data_7BKN # _entry.id 7BKN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7BKN pdb_00007bkn 10.2210/pdb7bkn/pdb WWPDB D_1292113537 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-07-07 2 'Structure model' 1 1 2021-08-04 3 'Structure model' 1 2 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7BKN _pdbx_database_status.recvd_initial_deposition_date 2021-01-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 7bjd unspecified PDB . 7bje unspecified PDB . 7bjh unspecified PDB . 7bjj unspecified PDB . 7bjm unspecified PDB . 7bjo unspecified PDB . 7bjr unspecified PDB . 7bjx unspecified PDB . 7bk1 unspecified PDB . 7bk2 unspecified PDB . 7bk3 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Baker, L.M.' 1 0000-0003-2002-0941 'Surgenor, A.E.' 2 0000-0002-9869-1430 'Williamson, D.S.' 3 0000-0002-5094-5200 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 64 _citation.language ? _citation.page_first 10312 _citation.page_last 10332 _citation.title ;Design and Synthesis of Pyrrolo[2,3- d ]pyrimidine-Derived Leucine-Rich Repeat Kinase 2 (LRRK2) Inhibitors Using a Checkpoint Kinase 1 (CHK1)-Derived Crystallographic Surrogate. ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.1c00720 _citation.pdbx_database_id_PubMed 34184879 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Williamson, D.S.' 1 ? primary 'Smith, G.P.' 2 ? primary 'Mikkelsen, G.K.' 3 ? primary 'Jensen, T.' 4 ? primary 'Acheson-Dossang, P.' 5 ? primary 'Badolo, L.' 6 ? primary 'Bedford, S.T.' 7 ? primary 'Chell, V.' 8 ? primary 'Chen, I.J.' 9 ? primary 'Dokurno, P.' 10 ? primary 'Hentzer, M.' 11 ? primary 'Newland, S.' 12 ? primary 'Ray, S.C.' 13 ? primary 'Shaw, T.' 14 ? primary 'Surgenor, A.E.' 15 ? primary 'Terry, L.' 16 ? primary 'Wang, Y.' 17 ? primary 'Christensen, K.V.' 18 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Serine/threonine-protein kinase Chk1' 34148.148 1 2.7.11.1 ? ? ? 2 non-polymer syn ADENINE 135.127 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 water nat water 18.015 50 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CHK1 checkpoint homolog,Cell cycle checkpoint kinase,Checkpoint kinase-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINKMLNHENVVKFYGHRREGNIQ YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNR ERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA LLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGHHHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINKMLNHENVVKFYGHRREGNIQ YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNR ERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA LLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGHHHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ADENINE ADE 3 'SULFATE ION' SO4 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 VAL n 1 4 PRO n 1 5 PHE n 1 6 VAL n 1 7 GLU n 1 8 ASP n 1 9 TRP n 1 10 ASP n 1 11 LEU n 1 12 VAL n 1 13 GLN n 1 14 THR n 1 15 LEU n 1 16 GLY n 1 17 GLU n 1 18 GLY n 1 19 ALA n 1 20 TYR n 1 21 GLY n 1 22 GLU n 1 23 VAL n 1 24 GLN n 1 25 LEU n 1 26 ALA n 1 27 VAL n 1 28 ASN n 1 29 ARG n 1 30 VAL n 1 31 THR n 1 32 GLU n 1 33 GLU n 1 34 ALA n 1 35 VAL n 1 36 ALA n 1 37 VAL n 1 38 LYS n 1 39 ILE n 1 40 VAL n 1 41 ASP n 1 42 MET n 1 43 LYS n 1 44 ARG n 1 45 ALA n 1 46 VAL n 1 47 ASP n 1 48 CYS n 1 49 PRO n 1 50 GLU n 1 51 ASN n 1 52 ILE n 1 53 LYS n 1 54 LYS n 1 55 GLU n 1 56 ILE n 1 57 CYS n 1 58 ILE n 1 59 ASN n 1 60 LYS n 1 61 MET n 1 62 LEU n 1 63 ASN n 1 64 HIS n 1 65 GLU n 1 66 ASN n 1 67 VAL n 1 68 VAL n 1 69 LYS n 1 70 PHE n 1 71 TYR n 1 72 GLY n 1 73 HIS n 1 74 ARG n 1 75 ARG n 1 76 GLU n 1 77 GLY n 1 78 ASN n 1 79 ILE n 1 80 GLN n 1 81 TYR n 1 82 LEU n 1 83 PHE n 1 84 LEU n 1 85 GLU n 1 86 TYR n 1 87 CYS n 1 88 SER n 1 89 GLY n 1 90 GLY n 1 91 GLU n 1 92 LEU n 1 93 PHE n 1 94 ASP n 1 95 ARG n 1 96 ILE n 1 97 GLU n 1 98 PRO n 1 99 ASP n 1 100 ILE n 1 101 GLY n 1 102 MET n 1 103 PRO n 1 104 GLU n 1 105 PRO n 1 106 ASP n 1 107 ALA n 1 108 GLN n 1 109 ARG n 1 110 PHE n 1 111 PHE n 1 112 HIS n 1 113 GLN n 1 114 LEU n 1 115 MET n 1 116 ALA n 1 117 GLY n 1 118 VAL n 1 119 VAL n 1 120 TYR n 1 121 LEU n 1 122 HIS n 1 123 GLY n 1 124 ILE n 1 125 GLY n 1 126 ILE n 1 127 THR n 1 128 HIS n 1 129 ARG n 1 130 ASP n 1 131 ILE n 1 132 LYS n 1 133 PRO n 1 134 GLU n 1 135 ASN n 1 136 LEU n 1 137 LEU n 1 138 LEU n 1 139 ASP n 1 140 GLU n 1 141 ARG n 1 142 ASP n 1 143 ASN n 1 144 LEU n 1 145 LYS n 1 146 ILE n 1 147 SER n 1 148 ASP n 1 149 PHE n 1 150 GLY n 1 151 LEU n 1 152 ALA n 1 153 THR n 1 154 VAL n 1 155 PHE n 1 156 ARG n 1 157 TYR n 1 158 ASN n 1 159 ASN n 1 160 ARG n 1 161 GLU n 1 162 ARG n 1 163 LEU n 1 164 LEU n 1 165 ASN n 1 166 LYS n 1 167 MET n 1 168 CYS n 1 169 GLY n 1 170 THR n 1 171 LEU n 1 172 PRO n 1 173 TYR n 1 174 VAL n 1 175 ALA n 1 176 PRO n 1 177 GLU n 1 178 LEU n 1 179 LEU n 1 180 LYS n 1 181 ARG n 1 182 ARG n 1 183 GLU n 1 184 PHE n 1 185 HIS n 1 186 ALA n 1 187 GLU n 1 188 PRO n 1 189 VAL n 1 190 ASP n 1 191 VAL n 1 192 TRP n 1 193 SER n 1 194 CYS n 1 195 GLY n 1 196 ILE n 1 197 VAL n 1 198 LEU n 1 199 THR n 1 200 ALA n 1 201 MET n 1 202 LEU n 1 203 ALA n 1 204 GLY n 1 205 GLU n 1 206 LEU n 1 207 PRO n 1 208 TRP n 1 209 ASP n 1 210 GLN n 1 211 PRO n 1 212 SER n 1 213 ASP n 1 214 SER n 1 215 CYS n 1 216 GLN n 1 217 GLU n 1 218 TYR n 1 219 SER n 1 220 ASP n 1 221 TRP n 1 222 LYS n 1 223 GLU n 1 224 LYS n 1 225 LYS n 1 226 THR n 1 227 TYR n 1 228 LEU n 1 229 ASN n 1 230 PRO n 1 231 TRP n 1 232 LYS n 1 233 LYS n 1 234 ILE n 1 235 ASP n 1 236 SER n 1 237 ALA n 1 238 PRO n 1 239 LEU n 1 240 ALA n 1 241 LEU n 1 242 LEU n 1 243 HIS n 1 244 LYS n 1 245 ILE n 1 246 LEU n 1 247 VAL n 1 248 GLU n 1 249 ASN n 1 250 PRO n 1 251 SER n 1 252 ALA n 1 253 ARG n 1 254 ILE n 1 255 THR n 1 256 ILE n 1 257 PRO n 1 258 ASP n 1 259 ILE n 1 260 LYS n 1 261 LYS n 1 262 ASP n 1 263 ARG n 1 264 TRP n 1 265 TYR n 1 266 ASN n 1 267 LYS n 1 268 PRO n 1 269 LEU n 1 270 LYS n 1 271 LYS n 1 272 GLY n 1 273 ALA n 1 274 LYS n 1 275 ARG n 1 276 PRO n 1 277 ARG n 1 278 VAL n 1 279 THR n 1 280 SER n 1 281 GLY n 1 282 GLY n 1 283 VAL n 1 284 SER n 1 285 GLU n 1 286 SER n 1 287 PRO n 1 288 SER n 1 289 GLY n 1 290 HIS n 1 291 HIS n 1 292 HIS n 1 293 HIS n 1 294 HIS n 1 295 HIS n 1 296 HIS n 1 297 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 297 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CHEK1, CHK1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line Sf9 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Baculovirus _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details 'CHK1 1-289 C8H' _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name Pfastbac1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ADE non-polymer . ADENINE ? 'C5 H5 N5' 135.127 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 VAL 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 PHE 5 5 ? ? ? A . n A 1 6 VAL 6 6 ? ? ? A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 TRP 9 9 9 TRP TRP A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 ALA 45 45 ? ? ? A . n A 1 46 VAL 46 46 ? ? ? A . n A 1 47 ASP 47 47 ? ? ? A . n A 1 48 CYS 48 48 ? ? ? A . n A 1 49 PRO 49 49 ? ? ? A . n A 1 50 GLU 50 50 ? ? ? A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 CYS 87 87 87 CYS CYS A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 MET 102 102 102 MET MET A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 HIS 112 112 112 HIS HIS A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 MET 115 115 115 MET MET A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 TYR 120 120 120 TYR TYR A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 ASN 143 143 143 ASN ASN A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 PHE 149 149 149 PHE PHE A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 ASN 158 158 158 ASN ASN A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 ASN 165 165 165 ASN ASN A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 MET 167 167 167 MET MET A . n A 1 168 CYS 168 168 168 CYS CYS A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 PRO 172 172 172 PRO PRO A . n A 1 173 TYR 173 173 173 TYR TYR A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 PRO 176 176 176 PRO PRO A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 LYS 180 180 180 LYS LYS A . n A 1 181 ARG 181 181 181 ARG ARG A . n A 1 182 ARG 182 182 182 ARG ARG A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 PHE 184 184 184 PHE PHE A . n A 1 185 HIS 185 185 185 HIS HIS A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 GLU 187 187 187 GLU GLU A . n A 1 188 PRO 188 188 188 PRO PRO A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 ASP 190 190 190 ASP ASP A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 TRP 192 192 192 TRP TRP A . n A 1 193 SER 193 193 193 SER SER A . n A 1 194 CYS 194 194 194 CYS CYS A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 ALA 200 200 200 ALA ALA A . n A 1 201 MET 201 201 201 MET MET A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 GLY 204 204 204 GLY GLY A . n A 1 205 GLU 205 205 205 GLU GLU A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 PRO 207 207 207 PRO PRO A . n A 1 208 TRP 208 208 208 TRP TRP A . n A 1 209 ASP 209 209 209 ASP ASP A . n A 1 210 GLN 210 210 210 GLN GLN A . n A 1 211 PRO 211 211 211 PRO PRO A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 ASP 213 213 213 ASP ASP A . n A 1 214 SER 214 214 214 SER SER A . n A 1 215 CYS 215 215 215 CYS CYS A . n A 1 216 GLN 216 216 216 GLN GLN A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 TYR 218 218 218 TYR TYR A . n A 1 219 SER 219 219 219 SER SER A . n A 1 220 ASP 220 220 220 ASP ASP A . n A 1 221 TRP 221 221 221 TRP TRP A . n A 1 222 LYS 222 222 222 LYS LYS A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 LYS 224 224 224 LYS LYS A . n A 1 225 LYS 225 225 225 LYS LYS A . n A 1 226 THR 226 226 226 THR THR A . n A 1 227 TYR 227 227 227 TYR TYR A . n A 1 228 LEU 228 228 228 LEU LEU A . n A 1 229 ASN 229 229 229 ASN ASN A . n A 1 230 PRO 230 230 230 PRO PRO A . n A 1 231 TRP 231 231 231 TRP TRP A . n A 1 232 LYS 232 232 232 LYS LYS A . n A 1 233 LYS 233 233 233 LYS LYS A . n A 1 234 ILE 234 234 234 ILE ILE A . n A 1 235 ASP 235 235 235 ASP ASP A . n A 1 236 SER 236 236 236 SER SER A . n A 1 237 ALA 237 237 237 ALA ALA A . n A 1 238 PRO 238 238 238 PRO PRO A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 ALA 240 240 240 ALA ALA A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 LEU 242 242 242 LEU LEU A . n A 1 243 HIS 243 243 243 HIS HIS A . n A 1 244 LYS 244 244 244 LYS LYS A . n A 1 245 ILE 245 245 245 ILE ILE A . n A 1 246 LEU 246 246 246 LEU LEU A . n A 1 247 VAL 247 247 247 VAL VAL A . n A 1 248 GLU 248 248 248 GLU GLU A . n A 1 249 ASN 249 249 249 ASN ASN A . n A 1 250 PRO 250 250 250 PRO PRO A . n A 1 251 SER 251 251 251 SER SER A . n A 1 252 ALA 252 252 252 ALA ALA A . n A 1 253 ARG 253 253 253 ARG ARG A . n A 1 254 ILE 254 254 254 ILE ILE A . n A 1 255 THR 255 255 255 THR THR A . n A 1 256 ILE 256 256 256 ILE ILE A . n A 1 257 PRO 257 257 257 PRO PRO A . n A 1 258 ASP 258 258 258 ASP ASP A . n A 1 259 ILE 259 259 259 ILE ILE A . n A 1 260 LYS 260 260 260 LYS LYS A . n A 1 261 LYS 261 261 261 LYS LYS A . n A 1 262 ASP 262 262 262 ASP ASP A . n A 1 263 ARG 263 263 263 ARG ARG A . n A 1 264 TRP 264 264 264 TRP TRP A . n A 1 265 TYR 265 265 265 TYR TYR A . n A 1 266 ASN 266 266 266 ASN ASN A . n A 1 267 LYS 267 267 267 LYS LYS A . n A 1 268 PRO 268 268 268 PRO PRO A . n A 1 269 LEU 269 269 269 LEU LEU A . n A 1 270 LYS 270 270 270 LYS LYS A . n A 1 271 LYS 271 271 271 LYS LYS A . n A 1 272 GLY 272 272 ? ? ? A . n A 1 273 ALA 273 273 ? ? ? A . n A 1 274 LYS 274 274 ? ? ? A . n A 1 275 ARG 275 275 ? ? ? A . n A 1 276 PRO 276 276 ? ? ? A . n A 1 277 ARG 277 277 ? ? ? A . n A 1 278 VAL 278 278 ? ? ? A . n A 1 279 THR 279 279 ? ? ? A . n A 1 280 SER 280 280 ? ? ? A . n A 1 281 GLY 281 281 ? ? ? A . n A 1 282 GLY 282 282 ? ? ? A . n A 1 283 VAL 283 283 ? ? ? A . n A 1 284 SER 284 284 ? ? ? A . n A 1 285 GLU 285 285 ? ? ? A . n A 1 286 SER 286 286 ? ? ? A . n A 1 287 PRO 287 287 ? ? ? A . n A 1 288 SER 288 288 ? ? ? A . n A 1 289 GLY 289 289 ? ? ? A . n A 1 290 HIS 290 290 ? ? ? A . n A 1 291 HIS 291 291 ? ? ? A . n A 1 292 HIS 292 292 ? ? ? A . n A 1 293 HIS 293 293 ? ? ? A . n A 1 294 HIS 294 294 ? ? ? A . n A 1 295 HIS 295 295 ? ? ? A . n A 1 296 HIS 296 296 ? ? ? A . n A 1 297 HIS 297 297 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ADE 1 301 1272 ADE UNL A . C 3 SO4 1 302 1273 SO4 SO4 A . D 4 HOH 1 401 2040 HOH HOH A . D 4 HOH 2 402 2047 HOH HOH A . D 4 HOH 3 403 2002 HOH HOH A . D 4 HOH 4 404 2022 HOH HOH A . D 4 HOH 5 405 2019 HOH HOH A . D 4 HOH 6 406 2017 HOH HOH A . D 4 HOH 7 407 2001 HOH HOH A . D 4 HOH 8 408 2033 HOH HOH A . D 4 HOH 9 409 2010 HOH HOH A . D 4 HOH 10 410 2042 HOH HOH A . D 4 HOH 11 411 2025 HOH HOH A . D 4 HOH 12 412 2006 HOH HOH A . D 4 HOH 13 413 2048 HOH HOH A . D 4 HOH 14 414 2024 HOH HOH A . D 4 HOH 15 415 2029 HOH HOH A . D 4 HOH 16 416 2031 HOH HOH A . D 4 HOH 17 417 2015 HOH HOH A . D 4 HOH 18 418 2003 HOH HOH A . D 4 HOH 19 419 2020 HOH HOH A . D 4 HOH 20 420 2034 HOH HOH A . D 4 HOH 21 421 2037 HOH HOH A . D 4 HOH 22 422 2036 HOH HOH A . D 4 HOH 23 423 2005 HOH HOH A . D 4 HOH 24 424 2007 HOH HOH A . D 4 HOH 25 425 2016 HOH HOH A . D 4 HOH 26 426 2012 HOH HOH A . D 4 HOH 27 427 2027 HOH HOH A . D 4 HOH 28 428 2045 HOH HOH A . D 4 HOH 29 429 2041 HOH HOH A . D 4 HOH 30 430 2046 HOH HOH A . D 4 HOH 31 431 2028 HOH HOH A . D 4 HOH 32 432 2039 HOH HOH A . D 4 HOH 33 433 2049 HOH HOH A . D 4 HOH 34 434 2009 HOH HOH A . D 4 HOH 35 435 2008 HOH HOH A . D 4 HOH 36 436 2044 HOH HOH A . D 4 HOH 37 437 2038 HOH HOH A . D 4 HOH 38 438 2043 HOH HOH A . D 4 HOH 39 439 2004 HOH HOH A . D 4 HOH 40 440 2030 HOH HOH A . D 4 HOH 41 441 2035 HOH HOH A . D 4 HOH 42 442 2021 HOH HOH A . D 4 HOH 43 443 2023 HOH HOH A . D 4 HOH 44 444 2026 HOH HOH A . D 4 HOH 45 445 2011 HOH HOH A . D 4 HOH 46 446 2018 HOH HOH A . D 4 HOH 47 447 2032 HOH HOH A . D 4 HOH 48 448 2014 HOH HOH A . D 4 HOH 49 449 2050 HOH HOH A . D 4 HOH 50 450 2013 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 7 ? CG ? A GLU 7 CG 2 1 Y 1 A GLU 7 ? CD ? A GLU 7 CD 3 1 Y 1 A GLU 7 ? OE1 ? A GLU 7 OE1 4 1 Y 1 A GLU 7 ? OE2 ? A GLU 7 OE2 5 1 Y 1 A GLU 17 ? CG ? A GLU 17 CG 6 1 Y 1 A GLU 17 ? CD ? A GLU 17 CD 7 1 Y 1 A GLU 17 ? OE1 ? A GLU 17 OE1 8 1 Y 1 A GLU 17 ? OE2 ? A GLU 17 OE2 9 1 Y 1 A TYR 20 ? CG ? A TYR 20 CG 10 1 Y 1 A TYR 20 ? CD1 ? A TYR 20 CD1 11 1 Y 1 A TYR 20 ? CD2 ? A TYR 20 CD2 12 1 Y 1 A TYR 20 ? CE1 ? A TYR 20 CE1 13 1 Y 1 A TYR 20 ? CE2 ? A TYR 20 CE2 14 1 Y 1 A TYR 20 ? CZ ? A TYR 20 CZ 15 1 Y 1 A TYR 20 ? OH ? A TYR 20 OH 16 1 Y 1 A GLU 22 ? CG ? A GLU 22 CG 17 1 Y 1 A GLU 22 ? CD ? A GLU 22 CD 18 1 Y 1 A GLU 22 ? OE1 ? A GLU 22 OE1 19 1 Y 1 A GLU 22 ? OE2 ? A GLU 22 OE2 20 1 Y 1 A ARG 29 ? CG ? A ARG 29 CG 21 1 Y 1 A ARG 29 ? CD ? A ARG 29 CD 22 1 Y 1 A ARG 29 ? NE ? A ARG 29 NE 23 1 Y 1 A ARG 29 ? CZ ? A ARG 29 CZ 24 1 Y 1 A ARG 29 ? NH1 ? A ARG 29 NH1 25 1 Y 1 A ARG 29 ? NH2 ? A ARG 29 NH2 26 1 Y 1 A GLU 33 ? CG ? A GLU 33 CG 27 1 Y 1 A GLU 33 ? CD ? A GLU 33 CD 28 1 Y 1 A GLU 33 ? OE1 ? A GLU 33 OE1 29 1 Y 1 A GLU 33 ? OE2 ? A GLU 33 OE2 30 1 Y 1 A LYS 43 ? CG ? A LYS 43 CG 31 1 Y 1 A LYS 43 ? CD ? A LYS 43 CD 32 1 Y 1 A LYS 43 ? CE ? A LYS 43 CE 33 1 Y 1 A LYS 43 ? NZ ? A LYS 43 NZ 34 1 Y 1 A ARG 44 ? CG ? A ARG 44 CG 35 1 Y 1 A ARG 44 ? CD ? A ARG 44 CD 36 1 Y 1 A ARG 44 ? NE ? A ARG 44 NE 37 1 Y 1 A ARG 44 ? CZ ? A ARG 44 CZ 38 1 Y 1 A ARG 44 ? NH1 ? A ARG 44 NH1 39 1 Y 1 A ARG 44 ? NH2 ? A ARG 44 NH2 40 1 Y 1 A ASN 51 ? CG ? A ASN 51 CG 41 1 Y 1 A ASN 51 ? OD1 ? A ASN 51 OD1 42 1 Y 1 A ASN 51 ? ND2 ? A ASN 51 ND2 43 1 Y 1 A LYS 53 ? CG ? A LYS 53 CG 44 1 Y 1 A LYS 53 ? CD ? A LYS 53 CD 45 1 Y 1 A LYS 53 ? CE ? A LYS 53 CE 46 1 Y 1 A LYS 53 ? NZ ? A LYS 53 NZ 47 1 Y 1 A LYS 69 ? CG ? A LYS 69 CG 48 1 Y 1 A LYS 69 ? CD ? A LYS 69 CD 49 1 Y 1 A LYS 69 ? CE ? A LYS 69 CE 50 1 Y 1 A LYS 69 ? NZ ? A LYS 69 NZ 51 1 Y 1 A ARG 74 ? CG ? A ARG 74 CG 52 1 Y 1 A ARG 74 ? CD ? A ARG 74 CD 53 1 Y 1 A ARG 74 ? NE ? A ARG 74 NE 54 1 Y 1 A ARG 74 ? CZ ? A ARG 74 CZ 55 1 Y 1 A ARG 74 ? NH1 ? A ARG 74 NH1 56 1 Y 1 A ARG 74 ? NH2 ? A ARG 74 NH2 57 1 Y 1 A ARG 75 ? CG ? A ARG 75 CG 58 1 Y 1 A ARG 75 ? CD ? A ARG 75 CD 59 1 Y 1 A ARG 75 ? NE ? A ARG 75 NE 60 1 Y 1 A ARG 75 ? CZ ? A ARG 75 CZ 61 1 Y 1 A ARG 75 ? NH1 ? A ARG 75 NH1 62 1 Y 1 A ARG 75 ? NH2 ? A ARG 75 NH2 63 1 Y 1 A ASP 99 ? CG ? A ASP 99 CG 64 1 Y 1 A ASP 99 ? OD1 ? A ASP 99 OD1 65 1 Y 1 A ASP 99 ? OD2 ? A ASP 99 OD2 66 1 Y 1 A ARG 141 ? CG ? A ARG 141 CG 67 1 Y 1 A ARG 141 ? CD ? A ARG 141 CD 68 1 Y 1 A ARG 141 ? NE ? A ARG 141 NE 69 1 Y 1 A ARG 141 ? CZ ? A ARG 141 CZ 70 1 Y 1 A ARG 141 ? NH1 ? A ARG 141 NH1 71 1 Y 1 A ARG 141 ? NH2 ? A ARG 141 NH2 72 1 Y 1 A LYS 180 ? CG ? A LYS 180 CG 73 1 Y 1 A LYS 180 ? CD ? A LYS 180 CD 74 1 Y 1 A LYS 180 ? CE ? A LYS 180 CE 75 1 Y 1 A LYS 180 ? NZ ? A LYS 180 NZ 76 1 Y 1 A GLU 205 ? CG ? A GLU 205 CG 77 1 Y 1 A GLU 205 ? CD ? A GLU 205 CD 78 1 Y 1 A GLU 205 ? OE1 ? A GLU 205 OE1 79 1 Y 1 A GLU 205 ? OE2 ? A GLU 205 OE2 80 1 Y 1 A LYS 270 ? CG ? A LYS 270 CG 81 1 Y 1 A LYS 270 ? CD ? A LYS 270 CD 82 1 Y 1 A LYS 270 ? CE ? A LYS 270 CE 83 1 Y 1 A LYS 270 ? NZ ? A LYS 270 NZ 84 1 Y 1 A LYS 271 ? CG ? A LYS 271 CG 85 1 Y 1 A LYS 271 ? CD ? A LYS 271 CD 86 1 Y 1 A LYS 271 ? CE ? A LYS 271 CE 87 1 Y 1 A LYS 271 ? NZ ? A LYS 271 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.16 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? AMoRE ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 102.810 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7BKN _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.640 _cell.length_a_esd ? _cell.length_b 65.057 _cell.length_b_esd ? _cell.length_c 53.950 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7BKN _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7BKN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.24 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.02 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;10-30% PEG8K 0.1M HEPES pH 7.5 15% isopropanol ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR CCD 130 mm' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-06-16 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7BKN _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.740 _reflns.d_resolution_low 52.6600 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7615 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.900 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.088 _reflns.pdbx_netI_over_av_sigmaI 7.600 _reflns.pdbx_netI_over_sigmaI 9.500 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.108 _reflns.pdbx_Rpim_I_all 0.061 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.740 2.840 ? 1.400 2262 ? ? ? 766 96.900 ? ? ? ? 0.537 ? ? ? ? ? ? ? ? 3.000 0.537 ? ? 1.900 0.649 0.360 ? 1 1 ? ? ? 2.840 2.940 ? 1.900 2045 ? ? ? 705 95.400 ? ? ? ? 0.409 ? ? ? ? ? ? ? ? 2.900 0.409 ? ? 2.400 0.494 0.274 ? 2 1 ? ? ? 2.940 3.060 ? 2.300 2083 ? ? ? 705 95.800 ? ? ? ? 0.333 ? ? ? ? ? ? ? ? 3.000 0.333 ? ? 3.300 0.404 0.225 ? 3 1 ? ? ? 3.060 3.200 ? 2.900 1938 ? ? ? 668 95.000 ? ? ? ? 0.251 ? ? ? ? ? ? ? ? 2.900 0.251 ? ? 4.500 0.305 0.170 ? 4 1 ? ? ? 3.200 3.360 ? 3.300 1865 ? ? ? 644 96.400 ? ? ? ? 0.218 ? ? ? ? ? ? ? ? 2.900 0.218 ? ? 5.500 0.266 0.150 ? 5 1 ? ? ? 3.360 3.540 ? 4.200 1536 ? ? ? 582 94.700 ? ? ? ? 0.167 ? ? ? ? ? ? ? ? 2.600 0.167 ? ? 7.000 0.208 0.122 ? 6 1 ? ? ? 3.540 3.750 ? 7.200 1734 ? ? ? 583 95.400 ? ? ? ? 0.099 ? ? ? ? ? ? ? ? 3.000 0.099 ? ? 10.300 0.120 0.067 ? 7 1 ? ? ? 3.750 4.010 ? 9.000 1580 ? ? ? 534 95.100 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 3.000 0.078 ? ? 13.100 0.095 0.053 ? 8 1 ? ? ? 4.010 4.330 ? 11.800 1460 ? ? ? 502 95.000 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 2.900 0.058 ? ? 16.100 0.070 0.039 ? 9 1 ? ? ? 4.330 4.750 ? 12.300 1275 ? ? ? 455 93.100 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? 2.800 0.051 ? ? 17.300 0.062 0.034 ? 10 1 ? ? ? 4.750 5.310 ? 12.100 1052 ? ? ? 413 92.600 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? 2.500 0.051 ? ? 16.300 0.064 0.038 ? 11 1 ? ? ? 5.310 6.130 ? 13.900 1098 ? ? ? 365 94.300 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 3.000 0.048 ? ? 17.300 0.058 0.032 ? 12 1 ? ? ? 6.130 7.500 ? 17.300 923 ? ? ? 314 92.700 ? ? ? ? 0.039 ? ? ? ? ? ? ? ? 2.900 0.039 ? ? 18.300 0.047 0.027 ? 13 1 ? ? ? 7.500 10.610 ? 19.600 636 ? ? ? 243 93.200 ? ? ? ? 0.030 ? ? ? ? ? ? ? ? 2.600 0.030 ? ? 22.700 0.038 0.023 ? 14 1 ? ? ? 10.610 52.607 ? 21.900 385 ? ? ? 136 90.100 ? ? ? ? 0.026 ? ? ? ? ? ? ? ? 2.800 0.026 ? ? 23.900 0.032 0.018 ? 15 1 ? ? ? # _refine.aniso_B[1][1] -2.0800 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.5700 _refine.aniso_B[2][2] 1.4500 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.8000 _refine.B_iso_max 126.680 _refine.B_iso_mean 49.7700 _refine.B_iso_min 18.630 _refine.correlation_coeff_Fo_to_Fc 0.9360 _refine.correlation_coeff_Fo_to_Fc_free 0.8830 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7BKN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7400 _refine.ls_d_res_low 52.6600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7220 _refine.ls_number_reflns_R_free 384 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.7300 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2119 _refine.ls_R_factor_R_free 0.2800 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2085 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1IA8 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.4280 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 16.2920 _refine.overall_SU_ML 0.3160 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.7400 _refine_hist.d_res_low 52.6600 _refine_hist.number_atoms_solvent 50 _refine_hist.number_atoms_total 2092 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 259 _refine_hist.pdbx_B_iso_mean_ligand 77.18 _refine_hist.pdbx_B_iso_mean_solvent 39.32 _refine_hist.pdbx_number_atoms_protein 2027 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.013 2090 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1952 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.541 1.637 2843 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.348 1.581 4482 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.202 5.000 257 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.412 23.204 103 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 22.650 15.000 343 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 21.708 15.000 10 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.072 0.200 269 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 2357 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 464 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.7400 _refine_ls_shell.d_res_low 2.8110 _refine_ls_shell.number_reflns_all 585 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 30 _refine_ls_shell.number_reflns_R_work 555 _refine_ls_shell.percent_reflns_obs 96.2200 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4010 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3240 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7BKN _struct.title 'Crystal structure of CHK1 complex with adenine' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7BKN _struct_keywords.text ;PARKINSON'S DISEASE, LEUCINE-RICH REPEAT KINASE 2, LRRK2, CHECKPOINT KINASE 1, CHK1, MUTANT, SURROGATE, KINASE INHIBITOR, SBDD, TRANSFERASE ; _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CHK1_HUMAN _struct_ref.pdbx_db_accession O14757 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINKMLNHENVVKFYGHRREGNIQ YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNR ERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA LLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7BKN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 289 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14757 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 289 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 289 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7BKN HIS A 290 ? UNP O14757 ? ? 'expression tag' 290 1 1 7BKN HIS A 291 ? UNP O14757 ? ? 'expression tag' 291 2 1 7BKN HIS A 292 ? UNP O14757 ? ? 'expression tag' 292 3 1 7BKN HIS A 293 ? UNP O14757 ? ? 'expression tag' 293 4 1 7BKN HIS A 294 ? UNP O14757 ? ? 'expression tag' 294 5 1 7BKN HIS A 295 ? UNP O14757 ? ? 'expression tag' 295 6 1 7BKN HIS A 296 ? UNP O14757 ? ? 'expression tag' 296 7 1 7BKN HIS A 297 ? UNP O14757 ? ? 'expression tag' 297 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 520 ? 1 MORE -7 ? 1 'SSA (A^2)' 12540 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 52 ? LEU A 62 ? ILE A 52 LEU A 62 1 ? 11 HELX_P HELX_P2 AA2 PHE A 93 ? ARG A 95 ? PHE A 93 ARG A 95 5 ? 3 HELX_P HELX_P3 AA3 PRO A 103 ? ILE A 124 ? PRO A 103 ILE A 124 1 ? 22 HELX_P HELX_P4 AA4 LYS A 132 ? GLU A 134 ? LYS A 132 GLU A 134 5 ? 3 HELX_P HELX_P5 AA5 THR A 170 ? ALA A 175 ? THR A 170 ALA A 175 5 ? 6 HELX_P HELX_P6 AA6 PRO A 176 ? ARG A 181 ? PRO A 176 ARG A 181 1 ? 6 HELX_P HELX_P7 AA7 ALA A 186 ? GLY A 204 ? ALA A 186 GLY A 204 1 ? 19 HELX_P HELX_P8 AA8 CYS A 215 ? GLU A 223 ? CYS A 215 GLU A 223 1 ? 9 HELX_P HELX_P9 AA9 PRO A 230 ? ILE A 234 ? PRO A 230 ILE A 234 5 ? 5 HELX_P HELX_P10 AB1 ASP A 235 ? LEU A 246 ? ASP A 235 LEU A 246 1 ? 12 HELX_P HELX_P11 AB2 THR A 255 ? LYS A 260 ? THR A 255 LYS A 260 1 ? 6 HELX_P HELX_P12 AB3 ARG A 263 ? LYS A 267 ? ARG A 263 LYS A 267 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASN _struct_mon_prot_cis.label_seq_id 229 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASN _struct_mon_prot_cis.auth_seq_id 229 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 230 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 230 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -6.29 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TRP A 9 ? GLY A 16 ? TRP A 9 GLY A 16 AA1 2 GLU A 22 ? ASN A 28 ? GLU A 22 ASN A 28 AA1 3 ALA A 34 ? ASP A 41 ? ALA A 34 ASP A 41 AA1 4 ILE A 79 ? LEU A 84 ? ILE A 79 LEU A 84 AA1 5 PHE A 70 ? ARG A 74 ? PHE A 70 ARG A 74 AA2 1 GLY A 90 ? GLU A 91 ? GLY A 90 GLU A 91 AA2 2 LEU A 136 ? LEU A 138 ? LEU A 136 LEU A 138 AA2 3 LEU A 144 ? ILE A 146 ? LEU A 144 ILE A 146 AA3 1 ILE A 126 ? THR A 127 ? ILE A 126 THR A 127 AA3 2 THR A 153 ? VAL A 154 ? THR A 153 VAL A 154 AA4 1 ARG A 156 ? TYR A 157 ? ARG A 156 TYR A 157 AA4 2 ARG A 160 ? GLU A 161 ? ARG A 160 GLU A 161 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 12 ? N VAL A 12 O LEU A 25 ? O LEU A 25 AA1 2 3 N ALA A 26 ? N ALA A 26 O VAL A 35 ? O VAL A 35 AA1 3 4 N ALA A 36 ? N ALA A 36 O LEU A 84 ? O LEU A 84 AA1 4 5 O PHE A 83 ? O PHE A 83 N TYR A 71 ? N TYR A 71 AA2 1 2 N GLY A 90 ? N GLY A 90 O LEU A 138 ? O LEU A 138 AA2 2 3 N LEU A 137 ? N LEU A 137 O LYS A 145 ? O LYS A 145 AA3 1 2 N THR A 127 ? N THR A 127 O THR A 153 ? O THR A 153 AA4 1 2 N TYR A 157 ? N TYR A 157 O ARG A 160 ? O ARG A 160 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ADE 301 ? 6 'binding site for residue ADE A 301' AC2 Software A SO4 302 ? 3 'binding site for residue SO4 A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 LEU A 15 ? LEU A 15 . ? 1_555 ? 2 AC1 6 VAL A 23 ? VAL A 23 . ? 1_555 ? 3 AC1 6 ALA A 36 ? ALA A 36 . ? 1_555 ? 4 AC1 6 GLU A 85 ? GLU A 85 . ? 1_555 ? 5 AC1 6 CYS A 87 ? CYS A 87 . ? 1_555 ? 6 AC1 6 LEU A 137 ? LEU A 137 . ? 1_555 ? 7 AC2 3 TYR A 157 ? TYR A 157 . ? 1_555 ? 8 AC2 3 ASN A 158 ? ASN A 158 . ? 1_555 ? 9 AC2 3 HOH D . ? HOH A 420 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 NZ A LYS 222 ? ? OE1 A GLU 248 ? ? 2.18 2 1 O A PRO 250 ? ? O A HOH 401 ? ? 2.19 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 CYS _pdbx_validate_rmsd_angle.auth_seq_id_1 87 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 CYS _pdbx_validate_rmsd_angle.auth_seq_id_2 87 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 CYS _pdbx_validate_rmsd_angle.auth_seq_id_3 87 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 119.22 _pdbx_validate_rmsd_angle.angle_target_value 111.50 _pdbx_validate_rmsd_angle.angle_deviation 7.72 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.20 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 12 ? ? -115.06 -92.64 2 1 ALA A 19 ? ? -176.96 -54.64 3 1 GLU A 32 ? ? 82.57 2.69 4 1 LYS A 43 ? ? -107.33 -76.64 5 1 ASN A 63 ? ? -163.86 83.79 6 1 ARG A 75 ? ? -67.26 -70.97 7 1 ILE A 100 ? ? -136.17 -35.77 8 1 ASP A 130 ? ? -156.25 60.80 9 1 ARG A 141 ? ? -87.49 30.24 10 1 ASP A 148 ? ? 54.82 98.09 11 1 THR A 153 ? ? -171.95 147.57 12 1 LEU A 246 ? ? -91.98 51.94 13 1 ARG A 253 ? ? -39.47 131.54 14 1 LEU A 269 ? ? -139.55 -44.28 # _pdbx_entry_details.entry_id 7BKN _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A VAL 3 ? A VAL 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A PHE 5 ? A PHE 5 6 1 Y 1 A VAL 6 ? A VAL 6 7 1 Y 1 A ALA 45 ? A ALA 45 8 1 Y 1 A VAL 46 ? A VAL 46 9 1 Y 1 A ASP 47 ? A ASP 47 10 1 Y 1 A CYS 48 ? A CYS 48 11 1 Y 1 A PRO 49 ? A PRO 49 12 1 Y 1 A GLU 50 ? A GLU 50 13 1 Y 1 A GLY 272 ? A GLY 272 14 1 Y 1 A ALA 273 ? A ALA 273 15 1 Y 1 A LYS 274 ? A LYS 274 16 1 Y 1 A ARG 275 ? A ARG 275 17 1 Y 1 A PRO 276 ? A PRO 276 18 1 Y 1 A ARG 277 ? A ARG 277 19 1 Y 1 A VAL 278 ? A VAL 278 20 1 Y 1 A THR 279 ? A THR 279 21 1 Y 1 A SER 280 ? A SER 280 22 1 Y 1 A GLY 281 ? A GLY 281 23 1 Y 1 A GLY 282 ? A GLY 282 24 1 Y 1 A VAL 283 ? A VAL 283 25 1 Y 1 A SER 284 ? A SER 284 26 1 Y 1 A GLU 285 ? A GLU 285 27 1 Y 1 A SER 286 ? A SER 286 28 1 Y 1 A PRO 287 ? A PRO 287 29 1 Y 1 A SER 288 ? A SER 288 30 1 Y 1 A GLY 289 ? A GLY 289 31 1 Y 1 A HIS 290 ? A HIS 290 32 1 Y 1 A HIS 291 ? A HIS 291 33 1 Y 1 A HIS 292 ? A HIS 292 34 1 Y 1 A HIS 293 ? A HIS 293 35 1 Y 1 A HIS 294 ? A HIS 294 36 1 Y 1 A HIS 295 ? A HIS 295 37 1 Y 1 A HIS 296 ? A HIS 296 38 1 Y 1 A HIS 297 ? A HIS 297 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ADE N9 N Y N 1 ADE C8 C Y N 2 ADE N7 N Y N 3 ADE C5 C Y N 4 ADE C6 C Y N 5 ADE N6 N N N 6 ADE N1 N Y N 7 ADE C2 C Y N 8 ADE N3 N Y N 9 ADE C4 C Y N 10 ADE HN9 H N N 11 ADE H8 H N N 12 ADE HN61 H N N 13 ADE HN62 H N N 14 ADE H2 H N N 15 ALA N N N N 16 ALA CA C N S 17 ALA C C N N 18 ALA O O N N 19 ALA CB C N N 20 ALA OXT O N N 21 ALA H H N N 22 ALA H2 H N N 23 ALA HA H N N 24 ALA HB1 H N N 25 ALA HB2 H N N 26 ALA HB3 H N N 27 ALA HXT H N N 28 ARG N N N N 29 ARG CA C N S 30 ARG C C N N 31 ARG O O N N 32 ARG CB C N N 33 ARG CG C N N 34 ARG CD C N N 35 ARG NE N N N 36 ARG CZ C N N 37 ARG NH1 N N N 38 ARG NH2 N N N 39 ARG OXT O N N 40 ARG H H N N 41 ARG H2 H N N 42 ARG HA H N N 43 ARG HB2 H N N 44 ARG HB3 H N N 45 ARG HG2 H N N 46 ARG HG3 H N N 47 ARG HD2 H N N 48 ARG HD3 H N N 49 ARG HE H N N 50 ARG HH11 H N N 51 ARG HH12 H N N 52 ARG HH21 H N N 53 ARG HH22 H N N 54 ARG HXT H N N 55 ASN N N N N 56 ASN CA C N S 57 ASN C C N N 58 ASN O O N N 59 ASN CB C N N 60 ASN CG C N N 61 ASN OD1 O N N 62 ASN ND2 N N N 63 ASN OXT O N N 64 ASN H H N N 65 ASN H2 H N N 66 ASN HA H N N 67 ASN HB2 H N N 68 ASN HB3 H N N 69 ASN HD21 H N N 70 ASN HD22 H N N 71 ASN HXT H N N 72 ASP N N N N 73 ASP CA C N S 74 ASP C C N N 75 ASP O O N N 76 ASP CB C N N 77 ASP CG C N N 78 ASP OD1 O N N 79 ASP OD2 O N N 80 ASP OXT O N N 81 ASP H H N N 82 ASP H2 H N N 83 ASP HA H N N 84 ASP HB2 H N N 85 ASP HB3 H N N 86 ASP HD2 H N N 87 ASP HXT H N N 88 CYS N N N N 89 CYS CA C N R 90 CYS C C N N 91 CYS O O N N 92 CYS CB C N N 93 CYS SG S N N 94 CYS OXT O N N 95 CYS H H N N 96 CYS H2 H N N 97 CYS HA H N N 98 CYS HB2 H N N 99 CYS HB3 H N N 100 CYS HG H N N 101 CYS HXT H N N 102 GLN N N N N 103 GLN CA C N S 104 GLN C C N N 105 GLN O O N N 106 GLN CB C N N 107 GLN CG C N N 108 GLN CD C N N 109 GLN OE1 O N N 110 GLN NE2 N N N 111 GLN OXT O N N 112 GLN H H N N 113 GLN H2 H N N 114 GLN HA H N N 115 GLN HB2 H N N 116 GLN HB3 H N N 117 GLN HG2 H N N 118 GLN HG3 H N N 119 GLN HE21 H N N 120 GLN HE22 H N N 121 GLN HXT H N N 122 GLU N N N N 123 GLU CA C N S 124 GLU C C N N 125 GLU O O N N 126 GLU CB C N N 127 GLU CG C N N 128 GLU CD C N N 129 GLU OE1 O N N 130 GLU OE2 O N N 131 GLU OXT O N N 132 GLU H H N N 133 GLU H2 H N N 134 GLU HA H N N 135 GLU HB2 H N N 136 GLU HB3 H N N 137 GLU HG2 H N N 138 GLU HG3 H N N 139 GLU HE2 H N N 140 GLU HXT H N N 141 GLY N N N N 142 GLY CA C N N 143 GLY C C N N 144 GLY O O N N 145 GLY OXT O N N 146 GLY H H N N 147 GLY H2 H N N 148 GLY HA2 H N N 149 GLY HA3 H N N 150 GLY HXT H N N 151 HIS N N N N 152 HIS CA C N S 153 HIS C C N N 154 HIS O O N N 155 HIS CB C N N 156 HIS CG C Y N 157 HIS ND1 N Y N 158 HIS CD2 C Y N 159 HIS CE1 C Y N 160 HIS NE2 N Y N 161 HIS OXT O N N 162 HIS H H N N 163 HIS H2 H N N 164 HIS HA H N N 165 HIS HB2 H N N 166 HIS HB3 H N N 167 HIS HD1 H N N 168 HIS HD2 H N N 169 HIS HE1 H N N 170 HIS HE2 H N N 171 HIS HXT H N N 172 HOH O O N N 173 HOH H1 H N N 174 HOH H2 H N N 175 ILE N N N N 176 ILE CA C N S 177 ILE C C N N 178 ILE O O N N 179 ILE CB C N S 180 ILE CG1 C N N 181 ILE CG2 C N N 182 ILE CD1 C N N 183 ILE OXT O N N 184 ILE H H N N 185 ILE H2 H N N 186 ILE HA H N N 187 ILE HB H N N 188 ILE HG12 H N N 189 ILE HG13 H N N 190 ILE HG21 H N N 191 ILE HG22 H N N 192 ILE HG23 H N N 193 ILE HD11 H N N 194 ILE HD12 H N N 195 ILE HD13 H N N 196 ILE HXT H N N 197 LEU N N N N 198 LEU CA C N S 199 LEU C C N N 200 LEU O O N N 201 LEU CB C N N 202 LEU CG C N N 203 LEU CD1 C N N 204 LEU CD2 C N N 205 LEU OXT O N N 206 LEU H H N N 207 LEU H2 H N N 208 LEU HA H N N 209 LEU HB2 H N N 210 LEU HB3 H N N 211 LEU HG H N N 212 LEU HD11 H N N 213 LEU HD12 H N N 214 LEU HD13 H N N 215 LEU HD21 H N N 216 LEU HD22 H N N 217 LEU HD23 H N N 218 LEU HXT H N N 219 LYS N N N N 220 LYS CA C N S 221 LYS C C N N 222 LYS O O N N 223 LYS CB C N N 224 LYS CG C N N 225 LYS CD C N N 226 LYS CE C N N 227 LYS NZ N N N 228 LYS OXT O N N 229 LYS H H N N 230 LYS H2 H N N 231 LYS HA H N N 232 LYS HB2 H N N 233 LYS HB3 H N N 234 LYS HG2 H N N 235 LYS HG3 H N N 236 LYS HD2 H N N 237 LYS HD3 H N N 238 LYS HE2 H N N 239 LYS HE3 H N N 240 LYS HZ1 H N N 241 LYS HZ2 H N N 242 LYS HZ3 H N N 243 LYS HXT H N N 244 MET N N N N 245 MET CA C N S 246 MET C C N N 247 MET O O N N 248 MET CB C N N 249 MET CG C N N 250 MET SD S N N 251 MET CE C N N 252 MET OXT O N N 253 MET H H N N 254 MET H2 H N N 255 MET HA H N N 256 MET HB2 H N N 257 MET HB3 H N N 258 MET HG2 H N N 259 MET HG3 H N N 260 MET HE1 H N N 261 MET HE2 H N N 262 MET HE3 H N N 263 MET HXT H N N 264 PHE N N N N 265 PHE CA C N S 266 PHE C C N N 267 PHE O O N N 268 PHE CB C N N 269 PHE CG C Y N 270 PHE CD1 C Y N 271 PHE CD2 C Y N 272 PHE CE1 C Y N 273 PHE CE2 C Y N 274 PHE CZ C Y N 275 PHE OXT O N N 276 PHE H H N N 277 PHE H2 H N N 278 PHE HA H N N 279 PHE HB2 H N N 280 PHE HB3 H N N 281 PHE HD1 H N N 282 PHE HD2 H N N 283 PHE HE1 H N N 284 PHE HE2 H N N 285 PHE HZ H N N 286 PHE HXT H N N 287 PRO N N N N 288 PRO CA C N S 289 PRO C C N N 290 PRO O O N N 291 PRO CB C N N 292 PRO CG C N N 293 PRO CD C N N 294 PRO OXT O N N 295 PRO H H N N 296 PRO HA H N N 297 PRO HB2 H N N 298 PRO HB3 H N N 299 PRO HG2 H N N 300 PRO HG3 H N N 301 PRO HD2 H N N 302 PRO HD3 H N N 303 PRO HXT H N N 304 SER N N N N 305 SER CA C N S 306 SER C C N N 307 SER O O N N 308 SER CB C N N 309 SER OG O N N 310 SER OXT O N N 311 SER H H N N 312 SER H2 H N N 313 SER HA H N N 314 SER HB2 H N N 315 SER HB3 H N N 316 SER HG H N N 317 SER HXT H N N 318 SO4 S S N N 319 SO4 O1 O N N 320 SO4 O2 O N N 321 SO4 O3 O N N 322 SO4 O4 O N N 323 THR N N N N 324 THR CA C N S 325 THR C C N N 326 THR O O N N 327 THR CB C N R 328 THR OG1 O N N 329 THR CG2 C N N 330 THR OXT O N N 331 THR H H N N 332 THR H2 H N N 333 THR HA H N N 334 THR HB H N N 335 THR HG1 H N N 336 THR HG21 H N N 337 THR HG22 H N N 338 THR HG23 H N N 339 THR HXT H N N 340 TRP N N N N 341 TRP CA C N S 342 TRP C C N N 343 TRP O O N N 344 TRP CB C N N 345 TRP CG C Y N 346 TRP CD1 C Y N 347 TRP CD2 C Y N 348 TRP NE1 N Y N 349 TRP CE2 C Y N 350 TRP CE3 C Y N 351 TRP CZ2 C Y N 352 TRP CZ3 C Y N 353 TRP CH2 C Y N 354 TRP OXT O N N 355 TRP H H N N 356 TRP H2 H N N 357 TRP HA H N N 358 TRP HB2 H N N 359 TRP HB3 H N N 360 TRP HD1 H N N 361 TRP HE1 H N N 362 TRP HE3 H N N 363 TRP HZ2 H N N 364 TRP HZ3 H N N 365 TRP HH2 H N N 366 TRP HXT H N N 367 TYR N N N N 368 TYR CA C N S 369 TYR C C N N 370 TYR O O N N 371 TYR CB C N N 372 TYR CG C Y N 373 TYR CD1 C Y N 374 TYR CD2 C Y N 375 TYR CE1 C Y N 376 TYR CE2 C Y N 377 TYR CZ C Y N 378 TYR OH O N N 379 TYR OXT O N N 380 TYR H H N N 381 TYR H2 H N N 382 TYR HA H N N 383 TYR HB2 H N N 384 TYR HB3 H N N 385 TYR HD1 H N N 386 TYR HD2 H N N 387 TYR HE1 H N N 388 TYR HE2 H N N 389 TYR HH H N N 390 TYR HXT H N N 391 VAL N N N N 392 VAL CA C N S 393 VAL C C N N 394 VAL O O N N 395 VAL CB C N N 396 VAL CG1 C N N 397 VAL CG2 C N N 398 VAL OXT O N N 399 VAL H H N N 400 VAL H2 H N N 401 VAL HA H N N 402 VAL HB H N N 403 VAL HG11 H N N 404 VAL HG12 H N N 405 VAL HG13 H N N 406 VAL HG21 H N N 407 VAL HG22 H N N 408 VAL HG23 H N N 409 VAL HXT H N N 410 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ADE N9 C8 sing Y N 1 ADE N9 C4 sing Y N 2 ADE N9 HN9 sing N N 3 ADE C8 N7 doub Y N 4 ADE C8 H8 sing N N 5 ADE N7 C5 sing Y N 6 ADE C5 C6 sing Y N 7 ADE C5 C4 doub Y N 8 ADE C6 N6 sing N N 9 ADE C6 N1 doub Y N 10 ADE N6 HN61 sing N N 11 ADE N6 HN62 sing N N 12 ADE N1 C2 sing Y N 13 ADE C2 N3 doub Y N 14 ADE C2 H2 sing N N 15 ADE N3 C4 sing Y N 16 ALA N CA sing N N 17 ALA N H sing N N 18 ALA N H2 sing N N 19 ALA CA C sing N N 20 ALA CA CB sing N N 21 ALA CA HA sing N N 22 ALA C O doub N N 23 ALA C OXT sing N N 24 ALA CB HB1 sing N N 25 ALA CB HB2 sing N N 26 ALA CB HB3 sing N N 27 ALA OXT HXT sing N N 28 ARG N CA sing N N 29 ARG N H sing N N 30 ARG N H2 sing N N 31 ARG CA C sing N N 32 ARG CA CB sing N N 33 ARG CA HA sing N N 34 ARG C O doub N N 35 ARG C OXT sing N N 36 ARG CB CG sing N N 37 ARG CB HB2 sing N N 38 ARG CB HB3 sing N N 39 ARG CG CD sing N N 40 ARG CG HG2 sing N N 41 ARG CG HG3 sing N N 42 ARG CD NE sing N N 43 ARG CD HD2 sing N N 44 ARG CD HD3 sing N N 45 ARG NE CZ sing N N 46 ARG NE HE sing N N 47 ARG CZ NH1 sing N N 48 ARG CZ NH2 doub N N 49 ARG NH1 HH11 sing N N 50 ARG NH1 HH12 sing N N 51 ARG NH2 HH21 sing N N 52 ARG NH2 HH22 sing N N 53 ARG OXT HXT sing N N 54 ASN N CA sing N N 55 ASN N H sing N N 56 ASN N H2 sing N N 57 ASN CA C sing N N 58 ASN CA CB sing N N 59 ASN CA HA sing N N 60 ASN C O doub N N 61 ASN C OXT sing N N 62 ASN CB CG sing N N 63 ASN CB HB2 sing N N 64 ASN CB HB3 sing N N 65 ASN CG OD1 doub N N 66 ASN CG ND2 sing N N 67 ASN ND2 HD21 sing N N 68 ASN ND2 HD22 sing N N 69 ASN OXT HXT sing N N 70 ASP N CA sing N N 71 ASP N H sing N N 72 ASP N H2 sing N N 73 ASP CA C sing N N 74 ASP CA CB sing N N 75 ASP CA HA sing N N 76 ASP C O doub N N 77 ASP C OXT sing N N 78 ASP CB CG sing N N 79 ASP CB HB2 sing N N 80 ASP CB HB3 sing N N 81 ASP CG OD1 doub N N 82 ASP CG OD2 sing N N 83 ASP OD2 HD2 sing N N 84 ASP OXT HXT sing N N 85 CYS N CA sing N N 86 CYS N H sing N N 87 CYS N H2 sing N N 88 CYS CA C sing N N 89 CYS CA CB sing N N 90 CYS CA HA sing N N 91 CYS C O doub N N 92 CYS C OXT sing N N 93 CYS CB SG sing N N 94 CYS CB HB2 sing N N 95 CYS CB HB3 sing N N 96 CYS SG HG sing N N 97 CYS OXT HXT sing N N 98 GLN N CA sing N N 99 GLN N H sing N N 100 GLN N H2 sing N N 101 GLN CA C sing N N 102 GLN CA CB sing N N 103 GLN CA HA sing N N 104 GLN C O doub N N 105 GLN C OXT sing N N 106 GLN CB CG sing N N 107 GLN CB HB2 sing N N 108 GLN CB HB3 sing N N 109 GLN CG CD sing N N 110 GLN CG HG2 sing N N 111 GLN CG HG3 sing N N 112 GLN CD OE1 doub N N 113 GLN CD NE2 sing N N 114 GLN NE2 HE21 sing N N 115 GLN NE2 HE22 sing N N 116 GLN OXT HXT sing N N 117 GLU N CA sing N N 118 GLU N H sing N N 119 GLU N H2 sing N N 120 GLU CA C sing N N 121 GLU CA CB sing N N 122 GLU CA HA sing N N 123 GLU C O doub N N 124 GLU C OXT sing N N 125 GLU CB CG sing N N 126 GLU CB HB2 sing N N 127 GLU CB HB3 sing N N 128 GLU CG CD sing N N 129 GLU CG HG2 sing N N 130 GLU CG HG3 sing N N 131 GLU CD OE1 doub N N 132 GLU CD OE2 sing N N 133 GLU OE2 HE2 sing N N 134 GLU OXT HXT sing N N 135 GLY N CA sing N N 136 GLY N H sing N N 137 GLY N H2 sing N N 138 GLY CA C sing N N 139 GLY CA HA2 sing N N 140 GLY CA HA3 sing N N 141 GLY C O doub N N 142 GLY C OXT sing N N 143 GLY OXT HXT sing N N 144 HIS N CA sing N N 145 HIS N H sing N N 146 HIS N H2 sing N N 147 HIS CA C sing N N 148 HIS CA CB sing N N 149 HIS CA HA sing N N 150 HIS C O doub N N 151 HIS C OXT sing N N 152 HIS CB CG sing N N 153 HIS CB HB2 sing N N 154 HIS CB HB3 sing N N 155 HIS CG ND1 sing Y N 156 HIS CG CD2 doub Y N 157 HIS ND1 CE1 doub Y N 158 HIS ND1 HD1 sing N N 159 HIS CD2 NE2 sing Y N 160 HIS CD2 HD2 sing N N 161 HIS CE1 NE2 sing Y N 162 HIS CE1 HE1 sing N N 163 HIS NE2 HE2 sing N N 164 HIS OXT HXT sing N N 165 HOH O H1 sing N N 166 HOH O H2 sing N N 167 ILE N CA sing N N 168 ILE N H sing N N 169 ILE N H2 sing N N 170 ILE CA C sing N N 171 ILE CA CB sing N N 172 ILE CA HA sing N N 173 ILE C O doub N N 174 ILE C OXT sing N N 175 ILE CB CG1 sing N N 176 ILE CB CG2 sing N N 177 ILE CB HB sing N N 178 ILE CG1 CD1 sing N N 179 ILE CG1 HG12 sing N N 180 ILE CG1 HG13 sing N N 181 ILE CG2 HG21 sing N N 182 ILE CG2 HG22 sing N N 183 ILE CG2 HG23 sing N N 184 ILE CD1 HD11 sing N N 185 ILE CD1 HD12 sing N N 186 ILE CD1 HD13 sing N N 187 ILE OXT HXT sing N N 188 LEU N CA sing N N 189 LEU N H sing N N 190 LEU N H2 sing N N 191 LEU CA C sing N N 192 LEU CA CB sing N N 193 LEU CA HA sing N N 194 LEU C O doub N N 195 LEU C OXT sing N N 196 LEU CB CG sing N N 197 LEU CB HB2 sing N N 198 LEU CB HB3 sing N N 199 LEU CG CD1 sing N N 200 LEU CG CD2 sing N N 201 LEU CG HG sing N N 202 LEU CD1 HD11 sing N N 203 LEU CD1 HD12 sing N N 204 LEU CD1 HD13 sing N N 205 LEU CD2 HD21 sing N N 206 LEU CD2 HD22 sing N N 207 LEU CD2 HD23 sing N N 208 LEU OXT HXT sing N N 209 LYS N CA sing N N 210 LYS N H sing N N 211 LYS N H2 sing N N 212 LYS CA C sing N N 213 LYS CA CB sing N N 214 LYS CA HA sing N N 215 LYS C O doub N N 216 LYS C OXT sing N N 217 LYS CB CG sing N N 218 LYS CB HB2 sing N N 219 LYS CB HB3 sing N N 220 LYS CG CD sing N N 221 LYS CG HG2 sing N N 222 LYS CG HG3 sing N N 223 LYS CD CE sing N N 224 LYS CD HD2 sing N N 225 LYS CD HD3 sing N N 226 LYS CE NZ sing N N 227 LYS CE HE2 sing N N 228 LYS CE HE3 sing N N 229 LYS NZ HZ1 sing N N 230 LYS NZ HZ2 sing N N 231 LYS NZ HZ3 sing N N 232 LYS OXT HXT sing N N 233 MET N CA sing N N 234 MET N H sing N N 235 MET N H2 sing N N 236 MET CA C sing N N 237 MET CA CB sing N N 238 MET CA HA sing N N 239 MET C O doub N N 240 MET C OXT sing N N 241 MET CB CG sing N N 242 MET CB HB2 sing N N 243 MET CB HB3 sing N N 244 MET CG SD sing N N 245 MET CG HG2 sing N N 246 MET CG HG3 sing N N 247 MET SD CE sing N N 248 MET CE HE1 sing N N 249 MET CE HE2 sing N N 250 MET CE HE3 sing N N 251 MET OXT HXT sing N N 252 PHE N CA sing N N 253 PHE N H sing N N 254 PHE N H2 sing N N 255 PHE CA C sing N N 256 PHE CA CB sing N N 257 PHE CA HA sing N N 258 PHE C O doub N N 259 PHE C OXT sing N N 260 PHE CB CG sing N N 261 PHE CB HB2 sing N N 262 PHE CB HB3 sing N N 263 PHE CG CD1 doub Y N 264 PHE CG CD2 sing Y N 265 PHE CD1 CE1 sing Y N 266 PHE CD1 HD1 sing N N 267 PHE CD2 CE2 doub Y N 268 PHE CD2 HD2 sing N N 269 PHE CE1 CZ doub Y N 270 PHE CE1 HE1 sing N N 271 PHE CE2 CZ sing Y N 272 PHE CE2 HE2 sing N N 273 PHE CZ HZ sing N N 274 PHE OXT HXT sing N N 275 PRO N CA sing N N 276 PRO N CD sing N N 277 PRO N H sing N N 278 PRO CA C sing N N 279 PRO CA CB sing N N 280 PRO CA HA sing N N 281 PRO C O doub N N 282 PRO C OXT sing N N 283 PRO CB CG sing N N 284 PRO CB HB2 sing N N 285 PRO CB HB3 sing N N 286 PRO CG CD sing N N 287 PRO CG HG2 sing N N 288 PRO CG HG3 sing N N 289 PRO CD HD2 sing N N 290 PRO CD HD3 sing N N 291 PRO OXT HXT sing N N 292 SER N CA sing N N 293 SER N H sing N N 294 SER N H2 sing N N 295 SER CA C sing N N 296 SER CA CB sing N N 297 SER CA HA sing N N 298 SER C O doub N N 299 SER C OXT sing N N 300 SER CB OG sing N N 301 SER CB HB2 sing N N 302 SER CB HB3 sing N N 303 SER OG HG sing N N 304 SER OXT HXT sing N N 305 SO4 S O1 doub N N 306 SO4 S O2 doub N N 307 SO4 S O3 sing N N 308 SO4 S O4 sing N N 309 THR N CA sing N N 310 THR N H sing N N 311 THR N H2 sing N N 312 THR CA C sing N N 313 THR CA CB sing N N 314 THR CA HA sing N N 315 THR C O doub N N 316 THR C OXT sing N N 317 THR CB OG1 sing N N 318 THR CB CG2 sing N N 319 THR CB HB sing N N 320 THR OG1 HG1 sing N N 321 THR CG2 HG21 sing N N 322 THR CG2 HG22 sing N N 323 THR CG2 HG23 sing N N 324 THR OXT HXT sing N N 325 TRP N CA sing N N 326 TRP N H sing N N 327 TRP N H2 sing N N 328 TRP CA C sing N N 329 TRP CA CB sing N N 330 TRP CA HA sing N N 331 TRP C O doub N N 332 TRP C OXT sing N N 333 TRP CB CG sing N N 334 TRP CB HB2 sing N N 335 TRP CB HB3 sing N N 336 TRP CG CD1 doub Y N 337 TRP CG CD2 sing Y N 338 TRP CD1 NE1 sing Y N 339 TRP CD1 HD1 sing N N 340 TRP CD2 CE2 doub Y N 341 TRP CD2 CE3 sing Y N 342 TRP NE1 CE2 sing Y N 343 TRP NE1 HE1 sing N N 344 TRP CE2 CZ2 sing Y N 345 TRP CE3 CZ3 doub Y N 346 TRP CE3 HE3 sing N N 347 TRP CZ2 CH2 doub Y N 348 TRP CZ2 HZ2 sing N N 349 TRP CZ3 CH2 sing Y N 350 TRP CZ3 HZ3 sing N N 351 TRP CH2 HH2 sing N N 352 TRP OXT HXT sing N N 353 TYR N CA sing N N 354 TYR N H sing N N 355 TYR N H2 sing N N 356 TYR CA C sing N N 357 TYR CA CB sing N N 358 TYR CA HA sing N N 359 TYR C O doub N N 360 TYR C OXT sing N N 361 TYR CB CG sing N N 362 TYR CB HB2 sing N N 363 TYR CB HB3 sing N N 364 TYR CG CD1 doub Y N 365 TYR CG CD2 sing Y N 366 TYR CD1 CE1 sing Y N 367 TYR CD1 HD1 sing N N 368 TYR CD2 CE2 doub Y N 369 TYR CD2 HD2 sing N N 370 TYR CE1 CZ doub Y N 371 TYR CE1 HE1 sing N N 372 TYR CE2 CZ sing Y N 373 TYR CE2 HE2 sing N N 374 TYR CZ OH sing N N 375 TYR OH HH sing N N 376 TYR OXT HXT sing N N 377 VAL N CA sing N N 378 VAL N H sing N N 379 VAL N H2 sing N N 380 VAL CA C sing N N 381 VAL CA CB sing N N 382 VAL CA HA sing N N 383 VAL C O doub N N 384 VAL C OXT sing N N 385 VAL CB CG1 sing N N 386 VAL CB CG2 sing N N 387 VAL CB HB sing N N 388 VAL CG1 HG11 sing N N 389 VAL CG1 HG12 sing N N 390 VAL CG1 HG13 sing N N 391 VAL CG2 HG21 sing N N 392 VAL CG2 HG22 sing N N 393 VAL CG2 HG23 sing N N 394 VAL OXT HXT sing N N 395 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ADE _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ADE _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1IA8 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7BKN _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.022401 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.005095 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015371 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019009 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_