AAA CYS 119 1_555 ? ? ? ? ? ? ? 2.029 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 66 ? CYS A 160 ? CYS AAA 66 ? 1_555 CYS AAA 160 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 106 ? CYS A 119 ? CYS AAA 106 ? 1_555 CYS AAA 119 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 17 ? THR A 18 ? GLY AAA 17 THR AAA 18 AA1 2 TYR A 42 ? PRO A 48 ? TYR AAA 42 PRO AAA 48 AA1 3 LEU A 54 ? TRP A 61 ? LEU AAA 54 TRP AAA 61 AA1 4 CYS A 66 ? LYS A 75 ? CYS AAA 66 LYS AAA 75 AA1 5 VAL A 81 ? LYS A 83 ? VAL AAA 81 LYS AAA 83 AA1 6 LYS A 91 ? THR A 97 ? LYS AAA 91 THR AAA 97 AA1 7 TYR A 102 ? GLU A 108 ? TYR AAA 102 GLU AAA 108 AA1 8 ALA A 118 ? VAL A 123 ? ALA AAA 118 VAL AAA 123 AA1 9 TYR A 20 ? ALA A 26 ? TYR AAA 20 ALA AAA 26 AA1 10 ILE A 147 ? SER A 150 ? ILE AAA 147 SER AAA 150 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 17 ? N GLY AAA 17 O LEU A 46 ? O LEU AAA 46 AA1 2 3 N GLU A 44 ? N GLU AAA 44 O LEU A 57 ? O LEU AAA 57 AA1 3 4 N LEU A 54 ? N LEU AAA 54 O ALA A 73 ? O ALA AAA 73 AA1 4 5 N GLU A 74 ? N GLU AAA 74 O LYS A 83 ? O LYS AAA 83 AA1 5 6 N PHE A 82 ? N PHE AAA 82 O VAL A 92 ? O VAL AAA 92 AA1 6 7 N ASP A 96 ? N ASP AAA 96 O LEU A 104 ? O LEU AAA 104 AA1 7 8 N MET A 107 ? N MET AAA 107 O ALA A 118 ? O ALA AAA 118 AA1 8 9 O VAL A 123 ? O VAL AAA 123 N TYR A 20 ? N TYR AAA 20 AA1 9 10 N MET A 24 ? N MET AAA 24 O LEU A 149 ? O LEU AAA 149 # _pdbx_entry_details.entry_id 7BGZ _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS AAA 75 ? ? -48.94 157.26 2 1 ASP AAA 96 ? ? -170.12 146.16 3 1 TYR AAA 99 ? ? 66.53 -41.92 4 1 SER AAA 116 ? ? -114.57 75.68 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 15.4893 _pdbx_refine_tls.origin_y 5.1748 _pdbx_refine_tls.origin_z 33.3413 _pdbx_refine_tls.T[1][1] 0.3313 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.1697 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0061 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.1354 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0316 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.0201 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.8761 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.4496 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.7700 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.5374 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.4822 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 2.6925 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.3844 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.1764 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0333 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.1513 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.2618 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.1490 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.2347 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.4070 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.1226 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? AAA 3 ? ? ? AAA 162 ? ALL ? 2 'X-RAY DIFFRACTION' 1 ? ? AaA 201 ? ? ? AaA 201 ? ALL ? # _pdbx_phasing_MR.entry_id 7BGZ _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 2.400 _pdbx_phasing_MR.d_res_low_rotation 14.260 _pdbx_phasing_MR.d_res_high_translation 2.400 _pdbx_phasing_MR.d_res_low_translation 14.260 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 AAA ALA 1 ? A ALA 1 2 1 Y 1 AAA SER 2 ? A SER 2 3 1 Y 1 AAA ASN 63 ? A ASN 63 4 1 Y 1 AAA ALA 86 ? A ALA 86 5 1 Y 1 AAA LEU 87 ? A LEU 87 6 1 Y 1 AAA ASN 88 ? A ASN 88 7 1 Y 1 AAA GLU 89 ? A GLU 89 8 1 Y 1 AAA SER 110 ? A SER 110 9 1 Y 1 AAA ALA 111 ? A ALA 111 10 1 Y 1 AAA GLU 112 ? A GLU 112 11 1 Y 1 AAA PRO 113 ? A PRO 113 12 1 Y 1 AAA GLU 114 ? A GLU 114 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 DKA C1 C N N 88 DKA O1 O N N 89 DKA C2 C N N 90 DKA C3 C N N 91 DKA C4 C N N 92 DKA C5 C N N 93 DKA C6 C N N 94 DKA C7 C N N 95 DKA C8 C N N 96 DKA C9 C N N 97 DKA C10 C N N 98 DKA O2 O N N 99 DKA H21 H N N 100 DKA H22 H N N 101 DKA H31 H N N 102 DKA H32 H N N 103 DKA H41 H N N 104 DKA H42 H N N 105 DKA H51 H N N 106 DKA H52 H N N 107 DKA H61 H N N 108 DKA H62 H N N 109 DKA H71 H N N 110 DKA H72 H N N 111 DKA H81 H N N 112 DKA H82 H N N 113 DKA H91 H N N 114 DKA H92 H N N 115 DKA H101 H N N 116 DKA H102 H N N 117 DKA H103 H N N 118 DKA HO2 H N N 119 EDO C1 C N N 120 EDO O1 O N N 121 EDO C2 C N N 122 EDO O2 O N N 123 EDO H11 H N N 124 EDO H12 H N N 125 EDO HO1 H N N 126 EDO H21 H N N 127 EDO H22 H N N 128 EDO HO2 H N N 129 GLN N N N N 130 GLN CA C N S 131 GLN C C N N 132 GLN O O N N 133 GLN CB C N N 134 GLN CG C N N 135 GLN CD C N N 136 GLN OE1 O N N 137 GLN NE2 N N N 138 GLN OXT O N N 139 GLN H H N N 140 GLN H2 H N N 141 GLN HA H N N 142 GLN HB2 H N N 143 GLN HB3 H N N 144 GLN HG2 H N N 145 GLN HG3 H N N 146 GLN HE21 H N N 147 GLN HE22 H N N 148 GLN HXT H N N 149 GLU N N N N 150 GLU CA C N S 151 GLU C C N N 152 GLU O O N N 153 GLU CB C N N 154 GLU CG C N N 155 GLU CD C N N 156 GLU OE1 O N N 157 GLU OE2 O N N 158 GLU OXT O N N 159 GLU H H N N 160 GLU H2 H N N 161 GLU HA H N N 162 GLU HB2 H N N 163 GLU HB3 H N N 164 GLU HG2 H N N 165 GLU HG3 H N N 166 GLU HE2 H N N 167 GLU HXT H N N 168 GLY N N N N 169 GLY CA C N N 170 GLY C C N N 171 GLY O O N N 172 GLY OXT O N N 173 GLY H H N N 174 GLY H2 H N N 175 GLY HA2 H N N 176 GLY HA3 H N N 177 GLY HXT H N N 178 HIS N N N N 179 HIS CA C N S 180 HIS C C N N 181 HIS O O N N 182 HIS CB C N N 183 HIS CG C Y N 184 HIS ND1 N Y N 185 HIS CD2 C Y N 186 HIS CE1 C Y N 187 HIS NE2 N Y N 188 HIS OXT O N N 189 HIS H H N N 190 HIS H2 H N N 191 HIS HA H N N 192 HIS HB2 H N N 193 HIS HB3 H N N 194 HIS HD1 H N N 195 HIS HD2 H N N 196 HIS HE1 H N N 197 HIS HE2 H N N 198 HIS HXT H N N 199 HOH O O N N 200 HOH H1 H N N 201 HOH H2 H N N 202 ILE N N N N 203 ILE CA C N S 204 ILE C C N N 205 ILE O O N N 206 ILE CB C N S 207 ILE CG1 C N N 208 ILE CG2 C N N 209 ILE CD1 C N N 210 ILE OXT O N N 211 ILE H H N N 212 ILE H2 H N N 213 ILE HA H N N 214 ILE HB H N N 215 ILE HG12 H N N 216 ILE HG13 H N N 217 ILE HG21 H N N 218 ILE HG22 H N N 219 ILE HG23 H N N 220 ILE HD11 H N N 221 ILE HD12 H N N 222 ILE HD13 H N N 223 ILE HXT H N N 224 LEU N N N N 225 LEU CA C N S 226 LEU C C N N 227 LEU O O N N 228 LEU CB C N N 229 LEU CG C N N 230 LEU CD1 C N N 231 LEU CD2 C N N 232 LEU OXT O N N 233 LEU H H N N 234 LEU H2 H N N 235 LEU HA H N N 236 LEU HB2 H N N 237 LEU HB3 H N N 238 LEU HG H N N 239 LEU HD11 H N N 240 LEU HD12 H N N 241 LEU HD13 H N N 242 LEU HD21 H N N 243 LEU HD22 H N N 244 LEU HD23 H N N 245 LEU HXT H N N 246 LYS N N N N 247 LYS CA C N S 248 LYS C C N N 249 LYS O O N N 250 LYS CB C N N 251 LYS CG C N N 252 LYS CD C N N 253 LYS CE C N N 254 LYS NZ N N N 255 LYS OXT O N N 256 LYS H H N N 257 LYS H2 H N N 258 LYS HA H N N 259 LYS HB2 H N N 260 LYS HB3 H N N 261 LYS HG2 H N N 262 LYS HG3 H N N 263 LYS HD2 H N N 264 LYS HD3 H N N 265 LYS HE2 H N N 266 LYS HE3 H N N 267 LYS HZ1 H N N 268 LYS HZ2 H N N 269 LYS HZ3 H N N 270 LYS HXT H N N 271 MET N N N N 272 MET CA C N S 273 MET C C N N 274 MET O O N N 275 MET CB C N N 276 MET CG C N N 277 MET SD S N N 278 MET CE C N N 279 MET OXT O N N 280 MET H H N N 281 MET H2 H N N 282 MET HA H N N 283 MET HB2 H N N 284 MET HB3 H N N 285 MET HG2 H N N 286 MET HG3 H N N 287 MET HE1 H N N 288 MET HE2 H N N 289 MET HE3 H N N 290 MET HXT H N N 291 PHE N N N N 292 PHE CA C N S 293 PHE C C N N 294 PHE O O N N 295 PHE CB C N N 296 PHE CG C Y N 297 PHE CD1 C Y N 298 PHE CD2 C Y N 299 PHE CE1 C Y N 300 PHE CE2 C Y N 301 PHE CZ C Y N 302 PHE OXT O N N 303 PHE H H N N 304 PHE H2 H N N 305 PHE HA H N N 306 PHE HB2 H N N 307 PHE HB3 H N N 308 PHE HD1 H N N 309 PHE HD2 H N N 310 PHE HE1 H N N 311 PHE HE2 H N N 312 PHE HZ H N N 313 PHE HXT H N N 314 PRO N N N N 315 PRO CA C N S 316 PRO C C N N 317 PRO O O N N 318 PRO CB C N N 319 PRO CG C N N 320 PRO CD C N N 321 PRO OXT O N N 322 PRO H H N N 323 PRO HA H N N 324 PRO HB2 H N N 325 PRO HB3 H N N 326 PRO HG2 H N N 327 PRO HG3 H N N 328 PRO HD2 H N N 329 PRO HD3 H N N 330 PRO HXT H N N 331 SER N N N N 332 SER CA C N S 333 SER C C N N 334 SER O O N N 335 SER CB C N N 336 SER OG O N N 337 SER OXT O N N 338 SER H H N N 339 SER H2 H N N 340 SER HA H N N 341 SER HB2 H N N 342 SER HB3 H N N 343 SER HG H N N 344 SER HXT H N N 345 THR N N N N 346 THR CA C N S 347 THR C C N N 348 THR O O N N 349 THR CB C N R 350 THR OG1 O N N 351 THR CG2 C N N 352 THR OXT O N N 353 THR H H N N 354 THR H2 H N N 355 THR HA H N N 356 THR HB H N N 357 THR HG1 H N N 358 THR HG21 H N N 359 THR HG22 H N N 360 THR HG23 H N N 361 THR HXT H N N 362 TRP N N N N 363 TRP CA C N S 364 TRP C C N N 365 TRP O O N N 366 TRP CB C N N 367 TRP CG C Y N 368 TRP CD1 C Y N 369 TRP CD2 C Y N 370 TRP NE1 N Y N 371 TRP CE2 C Y N 372 TRP CE3 C Y N 373 TRP CZ2 C Y N 374 TRP CZ3 C Y N 375 TRP CH2 C Y N 376 TRP OXT O N N 377 TRP H H N N 378 TRP H2 H N N 379 TRP HA H N N 380 TRP HB2 H N N 381 TRP HB3 H N N 382 TRP HD1 H N N 383 TRP HE1 H N N 384 TRP HE3 H N N 385 TRP HZ2 H N N 386 TRP HZ3 H N N 387 TRP HH2 H N N 388 TRP HXT H N N 389 TYR N N N N 390 TYR CA C N S 391 TYR C C N N 392 TYR O O N N 393 TYR CB C N N 394 TYR CG C Y N 395 TYR CD1 C Y N 396 TYR CD2 C Y N 397 TYR CE1 C Y N 398 TYR CE2 C Y N 399 TYR CZ C Y N 400 TYR OH O N N 401 TYR OXT O N N 402 TYR H H N N 403 TYR H2 H N N 404 TYR HA H N N 405 TYR HB2 H N N 406 TYR HB3 H N N 407 TYR HD1 H N N 408 TYR HD2 H N N 409 TYR HE1 H N N 410 TYR HE2 H N N 411 TYR HH H N N 412 TYR HXT H N N 413 VAL N N N N 414 VAL CA C N S 415 VAL C C N N 416 VAL O O N N 417 VAL CB C N N 418 VAL CG1 C N N 419 VAL CG2 C N N 420 VAL OXT O N N 421 VAL H H N N 422 VAL H2 H N N 423 VAL HA H N N 424 VAL HB H N N 425 VAL HG11 H N N 426 VAL HG12 H N N 427 VAL HG13 H N N 428 VAL HG21 H N N 429 VAL HG22 H N N 430 VAL HG23 H N N 431 VAL HXT H N N 432 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DKA C1 O1 doub N N 83 DKA C1 C2 sing N N 84 DKA C1 O2 sing N N 85 DKA C2 C3 sing N N 86 DKA C2 H21 sing N N 87 DKA C2 H22 sing N N 88 DKA C3 C4 sing N N 89 DKA C3 H31 sing N N 90 DKA C3 H32 sing N N 91 DKA C4 C5 sing N N 92 DKA C4 H41 sing N N 93 DKA C4 H42 sing N N 94 DKA C5 C6 sing N N 95 DKA C5 H51 sing N N 96 DKA C5 H52 sing N N 97 DKA C6 C7 sing N N 98 DKA C6 H61 sing N N 99 DKA C6 H62 sing N N 100 DKA C7 C8 sing N N 101 DKA C7 H71 sing N N 102 DKA C7 H72 sing N N 103 DKA C8 C9 sing N N 104 DKA C8 H81 sing N N 105 DKA C8 H82 sing N N 106 DKA C9 C10 sing N N 107 DKA C9 H91 sing N N 108 DKA C9 H92 sing N N 109 DKA C10 H101 sing N N 110 DKA C10 H102 sing N N 111 DKA C10 H103 sing N N 112 DKA O2 HO2 sing N N 113 EDO C1 O1 sing N N 114 EDO C1 C2 sing N N 115 EDO C1 H11 sing N N 116 EDO C1 H12 sing N N 117 EDO O1 HO1 sing N N 118 EDO C2 O2 sing N N 119 EDO C2 H21 sing N N 120 EDO C2 H22 sing N N 121 EDO O2 HO2 sing N N 122 GLN N CA sing N N 123 GLN N H sing N N 124 GLN N H2 sing N N 125 GLN CA C sing N N 126 GLN CA CB sing N N 127 GLN CA HA sing N N 128 GLN C O doub N N 129 GLN C OXT sing N N 130 GLN CB CG sing N N 131 GLN CB HB2 sing N N 132 GLN CB HB3 sing N N 133 GLN CG CD sing N N 134 GLN CG HG2 sing N N 135 GLN CG HG3 sing N N 136 GLN CD OE1 doub N N 137 GLN CD NE2 sing N N 138 GLN NE2 HE21 sing N N 139 GLN NE2 HE22 sing N N 140 GLN OXT HXT sing N N 141 GLU N CA sing N N 142 GLU N H sing N N 143 GLU N H2 sing N N 144 GLU CA C sing N N 145 GLU CA CB sing N N 146 GLU CA HA sing N N 147 GLU C O doub N N 148 GLU C OXT sing N N 149 GLU CB CG sing N N 150 GLU CB HB2 sing N N 151 GLU CB HB3 sing N N 152 GLU CG CD sing N N 153 GLU CG HG2 sing N N 154 GLU CG HG3 sing N N 155 GLU CD OE1 doub N N 156 GLU CD OE2 sing N N 157 GLU OE2 HE2 sing N N 158 GLU OXT HXT sing N N 159 GLY N CA sing N N 160 GLY N H sing N N 161 GLY N H2 sing N N 162 GLY CA C sing N N 163 GLY CA HA2 sing N N 164 GLY CA HA3 sing N N 165 GLY C O doub N N 166 GLY C OXT sing N N 167 GLY OXT HXT sing N N 168 HIS N CA sing N N 169 HIS N H sing N N 170 HIS N H2 sing N N 171 HIS CA C sing N N 172 HIS CA CB sing N N 173 HIS CA HA sing N N 174 HIS C O doub N N 175 HIS C OXT sing N N 176 HIS CB CG sing N N 177 HIS CB HB2 sing N N 178 HIS CB HB3 sing N N 179 HIS CG ND1 sing Y N 180 HIS CG CD2 doub Y N 181 HIS ND1 CE1 doub Y N 182 HIS ND1 HD1 sing N N 183 HIS CD2 NE2 sing Y N 184 HIS CD2 HD2 sing N N 185 HIS CE1 NE2 sing Y N 186 HIS CE1 HE1 sing N N 187 HIS NE2 HE2 sing N N 188 HIS OXT HXT sing N N 189 HOH O H1 sing N N 190 HOH O H2 sing N N 191 ILE N CA sing N N 192 ILE N H sing N N 193 ILE N H2 sing N N 194 ILE CA C sing N N 195 ILE CA CB sing N N 196 ILE CA HA sing N N 197 ILE C O doub N N 198 ILE C OXT sing N N 199 ILE CB CG1 sing N N 200 ILE CB CG2 sing N N 201 ILE CB HB sing N N 202 ILE CG1 CD1 sing N N 203 ILE CG1 HG12 sing N N 204 ILE CG1 HG13 sing N N 205 ILE CG2 HG21 sing N N 206 ILE CG2 HG22 sing N N 207 ILE CG2 HG23 sing N N 208 ILE CD1 HD11 sing N N 209 ILE CD1 HD12 sing N N 210 ILE CD1 HD13 sing N N 211 ILE OXT HXT sing N N 212 LEU N CA sing N N 213 LEU N H sing N N 214 LEU N H2 sing N N 215 LEU CA C sing N N 216 LEU CA CB sing N N 217 LEU CA HA sing N N 218 LEU C O doub N N 219 LEU C OXT sing N N 220 LEU CB CG sing N N 221 LEU CB HB2 sing N N 222 LEU CB HB3 sing N N 223 LEU CG CD1 sing N N 224 LEU CG CD2 sing N N 225 LEU CG HG sing N N 226 LEU CD1 HD11 sing N N 227 LEU CD1 HD12 sing N N 228 LEU CD1 HD13 sing N N 229 LEU CD2 HD21 sing N N 230 LEU CD2 HD22 sing N N 231 LEU CD2 HD23 sing N N 232 LEU OXT HXT sing N N 233 LYS N CA sing N N 234 LYS N H sing N N 235 LYS N H2 sing N N 236 LYS CA C sing N N 237 LYS CA CB sing N N 238 LYS CA HA sing N N 239 LYS C O doub N N 240 LYS C OXT sing N N 241 LYS CB CG sing N N 242 LYS CB HB2 sing N N 243 LYS CB HB3 sing N N 244 LYS CG CD sing N N 245 LYS CG HG2 sing N N 246 LYS CG HG3 sing N N 247 LYS CD CE sing N N 248 LYS CD HD2 sing N N 249 LYS CD HD3 sing N N 250 LYS CE NZ sing N N 251 LYS CE HE2 sing N N 252 LYS CE HE3 sing N N 253 LYS NZ HZ1 sing N N 254 LYS NZ HZ2 sing N N 255 LYS NZ HZ3 sing N N 256 LYS OXT HXT sing N N 257 MET N CA sing N N 258 MET N H sing N N 259 MET N H2 sing N N 260 MET CA C sing N N 261 MET CA CB sing N N 262 MET CA HA sing N N 263 MET C O doub N N 264 MET C OXT sing N N 265 MET CB CG sing N N 266 MET CB HB2 sing N N 267 MET CB HB3 sing N N 268 MET CG SD sing N N 269 MET CG HG2 sing N N 270 MET CG HG3 sing N N 271 MET SD CE sing N N 272 MET CE HE1 sing N N 273 MET CE HE2 sing N N 274 MET CE HE3 sing N N 275 MET OXT HXT sing N N 276 PHE N CA sing N N 277 PHE N H sing N N 278 PHE N H2 sing N N 279 PHE CA C sing N N 280 PHE CA CB sing N N 281 PHE CA HA sing N N 282 PHE C O doub N N 283 PHE C OXT sing N N 284 PHE CB CG sing N N 285 PHE CB HB2 sing N N 286 PHE CB HB3 sing N N 287 PHE CG CD1 doub Y N 288 PHE CG CD2 sing Y N 289 PHE CD1 CE1 sing Y N 290 PHE CD1 HD1 sing N N 291 PHE CD2 CE2 doub Y N 292 PHE CD2 HD2 sing N N 293 PHE CE1 CZ doub Y N 294 PHE CE1 HE1 sing N N 295 PHE CE2 CZ sing Y N 296 PHE CE2 HE2 sing N N 297 PHE CZ HZ sing N N 298 PHE OXT HXT sing N N 299 PRO N CA sing N N 300 PRO N CD sing N N 301 PRO N H sing N N 302 PRO CA C sing N N 303 PRO CA CB sing N N 304 PRO CA HA sing N N 305 PRO C O doub N N 306 PRO C OXT sing N N 307 PRO CB CG sing N N 308 PRO CB HB2 sing N N 309 PRO CB HB3 sing N N 310 PRO CG CD sing N N 311 PRO CG HG2 sing N N 312 PRO CG HG3 sing N N 313 PRO CD HD2 sing N N 314 PRO CD HD3 sing N N 315 PRO OXT HXT sing N N 316 SER N CA sing N N 317 SER N H sing N N 318 SER N H2 sing N N 319 SER CA C sing N N 320 SER CA CB sing N N 321 SER CA HA sing N N 322 SER C O doub N N 323 SER C OXT sing N N 324 SER CB OG sing N N 325 SER CB HB2 sing N N 326 SER CB HB3 sing N N 327 SER OG HG sing N N 328 SER OXT HXT sing N N 329 THR N CA sing N N 330 THR N H sing N N 331 THR N H2 sing N N 332 THR CA C sing N N 333 THR CA CB sing N N 334 THR CA HA sing N N 335 THR C O doub N N 336 THR C OXT sing N N 337 THR CB OG1 sing N N 338 THR CB CG2 sing N N 339 THR CB HB sing N N 340 THR OG1 HG1 sing N N 341 THR CG2 HG21 sing N N 342 THR CG2 HG22 sing N N 343 THR CG2 HG23 sing N N 344 THR OXT HXT sing N N 345 TRP N CA sing N N 346 TRP N H sing N N 347 TRP N H2 sing N N 348 TRP CA C sing N N 349 TRP CA CB sing N N 350 TRP CA HA sing N N 351 TRP C O doub N N 352 TRP C OXT sing N N 353 TRP CB CG sing N N 354 TRP CB HB2 sing N N 355 TRP CB HB3 sing N N 356 TRP CG CD1 doub Y N 357 TRP CG CD2 sing Y N 358 TRP CD1 NE1 sing Y N 359 TRP CD1 HD1 sing N N 360 TRP CD2 CE2 doub Y N 361 TRP CD2 CE3 sing Y N 362 TRP NE1 CE2 sing Y N 363 TRP NE1 HE1 sing N N 364 TRP CE2 CZ2 sing Y N 365 TRP CE3 CZ3 doub Y N 366 TRP CE3 HE3 sing N N 367 TRP CZ2 CH2 doub Y N 368 TRP CZ2 HZ2 sing N N 369 TRP CZ3 CH2 sing Y N 370 TRP CZ3 HZ3 sing N N 371 TRP CH2 HH2 sing N N 372 TRP OXT HXT sing N N 373 TYR N CA sing N N 374 TYR N H sing N N 375 TYR N H2 sing N N 376 TYR CA C sing N N 377 TYR CA CB sing N N 378 TYR CA HA sing N N 379 TYR C O doub N N 380 TYR C OXT sing N N 381 TYR CB CG sing N N 382 TYR CB HB2 sing N N 383 TYR CB HB3 sing N N 384 TYR CG CD1 doub Y N 385 TYR CG CD2 sing Y N 386 TYR CD1 CE1 sing Y N 387 TYR CD1 HD1 sing N N 388 TYR CD2 CE2 doub Y N 389 TYR CD2 HD2 sing N N 390 TYR CE1 CZ doub Y N 391 TYR CE1 HE1 sing N N 392 TYR CE2 CZ sing Y N 393 TYR CE2 HE2 sing N N 394 TYR CZ OH sing N N 395 TYR OH HH sing N N 396 TYR OXT HXT sing N N 397 VAL N CA sing N N 398 VAL N H sing N N 399 VAL N H2 sing N N 400 VAL CA C sing N N 401 VAL CA CB sing N N 402 VAL CA HA sing N N 403 VAL C O doub N N 404 VAL C OXT sing N N 405 VAL CB CG1 sing N N 406 VAL CB CG2 sing N N 407 VAL CB HB sing N N 408 VAL CG1 HG11 sing N N 409 VAL CG1 HG12 sing N N 410 VAL CG1 HG13 sing N N 411 VAL CG2 HG21 sing N N 412 VAL CG2 HG22 sing N N 413 VAL CG2 HG23 sing N N 414 VAL OXT HXT sing N N 415 # _pdbx_audit_support.funding_organization 'Polish National Science Centre' _pdbx_audit_support.country Poland _pdbx_audit_support.grant_number 2012/05/B/ST5/00278 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1BSY _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7BGZ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.018671 _atom_sites.fract_transf_matrix[1][2] 0.010780 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021559 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009019 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 0.867 # loop_