data_7BM8 # _entry.id 7BM8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7BM8 pdb_00007bm8 10.2210/pdb7bm8/pdb WWPDB D_1292113581 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'same protein complexed with DNA' _pdbx_database_related.db_id 6T1F _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7BM8 _pdbx_database_status.recvd_initial_deposition_date 2021-01-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jalal, A.S.' 1 0000-0001-7794-8834 'Tran, N.T.' 2 0000-0002-7186-3976 'Stevenson, C.E.M.' 3 0000-0001-6695-8201 'Lawson, D.M.' 4 0000-0002-7637-4303 'Le, T.B.K.' 5 0000-0003-4764-8851 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Elife _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2050-084X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'A CTP-dependent gating mechanism enables ParB spreading on DNA.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.7554/eLife.69676 _citation.pdbx_database_id_PubMed 34397383 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jalal, A.S.' 1 0000-0001-7794-8834 primary 'Tran, N.T.' 2 0000-0002-7186-3976 primary 'Stevenson, C.E.' 3 ? primary 'Chimthanawala, A.' 4 ? primary 'Badrinarayanan, A.' 5 0000-0001-5520-2134 primary 'Lawson, D.M.' 6 0000-0002-7637-4303 primary 'Le, T.B.' 7 0000-0003-4764-8851 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 98.400 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7BM8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 69.461 _cell.length_a_esd ? _cell.length_b 56.076 _cell.length_b_esd ? _cell.length_c 71.360 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7BM8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Chromosome-partitioning protein ParB' 28024.861 2 ? ? ? ;The expressed protein comprised residues 11-244 of the wild-type sequence with a C-terminal nickel affinity tag of sequence KLAAALEHHHHHH from the pET21b expression plasmid ; 2 non-polymer syn "CYTIDINE-5'-TRIPHOSPHATE" 483.156 2 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSEGRRGLGRGLSALLGEVDAAPAQAPGEQLGGSREAPIEILQRNPDQPRRTFREEDLEDLSNSIREKGVLQPILVRPSP DTAGEYQIVAGERRWRAAQRAGLKTVPIMVRELDDLAVLEIGIIENVQRADLNVLEEALSYKVLMEKFERTQENIAQTIG KSRSHVANTMRLLALPDEVQSYLVSGELTAGHARAIAAAADPVALAKQIIEGGLSVRETEALARKAPNLSAGKSKGGRPP RVKDKLAAALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSEGRRGLGRGLSALLGEVDAAPAQAPGEQLGGSREAPIEILQRNPDQPRRTFREEDLEDLSNSIREKGVLQPILVRPSP DTAGEYQIVAGERRWRAAQRAGLKTVPIMVRELDDLAVLEIGIIENVQRADLNVLEEALSYKVLMEKFERTQENIAQTIG KSRSHVANTMRLLALPDEVQSYLVSGELTAGHARAIAAAADPVALAKQIIEGGLSVRETEALARKAPNLSAGKSKGGRPP RVKDKLAAALEHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLU n 1 4 GLY n 1 5 ARG n 1 6 ARG n 1 7 GLY n 1 8 LEU n 1 9 GLY n 1 10 ARG n 1 11 GLY n 1 12 LEU n 1 13 SER n 1 14 ALA n 1 15 LEU n 1 16 LEU n 1 17 GLY n 1 18 GLU n 1 19 VAL n 1 20 ASP n 1 21 ALA n 1 22 ALA n 1 23 PRO n 1 24 ALA n 1 25 GLN n 1 26 ALA n 1 27 PRO n 1 28 GLY n 1 29 GLU n 1 30 GLN n 1 31 LEU n 1 32 GLY n 1 33 GLY n 1 34 SER n 1 35 ARG n 1 36 GLU n 1 37 ALA n 1 38 PRO n 1 39 ILE n 1 40 GLU n 1 41 ILE n 1 42 LEU n 1 43 GLN n 1 44 ARG n 1 45 ASN n 1 46 PRO n 1 47 ASP n 1 48 GLN n 1 49 PRO n 1 50 ARG n 1 51 ARG n 1 52 THR n 1 53 PHE n 1 54 ARG n 1 55 GLU n 1 56 GLU n 1 57 ASP n 1 58 LEU n 1 59 GLU n 1 60 ASP n 1 61 LEU n 1 62 SER n 1 63 ASN n 1 64 SER n 1 65 ILE n 1 66 ARG n 1 67 GLU n 1 68 LYS n 1 69 GLY n 1 70 VAL n 1 71 LEU n 1 72 GLN n 1 73 PRO n 1 74 ILE n 1 75 LEU n 1 76 VAL n 1 77 ARG n 1 78 PRO n 1 79 SER n 1 80 PRO n 1 81 ASP n 1 82 THR n 1 83 ALA n 1 84 GLY n 1 85 GLU n 1 86 TYR n 1 87 GLN n 1 88 ILE n 1 89 VAL n 1 90 ALA n 1 91 GLY n 1 92 GLU n 1 93 ARG n 1 94 ARG n 1 95 TRP n 1 96 ARG n 1 97 ALA n 1 98 ALA n 1 99 GLN n 1 100 ARG n 1 101 ALA n 1 102 GLY n 1 103 LEU n 1 104 LYS n 1 105 THR n 1 106 VAL n 1 107 PRO n 1 108 ILE n 1 109 MET n 1 110 VAL n 1 111 ARG n 1 112 GLU n 1 113 LEU n 1 114 ASP n 1 115 ASP n 1 116 LEU n 1 117 ALA n 1 118 VAL n 1 119 LEU n 1 120 GLU n 1 121 ILE n 1 122 GLY n 1 123 ILE n 1 124 ILE n 1 125 GLU n 1 126 ASN n 1 127 VAL n 1 128 GLN n 1 129 ARG n 1 130 ALA n 1 131 ASP n 1 132 LEU n 1 133 ASN n 1 134 VAL n 1 135 LEU n 1 136 GLU n 1 137 GLU n 1 138 ALA n 1 139 LEU n 1 140 SER n 1 141 TYR n 1 142 LYS n 1 143 VAL n 1 144 LEU n 1 145 MET n 1 146 GLU n 1 147 LYS n 1 148 PHE n 1 149 GLU n 1 150 ARG n 1 151 THR n 1 152 GLN n 1 153 GLU n 1 154 ASN n 1 155 ILE n 1 156 ALA n 1 157 GLN n 1 158 THR n 1 159 ILE n 1 160 GLY n 1 161 LYS n 1 162 SER n 1 163 ARG n 1 164 SER n 1 165 HIS n 1 166 VAL n 1 167 ALA n 1 168 ASN n 1 169 THR n 1 170 MET n 1 171 ARG n 1 172 LEU n 1 173 LEU n 1 174 ALA n 1 175 LEU n 1 176 PRO n 1 177 ASP n 1 178 GLU n 1 179 VAL n 1 180 GLN n 1 181 SER n 1 182 TYR n 1 183 LEU n 1 184 VAL n 1 185 SER n 1 186 GLY n 1 187 GLU n 1 188 LEU n 1 189 THR n 1 190 ALA n 1 191 GLY n 1 192 HIS n 1 193 ALA n 1 194 ARG n 1 195 ALA n 1 196 ILE n 1 197 ALA n 1 198 ALA n 1 199 ALA n 1 200 ALA n 1 201 ASP n 1 202 PRO n 1 203 VAL n 1 204 ALA n 1 205 LEU n 1 206 ALA n 1 207 LYS n 1 208 GLN n 1 209 ILE n 1 210 ILE n 1 211 GLU n 1 212 GLY n 1 213 GLY n 1 214 LEU n 1 215 SER n 1 216 VAL n 1 217 ARG n 1 218 GLU n 1 219 THR n 1 220 GLU n 1 221 ALA n 1 222 LEU n 1 223 ALA n 1 224 ARG n 1 225 LYS n 1 226 ALA n 1 227 PRO n 1 228 ASN n 1 229 LEU n 1 230 SER n 1 231 ALA n 1 232 GLY n 1 233 LYS n 1 234 SER n 1 235 LYS n 1 236 GLY n 1 237 GLY n 1 238 ARG n 1 239 PRO n 1 240 PRO n 1 241 ARG n 1 242 VAL n 1 243 LYS n 1 244 ASP n 1 245 LYS n 1 246 LEU n 1 247 ALA n 1 248 ALA n 1 249 ALA n 1 250 LEU n 1 251 GLU n 1 252 HIS n 1 253 HIS n 1 254 HIS n 1 255 HIS n 1 256 HIS n 1 257 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 257 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'parB, CCNA_03868' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'NA1000 / CB15N' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Caulobacter vibrioides (strain NA1000 / CB15N)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 565050 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain Rosetta _entity_src_gen.pdbx_host_org_variant Solu _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PARB_CAUVN _struct_ref.pdbx_db_accession B8GW30 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSEGRRGLGRGLSALLGEVDAAPAQAPGEQLGGSREAPIEILQRNPDQPRRTFREEDLEDLSNSIREKGVLQPILVRPSP DTAGEYQIVAGERRWRAAQRAGLKTVPIMVRELDDLAVLEIGIIENVQRADLNVLEEALSYKVLMEKFERTQENIAQTIG KSRSHVANTMRLLALPDEVQSYLVSGELTAGHARAIAAAADPVALAKQIIEGGLSVRETEALARKAPNLSAGKSKGGRPP RVKD ; _struct_ref.pdbx_align_begin 11 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7BM8 A 1 ? 244 ? B8GW30 11 ? 254 ? 11 254 2 1 7BM8 B 1 ? 244 ? B8GW30 11 ? 254 ? 11 254 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7BM8 LYS A 245 ? UNP B8GW30 ? ? 'expression tag' 255 1 1 7BM8 LEU A 246 ? UNP B8GW30 ? ? 'expression tag' 256 2 1 7BM8 ALA A 247 ? UNP B8GW30 ? ? 'expression tag' 257 3 1 7BM8 ALA A 248 ? UNP B8GW30 ? ? 'expression tag' 258 4 1 7BM8 ALA A 249 ? UNP B8GW30 ? ? 'expression tag' 259 5 1 7BM8 LEU A 250 ? UNP B8GW30 ? ? 'expression tag' 260 6 1 7BM8 GLU A 251 ? UNP B8GW30 ? ? 'expression tag' 261 7 1 7BM8 HIS A 252 ? UNP B8GW30 ? ? 'expression tag' 262 8 1 7BM8 HIS A 253 ? UNP B8GW30 ? ? 'expression tag' 263 9 1 7BM8 HIS A 254 ? UNP B8GW30 ? ? 'expression tag' 264 10 1 7BM8 HIS A 255 ? UNP B8GW30 ? ? 'expression tag' 265 11 1 7BM8 HIS A 256 ? UNP B8GW30 ? ? 'expression tag' 266 12 1 7BM8 HIS A 257 ? UNP B8GW30 ? ? 'expression tag' 267 13 2 7BM8 LYS B 245 ? UNP B8GW30 ? ? 'expression tag' 255 14 2 7BM8 LEU B 246 ? UNP B8GW30 ? ? 'expression tag' 256 15 2 7BM8 ALA B 247 ? UNP B8GW30 ? ? 'expression tag' 257 16 2 7BM8 ALA B 248 ? UNP B8GW30 ? ? 'expression tag' 258 17 2 7BM8 ALA B 249 ? UNP B8GW30 ? ? 'expression tag' 259 18 2 7BM8 LEU B 250 ? UNP B8GW30 ? ? 'expression tag' 260 19 2 7BM8 GLU B 251 ? UNP B8GW30 ? ? 'expression tag' 261 20 2 7BM8 HIS B 252 ? UNP B8GW30 ? ? 'expression tag' 262 21 2 7BM8 HIS B 253 ? UNP B8GW30 ? ? 'expression tag' 263 22 2 7BM8 HIS B 254 ? UNP B8GW30 ? ? 'expression tag' 264 23 2 7BM8 HIS B 255 ? UNP B8GW30 ? ? 'expression tag' 265 24 2 7BM8 HIS B 256 ? UNP B8GW30 ? ? 'expression tag' 266 25 2 7BM8 HIS B 257 ? UNP B8GW30 ? ? 'expression tag' 267 26 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CTP non-polymer . "CYTIDINE-5'-TRIPHOSPHATE" ? 'C9 H16 N3 O14 P3' 483.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7BM8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.46 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.0 _exptl_crystal.description NULL _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details NULL _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 XE 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-12-14 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.976 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site DIAMOND # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7BM8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.730 _reflns.d_resolution_low 70.590 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14516 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.400 _reflns.pdbx_Rmerge_I_obs 0.195 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 77 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.212 _reflns.pdbx_Rpim_I_all 0.083 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 92266 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.991 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.730 2.860 ? ? 8473 ? ? ? 1756 91.400 ? ? ? ? 1.210 ? ? ? ? ? ? ? ? 4.800 ? ? ? 1.200 1.357 0.599 ? 1 1 0.825 ? ? 9.050 70.590 ? ? 2561 ? ? ? 432 99.700 ? ? ? ? 0.063 ? ? ? ? ? ? ? ? 5.900 ? ? ? 13.500 0.069 0.028 ? 2 1 0.991 ? ? # _refine.aniso_B[1][1] -6.7900 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 1.2000 _refine.aniso_B[2][2] -6.2100 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 12.1200 _refine.B_iso_max 186.770 _refine.B_iso_mean 68.8990 _refine.B_iso_min 33.590 _refine.correlation_coeff_Fo_to_Fc 0.9300 _refine.correlation_coeff_Fo_to_Fc_free 0.9110 _refine.details ;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. The density did not allow the unambiguous placement of the gamma-S of CTP-gamma-S. Thus CTP was refined in its place. ; _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7BM8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7300 _refine.ls_d_res_low 68.8100 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13824 _refine.ls_number_reflns_R_free 678 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.6500 _refine.ls_percent_reflns_R_free 4.7000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2493 _refine.ls_R_factor_R_free 0.2839 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2477 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6T1F _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.6610 _refine.pdbx_overall_ESU_R_Free 0.3510 _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii 0.7000 _refine.pdbx_solvent_shrinkage_radii 0.7000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 21.4710 _refine.overall_SU_ML 0.3840 _refine.overall_SU_R_Cruickshank_DPI 0.6609 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.7300 _refine_hist.d_res_low 68.8100 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2716 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 360 _refine_hist.pdbx_B_iso_mean_ligand 60.63 _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2656 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 60 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 0.013 2756 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 2521 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.188 1.651 3743 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.105 1.577 5807 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 4.889 5.000 358 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 25.973 21.200 150 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.528 15.000 437 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 11.403 15.000 30 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.033 0.200 386 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 3126 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 546 ? r_gen_planes_other ? ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? 0.050 ? 0.050 1 'interatomic distance' ? A 5284 ? ? 1 'X-RAY DIFFRACTION' 2 ? ? 0.050 ? 0.050 2 'interatomic distance' ? B 5284 ? ? 1 # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.73 _refine_ls_shell.d_res_low 2.8000 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 61 _refine_ls_shell.number_reflns_R_work 870 _refine_ls_shell.percent_reflns_obs 84.9500 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4050 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3710 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 A 1 2 B # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.selection_details _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id 1 1 0 0 A 42 A 221 ? ? ? ? ? ? ? ? ? 1 2 0 0 B 42 B 221 ? ? ? ? ? ? ? ? ? # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7BM8 _struct.title ;Crystal structure of the C-terminally truncated chromosome-partitioning protein ParB from Caulobacter crescentus complexed with CTP-gamma-S ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7BM8 _struct_keywords.text 'chromosome segregation, CTP, molecular gates, protein-DNA recognition, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 2 ? F N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 54 ? GLY A 69 ? ARG A 64 GLY A 79 1 ? 16 HELX_P HELX_P2 AA2 GLY A 91 ? ALA A 101 ? GLY A 101 ALA A 111 1 ? 11 HELX_P HELX_P3 AA3 ASP A 114 ? GLN A 128 ? ASP A 124 GLN A 138 1 ? 15 HELX_P HELX_P4 AA4 ASN A 133 ? GLU A 149 ? ASN A 143 GLU A 159 1 ? 17 HELX_P HELX_P5 AA5 THR A 151 ? GLY A 160 ? THR A 161 GLY A 170 1 ? 10 HELX_P HELX_P6 AA6 SER A 162 ? LEU A 172 ? SER A 172 LEU A 182 1 ? 11 HELX_P HELX_P7 AA7 PRO A 176 ? GLY A 186 ? PRO A 186 GLY A 196 1 ? 11 HELX_P HELX_P8 AA8 THR A 189 ? ALA A 199 ? THR A 199 ALA A 209 1 ? 11 HELX_P HELX_P9 AA9 ALA A 204 ? ILE A 209 ? ALA A 214 ILE A 219 1 ? 6 HELX_P HELX_P10 AB1 ARG B 54 ? GLY B 69 ? ARG B 64 GLY B 79 1 ? 16 HELX_P HELX_P11 AB2 GLY B 91 ? ALA B 101 ? GLY B 101 ALA B 111 1 ? 11 HELX_P HELX_P12 AB3 ASP B 114 ? GLN B 128 ? ASP B 124 GLN B 138 1 ? 15 HELX_P HELX_P13 AB4 ASN B 133 ? GLU B 149 ? ASN B 143 GLU B 159 1 ? 17 HELX_P HELX_P14 AB5 THR B 151 ? GLY B 160 ? THR B 161 GLY B 170 1 ? 10 HELX_P HELX_P15 AB6 SER B 162 ? LEU B 172 ? SER B 172 LEU B 182 1 ? 11 HELX_P HELX_P16 AB7 PRO B 176 ? GLY B 186 ? PRO B 186 GLY B 196 1 ? 11 HELX_P HELX_P17 AB8 THR B 189 ? ALA B 199 ? THR B 199 ALA B 209 1 ? 11 HELX_P HELX_P18 AB9 ALA B 204 ? ILE B 209 ? ALA B 214 ILE B 219 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 125 OE1 ? ? ? 1_555 D MG . MG ? ? A GLU 135 A MG 302 1_555 ? ? ? ? ? ? ? 2.083 ? ? metalc2 metalc ? ? A GLU 125 OE2 ? ? ? 1_555 D MG . MG ? ? A GLU 135 A MG 302 1_555 ? ? ? ? ? ? ? 2.813 ? ? metalc3 metalc ? ? A ASN 126 OD1 ? ? ? 1_555 D MG . MG ? ? A ASN 136 A MG 302 1_555 ? ? ? ? ? ? ? 2.091 ? ? metalc4 metalc ? ? C CTP . O1A ? ? ? 1_555 D MG . MG ? ? A CTP 301 A MG 302 1_555 ? ? ? ? ? ? ? 2.084 ? ? metalc5 metalc ? ? C CTP . O2B ? ? ? 1_555 D MG . MG ? ? A CTP 301 A MG 302 1_555 ? ? ? ? ? ? ? 2.090 ? ? metalc6 metalc ? ? C CTP . O2G ? ? ? 1_555 D MG . MG ? ? A CTP 301 A MG 302 1_555 ? ? ? ? ? ? ? 2.086 ? ? metalc7 metalc ? ? B GLU 125 OE1 ? ? ? 1_555 F MG . MG ? ? B GLU 135 B MG 302 1_555 ? ? ? ? ? ? ? 2.082 ? ? metalc8 metalc ? ? B GLU 125 OE2 ? ? ? 1_555 F MG . MG ? ? B GLU 135 B MG 302 1_555 ? ? ? ? ? ? ? 2.802 ? ? metalc9 metalc ? ? B ASN 126 OD1 ? ? ? 1_555 F MG . MG ? ? B ASN 136 B MG 302 1_555 ? ? ? ? ? ? ? 2.092 ? ? metalc10 metalc ? ? E CTP . O1A ? ? ? 1_555 F MG . MG ? ? B CTP 301 B MG 302 1_555 ? ? ? ? ? ? ? 2.085 ? ? metalc11 metalc ? ? E CTP . O2B ? ? ? 1_555 F MG . MG ? ? B CTP 301 B MG 302 1_555 ? ? ? ? ? ? ? 2.090 ? ? metalc12 metalc ? ? E CTP . O3G ? ? ? 1_555 F MG . MG ? ? B CTP 301 B MG 302 1_555 ? ? ? ? ? ? ? 2.087 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 35 ? PRO A 38 ? ARG A 45 PRO A 48 AA1 2 THR A 105 ? VAL A 110 ? THR A 115 VAL A 120 AA1 3 ILE A 74 ? PRO A 78 ? ILE A 84 PRO A 88 AA1 4 TYR A 86 ? ALA A 90 ? TYR A 96 ALA A 100 AA1 5 LEU A 42 ? ARG A 44 ? LEU A 52 ARG A 54 AA2 1 ARG B 35 ? PRO B 38 ? ARG B 45 PRO B 48 AA2 2 THR B 105 ? VAL B 110 ? THR B 115 VAL B 120 AA2 3 ILE B 74 ? PRO B 78 ? ILE B 84 PRO B 88 AA2 4 TYR B 86 ? ALA B 90 ? TYR B 96 ALA B 100 AA2 5 LEU B 42 ? ARG B 44 ? LEU B 52 ARG B 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 35 ? N ARG A 45 O ILE A 108 ? O ILE A 118 AA1 2 3 O PRO A 107 ? O PRO A 117 N ILE A 74 ? N ILE A 84 AA1 3 4 N ARG A 77 ? N ARG A 87 O GLN A 87 ? O GLN A 97 AA1 4 5 O ILE A 88 ? O ILE A 98 N GLN A 43 ? N GLN A 53 AA2 1 2 N ARG B 35 ? N ARG B 45 O ILE B 108 ? O ILE B 118 AA2 2 3 O PRO B 107 ? O PRO B 117 N ILE B 74 ? N ILE B 84 AA2 3 4 N ARG B 77 ? N ARG B 87 O GLN B 87 ? O GLN B 97 AA2 4 5 O ILE B 88 ? O ILE B 98 N GLN B 43 ? N GLN B 53 # _atom_sites.entry_id 7BM8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014397 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002126 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017833 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014165 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 11 ? ? ? A . n A 1 2 SER 2 12 ? ? ? A . n A 1 3 GLU 3 13 ? ? ? A . n A 1 4 GLY 4 14 ? ? ? A . n A 1 5 ARG 5 15 ? ? ? A . n A 1 6 ARG 6 16 ? ? ? A . n A 1 7 GLY 7 17 ? ? ? A . n A 1 8 LEU 8 18 ? ? ? A . n A 1 9 GLY 9 19 ? ? ? A . n A 1 10 ARG 10 20 ? ? ? A . n A 1 11 GLY 11 21 ? ? ? A . n A 1 12 LEU 12 22 ? ? ? A . n A 1 13 SER 13 23 ? ? ? A . n A 1 14 ALA 14 24 ? ? ? A . n A 1 15 LEU 15 25 ? ? ? A . n A 1 16 LEU 16 26 ? ? ? A . n A 1 17 GLY 17 27 ? ? ? A . n A 1 18 GLU 18 28 ? ? ? A . n A 1 19 VAL 19 29 ? ? ? A . n A 1 20 ASP 20 30 ? ? ? A . n A 1 21 ALA 21 31 ? ? ? A . n A 1 22 ALA 22 32 ? ? ? A . n A 1 23 PRO 23 33 ? ? ? A . n A 1 24 ALA 24 34 ? ? ? A . n A 1 25 GLN 25 35 ? ? ? A . n A 1 26 ALA 26 36 ? ? ? A . n A 1 27 PRO 27 37 ? ? ? A . n A 1 28 GLY 28 38 ? ? ? A . n A 1 29 GLU 29 39 ? ? ? A . n A 1 30 GLN 30 40 ? ? ? A . n A 1 31 LEU 31 41 ? ? ? A . n A 1 32 GLY 32 42 42 GLY GLY A . n A 1 33 GLY 33 43 43 GLY GLY A . n A 1 34 SER 34 44 44 SER SER A . n A 1 35 ARG 35 45 45 ARG ARG A . n A 1 36 GLU 36 46 46 GLU GLU A . n A 1 37 ALA 37 47 47 ALA ALA A . n A 1 38 PRO 38 48 48 PRO PRO A . n A 1 39 ILE 39 49 49 ILE ILE A . n A 1 40 GLU 40 50 50 GLU GLU A . n A 1 41 ILE 41 51 51 ILE ILE A . n A 1 42 LEU 42 52 52 LEU LEU A . n A 1 43 GLN 43 53 53 GLN GLN A . n A 1 44 ARG 44 54 54 ARG ARG A . n A 1 45 ASN 45 55 55 ASN ASN A . n A 1 46 PRO 46 56 56 PRO PRO A . n A 1 47 ASP 47 57 57 ASP ASP A . n A 1 48 GLN 48 58 58 GLN GLN A . n A 1 49 PRO 49 59 59 PRO PRO A . n A 1 50 ARG 50 60 60 ARG ARG A . n A 1 51 ARG 51 61 61 ARG ARG A . n A 1 52 THR 52 62 62 THR THR A . n A 1 53 PHE 53 63 63 PHE PHE A . n A 1 54 ARG 54 64 64 ARG ARG A . n A 1 55 GLU 55 65 65 GLU GLU A . n A 1 56 GLU 56 66 66 GLU GLU A . n A 1 57 ASP 57 67 67 ASP ASP A . n A 1 58 LEU 58 68 68 LEU LEU A . n A 1 59 GLU 59 69 69 GLU GLU A . n A 1 60 ASP 60 70 70 ASP ASP A . n A 1 61 LEU 61 71 71 LEU LEU A . n A 1 62 SER 62 72 72 SER SER A . n A 1 63 ASN 63 73 73 ASN ASN A . n A 1 64 SER 64 74 74 SER SER A . n A 1 65 ILE 65 75 75 ILE ILE A . n A 1 66 ARG 66 76 76 ARG ARG A . n A 1 67 GLU 67 77 77 GLU GLU A . n A 1 68 LYS 68 78 78 LYS LYS A . n A 1 69 GLY 69 79 79 GLY GLY A . n A 1 70 VAL 70 80 80 VAL VAL A . n A 1 71 LEU 71 81 81 LEU LEU A . n A 1 72 GLN 72 82 82 GLN GLN A . n A 1 73 PRO 73 83 83 PRO PRO A . n A 1 74 ILE 74 84 84 ILE ILE A . n A 1 75 LEU 75 85 85 LEU LEU A . n A 1 76 VAL 76 86 86 VAL VAL A . n A 1 77 ARG 77 87 87 ARG ARG A . n A 1 78 PRO 78 88 88 PRO PRO A . n A 1 79 SER 79 89 89 SER SER A . n A 1 80 PRO 80 90 90 PRO PRO A . n A 1 81 ASP 81 91 91 ASP ASP A . n A 1 82 THR 82 92 92 THR THR A . n A 1 83 ALA 83 93 93 ALA ALA A . n A 1 84 GLY 84 94 94 GLY GLY A . n A 1 85 GLU 85 95 95 GLU GLU A . n A 1 86 TYR 86 96 96 TYR TYR A . n A 1 87 GLN 87 97 97 GLN GLN A . n A 1 88 ILE 88 98 98 ILE ILE A . n A 1 89 VAL 89 99 99 VAL VAL A . n A 1 90 ALA 90 100 100 ALA ALA A . n A 1 91 GLY 91 101 101 GLY GLY A . n A 1 92 GLU 92 102 102 GLU GLU A . n A 1 93 ARG 93 103 103 ARG ARG A . n A 1 94 ARG 94 104 104 ARG ARG A . n A 1 95 TRP 95 105 105 TRP TRP A . n A 1 96 ARG 96 106 106 ARG ARG A . n A 1 97 ALA 97 107 107 ALA ALA A . n A 1 98 ALA 98 108 108 ALA ALA A . n A 1 99 GLN 99 109 109 GLN GLN A . n A 1 100 ARG 100 110 110 ARG ARG A . n A 1 101 ALA 101 111 111 ALA ALA A . n A 1 102 GLY 102 112 112 GLY GLY A . n A 1 103 LEU 103 113 113 LEU LEU A . n A 1 104 LYS 104 114 114 LYS LYS A . n A 1 105 THR 105 115 115 THR THR A . n A 1 106 VAL 106 116 116 VAL VAL A . n A 1 107 PRO 107 117 117 PRO PRO A . n A 1 108 ILE 108 118 118 ILE ILE A . n A 1 109 MET 109 119 119 MET MET A . n A 1 110 VAL 110 120 120 VAL VAL A . n A 1 111 ARG 111 121 121 ARG ARG A . n A 1 112 GLU 112 122 122 GLU GLU A . n A 1 113 LEU 113 123 123 LEU LEU A . n A 1 114 ASP 114 124 124 ASP ASP A . n A 1 115 ASP 115 125 125 ASP ASP A . n A 1 116 LEU 116 126 126 LEU LEU A . n A 1 117 ALA 117 127 127 ALA ALA A . n A 1 118 VAL 118 128 128 VAL VAL A . n A 1 119 LEU 119 129 129 LEU LEU A . n A 1 120 GLU 120 130 130 GLU GLU A . n A 1 121 ILE 121 131 131 ILE ILE A . n A 1 122 GLY 122 132 132 GLY GLY A . n A 1 123 ILE 123 133 133 ILE ILE A . n A 1 124 ILE 124 134 134 ILE ILE A . n A 1 125 GLU 125 135 135 GLU GLU A . n A 1 126 ASN 126 136 136 ASN ASN A . n A 1 127 VAL 127 137 137 VAL VAL A . n A 1 128 GLN 128 138 138 GLN GLN A . n A 1 129 ARG 129 139 139 ARG ARG A . n A 1 130 ALA 130 140 140 ALA ALA A . n A 1 131 ASP 131 141 141 ASP ASP A . n A 1 132 LEU 132 142 142 LEU LEU A . n A 1 133 ASN 133 143 143 ASN ASN A . n A 1 134 VAL 134 144 144 VAL VAL A . n A 1 135 LEU 135 145 145 LEU LEU A . n A 1 136 GLU 136 146 146 GLU GLU A . n A 1 137 GLU 137 147 147 GLU GLU A . n A 1 138 ALA 138 148 148 ALA ALA A . n A 1 139 LEU 139 149 149 LEU LEU A . n A 1 140 SER 140 150 150 SER SER A . n A 1 141 TYR 141 151 151 TYR TYR A . n A 1 142 LYS 142 152 152 LYS LYS A . n A 1 143 VAL 143 153 153 VAL VAL A . n A 1 144 LEU 144 154 154 LEU LEU A . n A 1 145 MET 145 155 155 MET MET A . n A 1 146 GLU 146 156 156 GLU GLU A . n A 1 147 LYS 147 157 157 LYS LYS A . n A 1 148 PHE 148 158 158 PHE PHE A . n A 1 149 GLU 149 159 159 GLU GLU A . n A 1 150 ARG 150 160 160 ARG ARG A . n A 1 151 THR 151 161 161 THR THR A . n A 1 152 GLN 152 162 162 GLN GLN A . n A 1 153 GLU 153 163 163 GLU GLU A . n A 1 154 ASN 154 164 164 ASN ASN A . n A 1 155 ILE 155 165 165 ILE ILE A . n A 1 156 ALA 156 166 166 ALA ALA A . n A 1 157 GLN 157 167 167 GLN GLN A . n A 1 158 THR 158 168 168 THR THR A . n A 1 159 ILE 159 169 169 ILE ILE A . n A 1 160 GLY 160 170 170 GLY GLY A . n A 1 161 LYS 161 171 171 LYS LYS A . n A 1 162 SER 162 172 172 SER SER A . n A 1 163 ARG 163 173 173 ARG ARG A . n A 1 164 SER 164 174 174 SER SER A . n A 1 165 HIS 165 175 175 HIS HIS A . n A 1 166 VAL 166 176 176 VAL VAL A . n A 1 167 ALA 167 177 177 ALA ALA A . n A 1 168 ASN 168 178 178 ASN ASN A . n A 1 169 THR 169 179 179 THR THR A . n A 1 170 MET 170 180 180 MET MET A . n A 1 171 ARG 171 181 181 ARG ARG A . n A 1 172 LEU 172 182 182 LEU LEU A . n A 1 173 LEU 173 183 183 LEU LEU A . n A 1 174 ALA 174 184 184 ALA ALA A . n A 1 175 LEU 175 185 185 LEU LEU A . n A 1 176 PRO 176 186 186 PRO PRO A . n A 1 177 ASP 177 187 187 ASP ASP A . n A 1 178 GLU 178 188 188 GLU GLU A . n A 1 179 VAL 179 189 189 VAL VAL A . n A 1 180 GLN 180 190 190 GLN GLN A . n A 1 181 SER 181 191 191 SER SER A . n A 1 182 TYR 182 192 192 TYR TYR A . n A 1 183 LEU 183 193 193 LEU LEU A . n A 1 184 VAL 184 194 194 VAL VAL A . n A 1 185 SER 185 195 195 SER SER A . n A 1 186 GLY 186 196 196 GLY GLY A . n A 1 187 GLU 187 197 197 GLU GLU A . n A 1 188 LEU 188 198 198 LEU LEU A . n A 1 189 THR 189 199 199 THR THR A . n A 1 190 ALA 190 200 200 ALA ALA A . n A 1 191 GLY 191 201 201 GLY GLY A . n A 1 192 HIS 192 202 202 HIS HIS A . n A 1 193 ALA 193 203 203 ALA ALA A . n A 1 194 ARG 194 204 204 ARG ARG A . n A 1 195 ALA 195 205 205 ALA ALA A . n A 1 196 ILE 196 206 206 ILE ILE A . n A 1 197 ALA 197 207 207 ALA ALA A . n A 1 198 ALA 198 208 208 ALA ALA A . n A 1 199 ALA 199 209 209 ALA ALA A . n A 1 200 ALA 200 210 210 ALA ALA A . n A 1 201 ASP 201 211 211 ASP ASP A . n A 1 202 PRO 202 212 212 PRO PRO A . n A 1 203 VAL 203 213 213 VAL VAL A . n A 1 204 ALA 204 214 214 ALA ALA A . n A 1 205 LEU 205 215 215 LEU LEU A . n A 1 206 ALA 206 216 216 ALA ALA A . n A 1 207 LYS 207 217 217 LYS LYS A . n A 1 208 GLN 208 218 218 GLN GLN A . n A 1 209 ILE 209 219 219 ILE ILE A . n A 1 210 ILE 210 220 220 ILE ILE A . n A 1 211 GLU 211 221 221 GLU GLU A . n A 1 212 GLY 212 222 ? ? ? A . n A 1 213 GLY 213 223 ? ? ? A . n A 1 214 LEU 214 224 ? ? ? A . n A 1 215 SER 215 225 ? ? ? A . n A 1 216 VAL 216 226 ? ? ? A . n A 1 217 ARG 217 227 ? ? ? A . n A 1 218 GLU 218 228 ? ? ? A . n A 1 219 THR 219 229 ? ? ? A . n A 1 220 GLU 220 230 ? ? ? A . n A 1 221 ALA 221 231 ? ? ? A . n A 1 222 LEU 222 232 ? ? ? A . n A 1 223 ALA 223 233 ? ? ? A . n A 1 224 ARG 224 234 ? ? ? A . n A 1 225 LYS 225 235 ? ? ? A . n A 1 226 ALA 226 236 ? ? ? A . n A 1 227 PRO 227 237 ? ? ? A . n A 1 228 ASN 228 238 ? ? ? A . n A 1 229 LEU 229 239 ? ? ? A . n A 1 230 SER 230 240 ? ? ? A . n A 1 231 ALA 231 241 ? ? ? A . n A 1 232 GLY 232 242 ? ? ? A . n A 1 233 LYS 233 243 ? ? ? A . n A 1 234 SER 234 244 ? ? ? A . n A 1 235 LYS 235 245 ? ? ? A . n A 1 236 GLY 236 246 ? ? ? A . n A 1 237 GLY 237 247 ? ? ? A . n A 1 238 ARG 238 248 ? ? ? A . n A 1 239 PRO 239 249 ? ? ? A . n A 1 240 PRO 240 250 ? ? ? A . n A 1 241 ARG 241 251 ? ? ? A . n A 1 242 VAL 242 252 ? ? ? A . n A 1 243 LYS 243 253 ? ? ? A . n A 1 244 ASP 244 254 ? ? ? A . n A 1 245 LYS 245 255 ? ? ? A . n A 1 246 LEU 246 256 ? ? ? A . n A 1 247 ALA 247 257 ? ? ? A . n A 1 248 ALA 248 258 ? ? ? A . n A 1 249 ALA 249 259 ? ? ? A . n A 1 250 LEU 250 260 ? ? ? A . n A 1 251 GLU 251 261 ? ? ? A . n A 1 252 HIS 252 262 ? ? ? A . n A 1 253 HIS 253 263 ? ? ? A . n A 1 254 HIS 254 264 ? ? ? A . n A 1 255 HIS 255 265 ? ? ? A . n A 1 256 HIS 256 266 ? ? ? A . n A 1 257 HIS 257 267 ? ? ? A . n B 1 1 MET 1 11 ? ? ? B . n B 1 2 SER 2 12 ? ? ? B . n B 1 3 GLU 3 13 ? ? ? B . n B 1 4 GLY 4 14 ? ? ? B . n B 1 5 ARG 5 15 ? ? ? B . n B 1 6 ARG 6 16 ? ? ? B . n B 1 7 GLY 7 17 ? ? ? B . n B 1 8 LEU 8 18 ? ? ? B . n B 1 9 GLY 9 19 ? ? ? B . n B 1 10 ARG 10 20 ? ? ? B . n B 1 11 GLY 11 21 ? ? ? B . n B 1 12 LEU 12 22 ? ? ? B . n B 1 13 SER 13 23 ? ? ? B . n B 1 14 ALA 14 24 ? ? ? B . n B 1 15 LEU 15 25 ? ? ? B . n B 1 16 LEU 16 26 ? ? ? B . n B 1 17 GLY 17 27 ? ? ? B . n B 1 18 GLU 18 28 ? ? ? B . n B 1 19 VAL 19 29 ? ? ? B . n B 1 20 ASP 20 30 ? ? ? B . n B 1 21 ALA 21 31 ? ? ? B . n B 1 22 ALA 22 32 ? ? ? B . n B 1 23 PRO 23 33 ? ? ? B . n B 1 24 ALA 24 34 ? ? ? B . n B 1 25 GLN 25 35 ? ? ? B . n B 1 26 ALA 26 36 ? ? ? B . n B 1 27 PRO 27 37 ? ? ? B . n B 1 28 GLY 28 38 ? ? ? B . n B 1 29 GLU 29 39 ? ? ? B . n B 1 30 GLN 30 40 ? ? ? B . n B 1 31 LEU 31 41 ? ? ? B . n B 1 32 GLY 32 42 42 GLY GLY B . n B 1 33 GLY 33 43 43 GLY GLY B . n B 1 34 SER 34 44 44 SER SER B . n B 1 35 ARG 35 45 45 ARG ARG B . n B 1 36 GLU 36 46 46 GLU GLU B . n B 1 37 ALA 37 47 47 ALA ALA B . n B 1 38 PRO 38 48 48 PRO PRO B . n B 1 39 ILE 39 49 49 ILE ILE B . n B 1 40 GLU 40 50 50 GLU GLU B . n B 1 41 ILE 41 51 51 ILE ILE B . n B 1 42 LEU 42 52 52 LEU LEU B . n B 1 43 GLN 43 53 53 GLN GLN B . n B 1 44 ARG 44 54 54 ARG ARG B . n B 1 45 ASN 45 55 55 ASN ASN B . n B 1 46 PRO 46 56 56 PRO PRO B . n B 1 47 ASP 47 57 57 ASP ASP B . n B 1 48 GLN 48 58 58 GLN GLN B . n B 1 49 PRO 49 59 59 PRO PRO B . n B 1 50 ARG 50 60 60 ARG ARG B . n B 1 51 ARG 51 61 61 ARG ARG B . n B 1 52 THR 52 62 62 THR THR B . n B 1 53 PHE 53 63 63 PHE PHE B . n B 1 54 ARG 54 64 64 ARG ARG B . n B 1 55 GLU 55 65 65 GLU GLU B . n B 1 56 GLU 56 66 66 GLU GLU B . n B 1 57 ASP 57 67 67 ASP ASP B . n B 1 58 LEU 58 68 68 LEU LEU B . n B 1 59 GLU 59 69 69 GLU GLU B . n B 1 60 ASP 60 70 70 ASP ASP B . n B 1 61 LEU 61 71 71 LEU LEU B . n B 1 62 SER 62 72 72 SER SER B . n B 1 63 ASN 63 73 73 ASN ASN B . n B 1 64 SER 64 74 74 SER SER B . n B 1 65 ILE 65 75 75 ILE ILE B . n B 1 66 ARG 66 76 76 ARG ARG B . n B 1 67 GLU 67 77 77 GLU GLU B . n B 1 68 LYS 68 78 78 LYS LYS B . n B 1 69 GLY 69 79 79 GLY GLY B . n B 1 70 VAL 70 80 80 VAL VAL B . n B 1 71 LEU 71 81 81 LEU LEU B . n B 1 72 GLN 72 82 82 GLN GLN B . n B 1 73 PRO 73 83 83 PRO PRO B . n B 1 74 ILE 74 84 84 ILE ILE B . n B 1 75 LEU 75 85 85 LEU LEU B . n B 1 76 VAL 76 86 86 VAL VAL B . n B 1 77 ARG 77 87 87 ARG ARG B . n B 1 78 PRO 78 88 88 PRO PRO B . n B 1 79 SER 79 89 89 SER SER B . n B 1 80 PRO 80 90 90 PRO PRO B . n B 1 81 ASP 81 91 91 ASP ASP B . n B 1 82 THR 82 92 92 THR THR B . n B 1 83 ALA 83 93 93 ALA ALA B . n B 1 84 GLY 84 94 94 GLY GLY B . n B 1 85 GLU 85 95 95 GLU GLU B . n B 1 86 TYR 86 96 96 TYR TYR B . n B 1 87 GLN 87 97 97 GLN GLN B . n B 1 88 ILE 88 98 98 ILE ILE B . n B 1 89 VAL 89 99 99 VAL VAL B . n B 1 90 ALA 90 100 100 ALA ALA B . n B 1 91 GLY 91 101 101 GLY GLY B . n B 1 92 GLU 92 102 102 GLU GLU B . n B 1 93 ARG 93 103 103 ARG ARG B . n B 1 94 ARG 94 104 104 ARG ARG B . n B 1 95 TRP 95 105 105 TRP TRP B . n B 1 96 ARG 96 106 106 ARG ARG B . n B 1 97 ALA 97 107 107 ALA ALA B . n B 1 98 ALA 98 108 108 ALA ALA B . n B 1 99 GLN 99 109 109 GLN GLN B . n B 1 100 ARG 100 110 110 ARG ARG B . n B 1 101 ALA 101 111 111 ALA ALA B . n B 1 102 GLY 102 112 112 GLY GLY B . n B 1 103 LEU 103 113 113 LEU LEU B . n B 1 104 LYS 104 114 114 LYS LYS B . n B 1 105 THR 105 115 115 THR THR B . n B 1 106 VAL 106 116 116 VAL VAL B . n B 1 107 PRO 107 117 117 PRO PRO B . n B 1 108 ILE 108 118 118 ILE ILE B . n B 1 109 MET 109 119 119 MET MET B . n B 1 110 VAL 110 120 120 VAL VAL B . n B 1 111 ARG 111 121 121 ARG ARG B . n B 1 112 GLU 112 122 122 GLU GLU B . n B 1 113 LEU 113 123 123 LEU LEU B . n B 1 114 ASP 114 124 124 ASP ASP B . n B 1 115 ASP 115 125 125 ASP ASP B . n B 1 116 LEU 116 126 126 LEU LEU B . n B 1 117 ALA 117 127 127 ALA ALA B . n B 1 118 VAL 118 128 128 VAL VAL B . n B 1 119 LEU 119 129 129 LEU LEU B . n B 1 120 GLU 120 130 130 GLU GLU B . n B 1 121 ILE 121 131 131 ILE ILE B . n B 1 122 GLY 122 132 132 GLY GLY B . n B 1 123 ILE 123 133 133 ILE ILE B . n B 1 124 ILE 124 134 134 ILE ILE B . n B 1 125 GLU 125 135 135 GLU GLU B . n B 1 126 ASN 126 136 136 ASN ASN B . n B 1 127 VAL 127 137 137 VAL VAL B . n B 1 128 GLN 128 138 138 GLN GLN B . n B 1 129 ARG 129 139 139 ARG ARG B . n B 1 130 ALA 130 140 140 ALA ALA B . n B 1 131 ASP 131 141 141 ASP ASP B . n B 1 132 LEU 132 142 142 LEU LEU B . n B 1 133 ASN 133 143 143 ASN ASN B . n B 1 134 VAL 134 144 144 VAL VAL B . n B 1 135 LEU 135 145 145 LEU LEU B . n B 1 136 GLU 136 146 146 GLU GLU B . n B 1 137 GLU 137 147 147 GLU GLU B . n B 1 138 ALA 138 148 148 ALA ALA B . n B 1 139 LEU 139 149 149 LEU LEU B . n B 1 140 SER 140 150 150 SER SER B . n B 1 141 TYR 141 151 151 TYR TYR B . n B 1 142 LYS 142 152 152 LYS LYS B . n B 1 143 VAL 143 153 153 VAL VAL B . n B 1 144 LEU 144 154 154 LEU LEU B . n B 1 145 MET 145 155 155 MET MET B . n B 1 146 GLU 146 156 156 GLU GLU B . n B 1 147 LYS 147 157 157 LYS LYS B . n B 1 148 PHE 148 158 158 PHE PHE B . n B 1 149 GLU 149 159 159 GLU GLU B . n B 1 150 ARG 150 160 160 ARG ARG B . n B 1 151 THR 151 161 161 THR THR B . n B 1 152 GLN 152 162 162 GLN GLN B . n B 1 153 GLU 153 163 163 GLU GLU B . n B 1 154 ASN 154 164 164 ASN ASN B . n B 1 155 ILE 155 165 165 ILE ILE B . n B 1 156 ALA 156 166 166 ALA ALA B . n B 1 157 GLN 157 167 167 GLN GLN B . n B 1 158 THR 158 168 168 THR THR B . n B 1 159 ILE 159 169 169 ILE ILE B . n B 1 160 GLY 160 170 170 GLY GLY B . n B 1 161 LYS 161 171 171 LYS LYS B . n B 1 162 SER 162 172 172 SER SER B . n B 1 163 ARG 163 173 173 ARG ARG B . n B 1 164 SER 164 174 174 SER SER B . n B 1 165 HIS 165 175 175 HIS HIS B . n B 1 166 VAL 166 176 176 VAL VAL B . n B 1 167 ALA 167 177 177 ALA ALA B . n B 1 168 ASN 168 178 178 ASN ASN B . n B 1 169 THR 169 179 179 THR THR B . n B 1 170 MET 170 180 180 MET MET B . n B 1 171 ARG 171 181 181 ARG ARG B . n B 1 172 LEU 172 182 182 LEU LEU B . n B 1 173 LEU 173 183 183 LEU LEU B . n B 1 174 ALA 174 184 184 ALA ALA B . n B 1 175 LEU 175 185 185 LEU LEU B . n B 1 176 PRO 176 186 186 PRO PRO B . n B 1 177 ASP 177 187 187 ASP ASP B . n B 1 178 GLU 178 188 188 GLU GLU B . n B 1 179 VAL 179 189 189 VAL VAL B . n B 1 180 GLN 180 190 190 GLN GLN B . n B 1 181 SER 181 191 191 SER SER B . n B 1 182 TYR 182 192 192 TYR TYR B . n B 1 183 LEU 183 193 193 LEU LEU B . n B 1 184 VAL 184 194 194 VAL VAL B . n B 1 185 SER 185 195 195 SER SER B . n B 1 186 GLY 186 196 196 GLY GLY B . n B 1 187 GLU 187 197 197 GLU GLU B . n B 1 188 LEU 188 198 198 LEU LEU B . n B 1 189 THR 189 199 199 THR THR B . n B 1 190 ALA 190 200 200 ALA ALA B . n B 1 191 GLY 191 201 201 GLY GLY B . n B 1 192 HIS 192 202 202 HIS HIS B . n B 1 193 ALA 193 203 203 ALA ALA B . n B 1 194 ARG 194 204 204 ARG ARG B . n B 1 195 ALA 195 205 205 ALA ALA B . n B 1 196 ILE 196 206 206 ILE ILE B . n B 1 197 ALA 197 207 207 ALA ALA B . n B 1 198 ALA 198 208 208 ALA ALA B . n B 1 199 ALA 199 209 209 ALA ALA B . n B 1 200 ALA 200 210 210 ALA ALA B . n B 1 201 ASP 201 211 211 ASP ASP B . n B 1 202 PRO 202 212 212 PRO PRO B . n B 1 203 VAL 203 213 213 VAL VAL B . n B 1 204 ALA 204 214 214 ALA ALA B . n B 1 205 LEU 205 215 215 LEU LEU B . n B 1 206 ALA 206 216 216 ALA ALA B . n B 1 207 LYS 207 217 217 LYS LYS B . n B 1 208 GLN 208 218 218 GLN GLN B . n B 1 209 ILE 209 219 219 ILE ILE B . n B 1 210 ILE 210 220 220 ILE ILE B . n B 1 211 GLU 211 221 221 GLU GLU B . n B 1 212 GLY 212 222 ? ? ? B . n B 1 213 GLY 213 223 ? ? ? B . n B 1 214 LEU 214 224 ? ? ? B . n B 1 215 SER 215 225 ? ? ? B . n B 1 216 VAL 216 226 ? ? ? B . n B 1 217 ARG 217 227 ? ? ? B . n B 1 218 GLU 218 228 ? ? ? B . n B 1 219 THR 219 229 ? ? ? B . n B 1 220 GLU 220 230 ? ? ? B . n B 1 221 ALA 221 231 ? ? ? B . n B 1 222 LEU 222 232 ? ? ? B . n B 1 223 ALA 223 233 ? ? ? B . n B 1 224 ARG 224 234 ? ? ? B . n B 1 225 LYS 225 235 ? ? ? B . n B 1 226 ALA 226 236 ? ? ? B . n B 1 227 PRO 227 237 ? ? ? B . n B 1 228 ASN 228 238 ? ? ? B . n B 1 229 LEU 229 239 ? ? ? B . n B 1 230 SER 230 240 ? ? ? B . n B 1 231 ALA 231 241 ? ? ? B . n B 1 232 GLY 232 242 ? ? ? B . n B 1 233 LYS 233 243 ? ? ? B . n B 1 234 SER 234 244 ? ? ? B . n B 1 235 LYS 235 245 ? ? ? B . n B 1 236 GLY 236 246 ? ? ? B . n B 1 237 GLY 237 247 ? ? ? B . n B 1 238 ARG 238 248 ? ? ? B . n B 1 239 PRO 239 249 ? ? ? B . n B 1 240 PRO 240 250 ? ? ? B . n B 1 241 ARG 241 251 ? ? ? B . n B 1 242 VAL 242 252 ? ? ? B . n B 1 243 LYS 243 253 ? ? ? B . n B 1 244 ASP 244 254 ? ? ? B . n B 1 245 LYS 245 255 ? ? ? B . n B 1 246 LEU 246 256 ? ? ? B . n B 1 247 ALA 247 257 ? ? ? B . n B 1 248 ALA 248 258 ? ? ? B . n B 1 249 ALA 249 259 ? ? ? B . n B 1 250 LEU 250 260 ? ? ? B . n B 1 251 GLU 251 261 ? ? ? B . n B 1 252 HIS 252 262 ? ? ? B . n B 1 253 HIS 253 263 ? ? ? B . n B 1 254 HIS 254 264 ? ? ? B . n B 1 255 HIS 255 265 ? ? ? B . n B 1 256 HIS 256 266 ? ? ? B . n B 1 257 HIS 257 267 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 CTP 1 301 301 CTP CTP A . D 3 MG 1 302 501 MG MG A . E 2 CTP 1 301 301 CTP CTP B . F 3 MG 1 302 501 MG MG B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6340 ? 1 MORE -50 ? 1 'SSA (A^2)' 16490 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 125 ? A GLU 135 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 OE2 ? A GLU 125 ? A GLU 135 ? 1_555 50.9 ? 2 OE1 ? A GLU 125 ? A GLU 135 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 OD1 ? A ASN 126 ? A ASN 136 ? 1_555 84.6 ? 3 OE2 ? A GLU 125 ? A GLU 135 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 OD1 ? A ASN 126 ? A ASN 136 ? 1_555 82.3 ? 4 OE1 ? A GLU 125 ? A GLU 135 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O1A ? C CTP . ? A CTP 301 ? 1_555 153.1 ? 5 OE2 ? A GLU 125 ? A GLU 135 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O1A ? C CTP . ? A CTP 301 ? 1_555 146.8 ? 6 OD1 ? A ASN 126 ? A ASN 136 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O1A ? C CTP . ? A CTP 301 ? 1_555 80.7 ? 7 OE1 ? A GLU 125 ? A GLU 135 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O2B ? C CTP . ? A CTP 301 ? 1_555 108.7 ? 8 OE2 ? A GLU 125 ? A GLU 135 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O2B ? C CTP . ? A CTP 301 ? 1_555 102.1 ? 9 OD1 ? A ASN 126 ? A ASN 136 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O2B ? C CTP . ? A CTP 301 ? 1_555 165.9 ? 10 O1A ? C CTP . ? A CTP 301 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O2B ? C CTP . ? A CTP 301 ? 1_555 88.7 ? 11 OE1 ? A GLU 125 ? A GLU 135 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O2G ? C CTP . ? A CTP 301 ? 1_555 118.4 ? 12 OE2 ? A GLU 125 ? A GLU 135 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O2G ? C CTP . ? A CTP 301 ? 1_555 67.5 ? 13 OD1 ? A ASN 126 ? A ASN 136 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O2G ? C CTP . ? A CTP 301 ? 1_555 86.9 ? 14 O1A ? C CTP . ? A CTP 301 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O2G ? C CTP . ? A CTP 301 ? 1_555 83.3 ? 15 O2B ? C CTP . ? A CTP 301 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O2G ? C CTP . ? A CTP 301 ? 1_555 82.6 ? 16 OE1 ? B GLU 125 ? B GLU 135 ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 OE2 ? B GLU 125 ? B GLU 135 ? 1_555 51.1 ? 17 OE1 ? B GLU 125 ? B GLU 135 ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 OD1 ? B ASN 126 ? B ASN 136 ? 1_555 84.4 ? 18 OE2 ? B GLU 125 ? B GLU 135 ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 OD1 ? B ASN 126 ? B ASN 136 ? 1_555 82.7 ? 19 OE1 ? B GLU 125 ? B GLU 135 ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 O1A ? E CTP . ? B CTP 301 ? 1_555 152.5 ? 20 OE2 ? B GLU 125 ? B GLU 135 ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 O1A ? E CTP . ? B CTP 301 ? 1_555 147.8 ? 21 OD1 ? B ASN 126 ? B ASN 136 ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 O1A ? E CTP . ? B CTP 301 ? 1_555 81.2 ? 22 OE1 ? B GLU 125 ? B GLU 135 ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 O2B ? E CTP . ? B CTP 301 ? 1_555 107.3 ? 23 OE2 ? B GLU 125 ? B GLU 135 ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 O2B ? E CTP . ? B CTP 301 ? 1_555 101.2 ? 24 OD1 ? B ASN 126 ? B ASN 136 ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 O2B ? E CTP . ? B CTP 301 ? 1_555 167.5 ? 25 O1A ? E CTP . ? B CTP 301 ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 O2B ? E CTP . ? B CTP 301 ? 1_555 89.6 ? 26 OE1 ? B GLU 125 ? B GLU 135 ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 O3G ? E CTP . ? B CTP 301 ? 1_555 120.3 ? 27 OE2 ? B GLU 125 ? B GLU 135 ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 O3G ? E CTP . ? B CTP 301 ? 1_555 69.1 ? 28 OD1 ? B ASN 126 ? B ASN 136 ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 O3G ? E CTP . ? B CTP 301 ? 1_555 88.9 ? 29 O1A ? E CTP . ? B CTP 301 ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 O3G ? E CTP . ? B CTP 301 ? 1_555 82.8 ? 30 O2B ? E CTP . ? B CTP 301 ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 O3G ? E CTP . ? B CTP 301 ? 1_555 81.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-04-28 2 'Structure model' 1 1 2021-10-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 2 'Structure model' diffrn_source 5 2 'Structure model' pdbx_database_proc # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_database_2.pdbx_DOI' 11 2 'Structure model' '_database_2.pdbx_database_accession' 12 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7BM8 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 57 ? ? -93.48 35.14 2 1 GLU A 77 ? ? -74.34 -76.98 3 1 ASP B 57 ? ? -93.64 35.21 4 1 GLU B 77 ? ? -74.55 -76.68 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 64 ? CG ? A ARG 54 CG 2 1 Y 1 A ARG 64 ? CD ? A ARG 54 CD 3 1 Y 1 A ARG 64 ? NE ? A ARG 54 NE 4 1 Y 1 A ARG 64 ? CZ ? A ARG 54 CZ 5 1 Y 1 A ARG 64 ? NH1 ? A ARG 54 NH1 6 1 Y 1 A ARG 64 ? NH2 ? A ARG 54 NH2 7 1 Y 1 A GLU 66 ? CG ? A GLU 56 CG 8 1 Y 1 A GLU 66 ? CD ? A GLU 56 CD 9 1 Y 1 A GLU 66 ? OE1 ? A GLU 56 OE1 10 1 Y 1 A GLU 66 ? OE2 ? A GLU 56 OE2 11 1 Y 1 A LYS 114 ? CG ? A LYS 104 CG 12 1 Y 1 A LYS 114 ? CD ? A LYS 104 CD 13 1 Y 1 A LYS 114 ? CE ? A LYS 104 CE 14 1 Y 1 A LYS 114 ? NZ ? A LYS 104 NZ 15 1 Y 1 A GLU 188 ? CG ? A GLU 178 CG 16 1 Y 1 A GLU 188 ? CD ? A GLU 178 CD 17 1 Y 1 A GLU 188 ? OE1 ? A GLU 178 OE1 18 1 Y 1 A GLU 188 ? OE2 ? A GLU 178 OE2 19 1 Y 1 A SER 191 ? OG ? A SER 181 OG 20 1 Y 1 A TYR 192 ? CG ? A TYR 182 CG 21 1 Y 1 A TYR 192 ? CD1 ? A TYR 182 CD1 22 1 Y 1 A TYR 192 ? CD2 ? A TYR 182 CD2 23 1 Y 1 A TYR 192 ? CE1 ? A TYR 182 CE1 24 1 Y 1 A TYR 192 ? CE2 ? A TYR 182 CE2 25 1 Y 1 A TYR 192 ? CZ ? A TYR 182 CZ 26 1 Y 1 A TYR 192 ? OH ? A TYR 182 OH 27 1 Y 1 A VAL 194 ? CG1 ? A VAL 184 CG1 28 1 Y 1 A VAL 194 ? CG2 ? A VAL 184 CG2 29 1 Y 1 A SER 195 ? OG ? A SER 185 OG 30 1 Y 1 A GLU 197 ? CG ? A GLU 187 CG 31 1 Y 1 A GLU 197 ? CD ? A GLU 187 CD 32 1 Y 1 A GLU 197 ? OE1 ? A GLU 187 OE1 33 1 Y 1 A GLU 197 ? OE2 ? A GLU 187 OE2 34 1 Y 1 A LEU 198 ? CG ? A LEU 188 CG 35 1 Y 1 A LEU 198 ? CD1 ? A LEU 188 CD1 36 1 Y 1 A LEU 198 ? CD2 ? A LEU 188 CD2 37 1 Y 1 A THR 199 ? OG1 ? A THR 189 OG1 38 1 Y 1 A THR 199 ? CG2 ? A THR 189 CG2 39 1 Y 1 A HIS 202 ? CG ? A HIS 192 CG 40 1 Y 1 A HIS 202 ? ND1 ? A HIS 192 ND1 41 1 Y 1 A HIS 202 ? CD2 ? A HIS 192 CD2 42 1 Y 1 A HIS 202 ? CE1 ? A HIS 192 CE1 43 1 Y 1 A HIS 202 ? NE2 ? A HIS 192 NE2 44 1 Y 1 A ARG 204 ? CG ? A ARG 194 CG 45 1 Y 1 A ARG 204 ? CD ? A ARG 194 CD 46 1 Y 1 A ARG 204 ? NE ? A ARG 194 NE 47 1 Y 1 A ARG 204 ? CZ ? A ARG 194 CZ 48 1 Y 1 A ARG 204 ? NH1 ? A ARG 194 NH1 49 1 Y 1 A ARG 204 ? NH2 ? A ARG 194 NH2 50 1 Y 1 A ILE 206 ? CG1 ? A ILE 196 CG1 51 1 Y 1 A ILE 206 ? CG2 ? A ILE 196 CG2 52 1 Y 1 A ILE 206 ? CD1 ? A ILE 196 CD1 53 1 Y 1 A VAL 213 ? CG1 ? A VAL 203 CG1 54 1 Y 1 A VAL 213 ? CG2 ? A VAL 203 CG2 55 1 Y 1 A LEU 215 ? CG ? A LEU 205 CG 56 1 Y 1 A LEU 215 ? CD1 ? A LEU 205 CD1 57 1 Y 1 A LEU 215 ? CD2 ? A LEU 205 CD2 58 1 Y 1 A LYS 217 ? CG ? A LYS 207 CG 59 1 Y 1 A LYS 217 ? CD ? A LYS 207 CD 60 1 Y 1 A LYS 217 ? CE ? A LYS 207 CE 61 1 Y 1 A LYS 217 ? NZ ? A LYS 207 NZ 62 1 Y 1 A GLN 218 ? CG ? A GLN 208 CG 63 1 Y 1 A GLN 218 ? CD ? A GLN 208 CD 64 1 Y 1 A GLN 218 ? OE1 ? A GLN 208 OE1 65 1 Y 1 A GLN 218 ? NE2 ? A GLN 208 NE2 66 1 Y 1 A ILE 219 ? CG1 ? A ILE 209 CG1 67 1 Y 1 A ILE 219 ? CG2 ? A ILE 209 CG2 68 1 Y 1 A ILE 219 ? CD1 ? A ILE 209 CD1 69 1 Y 1 A ILE 220 ? CG1 ? A ILE 210 CG1 70 1 Y 1 A ILE 220 ? CG2 ? A ILE 210 CG2 71 1 Y 1 A ILE 220 ? CD1 ? A ILE 210 CD1 72 1 Y 1 A GLU 221 ? CG ? A GLU 211 CG 73 1 Y 1 A GLU 221 ? CD ? A GLU 211 CD 74 1 Y 1 A GLU 221 ? OE1 ? A GLU 211 OE1 75 1 Y 1 A GLU 221 ? OE2 ? A GLU 211 OE2 76 1 Y 1 B GLU 66 ? CG ? B GLU 56 CG 77 1 Y 1 B GLU 66 ? CD ? B GLU 56 CD 78 1 Y 1 B GLU 66 ? OE1 ? B GLU 56 OE1 79 1 Y 1 B GLU 66 ? OE2 ? B GLU 56 OE2 80 1 Y 1 B LYS 114 ? CG ? B LYS 104 CG 81 1 Y 1 B LYS 114 ? CD ? B LYS 104 CD 82 1 Y 1 B LYS 114 ? CE ? B LYS 104 CE 83 1 Y 1 B LYS 114 ? NZ ? B LYS 104 NZ 84 1 Y 1 B ARG 173 ? CG ? B ARG 163 CG 85 1 Y 1 B ARG 173 ? CD ? B ARG 163 CD 86 1 Y 1 B ARG 173 ? NE ? B ARG 163 NE 87 1 Y 1 B ARG 173 ? CZ ? B ARG 163 CZ 88 1 Y 1 B ARG 173 ? NH1 ? B ARG 163 NH1 89 1 Y 1 B ARG 173 ? NH2 ? B ARG 163 NH2 90 1 Y 1 B LEU 185 ? CG ? B LEU 175 CG 91 1 Y 1 B LEU 185 ? CD1 ? B LEU 175 CD1 92 1 Y 1 B LEU 185 ? CD2 ? B LEU 175 CD2 93 1 Y 1 B GLU 188 ? CG ? B GLU 178 CG 94 1 Y 1 B GLU 188 ? CD ? B GLU 178 CD 95 1 Y 1 B GLU 188 ? OE1 ? B GLU 178 OE1 96 1 Y 1 B GLU 188 ? OE2 ? B GLU 178 OE2 97 1 Y 1 B SER 191 ? OG ? B SER 181 OG 98 1 Y 1 B TYR 192 ? CG ? B TYR 182 CG 99 1 Y 1 B TYR 192 ? CD1 ? B TYR 182 CD1 100 1 Y 1 B TYR 192 ? CD2 ? B TYR 182 CD2 101 1 Y 1 B TYR 192 ? CE1 ? B TYR 182 CE1 102 1 Y 1 B TYR 192 ? CE2 ? B TYR 182 CE2 103 1 Y 1 B TYR 192 ? CZ ? B TYR 182 CZ 104 1 Y 1 B TYR 192 ? OH ? B TYR 182 OH 105 1 Y 1 B VAL 194 ? CG1 ? B VAL 184 CG1 106 1 Y 1 B VAL 194 ? CG2 ? B VAL 184 CG2 107 1 Y 1 B GLU 197 ? CG ? B GLU 187 CG 108 1 Y 1 B GLU 197 ? CD ? B GLU 187 CD 109 1 Y 1 B GLU 197 ? OE1 ? B GLU 187 OE1 110 1 Y 1 B GLU 197 ? OE2 ? B GLU 187 OE2 111 1 Y 1 B LEU 198 ? CG ? B LEU 188 CG 112 1 Y 1 B LEU 198 ? CD1 ? B LEU 188 CD1 113 1 Y 1 B LEU 198 ? CD2 ? B LEU 188 CD2 114 1 Y 1 B THR 199 ? OG1 ? B THR 189 OG1 115 1 Y 1 B THR 199 ? CG2 ? B THR 189 CG2 116 1 Y 1 B HIS 202 ? CG ? B HIS 192 CG 117 1 Y 1 B HIS 202 ? ND1 ? B HIS 192 ND1 118 1 Y 1 B HIS 202 ? CD2 ? B HIS 192 CD2 119 1 Y 1 B HIS 202 ? CE1 ? B HIS 192 CE1 120 1 Y 1 B HIS 202 ? NE2 ? B HIS 192 NE2 121 1 Y 1 B ARG 204 ? CG ? B ARG 194 CG 122 1 Y 1 B ARG 204 ? CD ? B ARG 194 CD 123 1 Y 1 B ARG 204 ? NE ? B ARG 194 NE 124 1 Y 1 B ARG 204 ? CZ ? B ARG 194 CZ 125 1 Y 1 B ARG 204 ? NH1 ? B ARG 194 NH1 126 1 Y 1 B ARG 204 ? NH2 ? B ARG 194 NH2 127 1 Y 1 B ILE 206 ? CG1 ? B ILE 196 CG1 128 1 Y 1 B ILE 206 ? CG2 ? B ILE 196 CG2 129 1 Y 1 B ILE 206 ? CD1 ? B ILE 196 CD1 130 1 Y 1 B VAL 213 ? CG1 ? B VAL 203 CG1 131 1 Y 1 B VAL 213 ? CG2 ? B VAL 203 CG2 132 1 Y 1 B LEU 215 ? CG ? B LEU 205 CG 133 1 Y 1 B LEU 215 ? CD1 ? B LEU 205 CD1 134 1 Y 1 B LEU 215 ? CD2 ? B LEU 205 CD2 135 1 Y 1 B LYS 217 ? CG ? B LYS 207 CG 136 1 Y 1 B LYS 217 ? CD ? B LYS 207 CD 137 1 Y 1 B LYS 217 ? CE ? B LYS 207 CE 138 1 Y 1 B LYS 217 ? NZ ? B LYS 207 NZ 139 1 Y 1 B GLN 218 ? CG ? B GLN 208 CG 140 1 Y 1 B GLN 218 ? CD ? B GLN 208 CD 141 1 Y 1 B GLN 218 ? OE1 ? B GLN 208 OE1 142 1 Y 1 B GLN 218 ? NE2 ? B GLN 208 NE2 143 1 Y 1 B ILE 219 ? CG1 ? B ILE 209 CG1 144 1 Y 1 B ILE 219 ? CG2 ? B ILE 209 CG2 145 1 Y 1 B ILE 219 ? CD1 ? B ILE 209 CD1 146 1 Y 1 B ILE 220 ? CG1 ? B ILE 210 CG1 147 1 Y 1 B ILE 220 ? CG2 ? B ILE 210 CG2 148 1 Y 1 B ILE 220 ? CD1 ? B ILE 210 CD1 149 1 Y 1 B GLU 221 ? CG ? B GLU 211 CG 150 1 Y 1 B GLU 221 ? CD ? B GLU 211 CD 151 1 Y 1 B GLU 221 ? OE1 ? B GLU 211 OE1 152 1 Y 1 B GLU 221 ? OE2 ? B GLU 211 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 11 ? A MET 1 2 1 Y 1 A SER 12 ? A SER 2 3 1 Y 1 A GLU 13 ? A GLU 3 4 1 Y 1 A GLY 14 ? A GLY 4 5 1 Y 1 A ARG 15 ? A ARG 5 6 1 Y 1 A ARG 16 ? A ARG 6 7 1 Y 1 A GLY 17 ? A GLY 7 8 1 Y 1 A LEU 18 ? A LEU 8 9 1 Y 1 A GLY 19 ? A GLY 9 10 1 Y 1 A ARG 20 ? A ARG 10 11 1 Y 1 A GLY 21 ? A GLY 11 12 1 Y 1 A LEU 22 ? A LEU 12 13 1 Y 1 A SER 23 ? A SER 13 14 1 Y 1 A ALA 24 ? A ALA 14 15 1 Y 1 A LEU 25 ? A LEU 15 16 1 Y 1 A LEU 26 ? A LEU 16 17 1 Y 1 A GLY 27 ? A GLY 17 18 1 Y 1 A GLU 28 ? A GLU 18 19 1 Y 1 A VAL 29 ? A VAL 19 20 1 Y 1 A ASP 30 ? A ASP 20 21 1 Y 1 A ALA 31 ? A ALA 21 22 1 Y 1 A ALA 32 ? A ALA 22 23 1 Y 1 A PRO 33 ? A PRO 23 24 1 Y 1 A ALA 34 ? A ALA 24 25 1 Y 1 A GLN 35 ? A GLN 25 26 1 Y 1 A ALA 36 ? A ALA 26 27 1 Y 1 A PRO 37 ? A PRO 27 28 1 Y 1 A GLY 38 ? A GLY 28 29 1 Y 1 A GLU 39 ? A GLU 29 30 1 Y 1 A GLN 40 ? A GLN 30 31 1 Y 1 A LEU 41 ? A LEU 31 32 1 Y 1 A GLY 222 ? A GLY 212 33 1 Y 1 A GLY 223 ? A GLY 213 34 1 Y 1 A LEU 224 ? A LEU 214 35 1 Y 1 A SER 225 ? A SER 215 36 1 Y 1 A VAL 226 ? A VAL 216 37 1 Y 1 A ARG 227 ? A ARG 217 38 1 Y 1 A GLU 228 ? A GLU 218 39 1 Y 1 A THR 229 ? A THR 219 40 1 Y 1 A GLU 230 ? A GLU 220 41 1 Y 1 A ALA 231 ? A ALA 221 42 1 Y 1 A LEU 232 ? A LEU 222 43 1 Y 1 A ALA 233 ? A ALA 223 44 1 Y 1 A ARG 234 ? A ARG 224 45 1 Y 1 A LYS 235 ? A LYS 225 46 1 Y 1 A ALA 236 ? A ALA 226 47 1 Y 1 A PRO 237 ? A PRO 227 48 1 Y 1 A ASN 238 ? A ASN 228 49 1 Y 1 A LEU 239 ? A LEU 229 50 1 Y 1 A SER 240 ? A SER 230 51 1 Y 1 A ALA 241 ? A ALA 231 52 1 Y 1 A GLY 242 ? A GLY 232 53 1 Y 1 A LYS 243 ? A LYS 233 54 1 Y 1 A SER 244 ? A SER 234 55 1 Y 1 A LYS 245 ? A LYS 235 56 1 Y 1 A GLY 246 ? A GLY 236 57 1 Y 1 A GLY 247 ? A GLY 237 58 1 Y 1 A ARG 248 ? A ARG 238 59 1 Y 1 A PRO 249 ? A PRO 239 60 1 Y 1 A PRO 250 ? A PRO 240 61 1 Y 1 A ARG 251 ? A ARG 241 62 1 Y 1 A VAL 252 ? A VAL 242 63 1 Y 1 A LYS 253 ? A LYS 243 64 1 Y 1 A ASP 254 ? A ASP 244 65 1 Y 1 A LYS 255 ? A LYS 245 66 1 Y 1 A LEU 256 ? A LEU 246 67 1 Y 1 A ALA 257 ? A ALA 247 68 1 Y 1 A ALA 258 ? A ALA 248 69 1 Y 1 A ALA 259 ? A ALA 249 70 1 Y 1 A LEU 260 ? A LEU 250 71 1 Y 1 A GLU 261 ? A GLU 251 72 1 Y 1 A HIS 262 ? A HIS 252 73 1 Y 1 A HIS 263 ? A HIS 253 74 1 Y 1 A HIS 264 ? A HIS 254 75 1 Y 1 A HIS 265 ? A HIS 255 76 1 Y 1 A HIS 266 ? A HIS 256 77 1 Y 1 A HIS 267 ? A HIS 257 78 1 Y 1 B MET 11 ? B MET 1 79 1 Y 1 B SER 12 ? B SER 2 80 1 Y 1 B GLU 13 ? B GLU 3 81 1 Y 1 B GLY 14 ? B GLY 4 82 1 Y 1 B ARG 15 ? B ARG 5 83 1 Y 1 B ARG 16 ? B ARG 6 84 1 Y 1 B GLY 17 ? B GLY 7 85 1 Y 1 B LEU 18 ? B LEU 8 86 1 Y 1 B GLY 19 ? B GLY 9 87 1 Y 1 B ARG 20 ? B ARG 10 88 1 Y 1 B GLY 21 ? B GLY 11 89 1 Y 1 B LEU 22 ? B LEU 12 90 1 Y 1 B SER 23 ? B SER 13 91 1 Y 1 B ALA 24 ? B ALA 14 92 1 Y 1 B LEU 25 ? B LEU 15 93 1 Y 1 B LEU 26 ? B LEU 16 94 1 Y 1 B GLY 27 ? B GLY 17 95 1 Y 1 B GLU 28 ? B GLU 18 96 1 Y 1 B VAL 29 ? B VAL 19 97 1 Y 1 B ASP 30 ? B ASP 20 98 1 Y 1 B ALA 31 ? B ALA 21 99 1 Y 1 B ALA 32 ? B ALA 22 100 1 Y 1 B PRO 33 ? B PRO 23 101 1 Y 1 B ALA 34 ? B ALA 24 102 1 Y 1 B GLN 35 ? B GLN 25 103 1 Y 1 B ALA 36 ? B ALA 26 104 1 Y 1 B PRO 37 ? B PRO 27 105 1 Y 1 B GLY 38 ? B GLY 28 106 1 Y 1 B GLU 39 ? B GLU 29 107 1 Y 1 B GLN 40 ? B GLN 30 108 1 Y 1 B LEU 41 ? B LEU 31 109 1 Y 1 B GLY 222 ? B GLY 212 110 1 Y 1 B GLY 223 ? B GLY 213 111 1 Y 1 B LEU 224 ? B LEU 214 112 1 Y 1 B SER 225 ? B SER 215 113 1 Y 1 B VAL 226 ? B VAL 216 114 1 Y 1 B ARG 227 ? B ARG 217 115 1 Y 1 B GLU 228 ? B GLU 218 116 1 Y 1 B THR 229 ? B THR 219 117 1 Y 1 B GLU 230 ? B GLU 220 118 1 Y 1 B ALA 231 ? B ALA 221 119 1 Y 1 B LEU 232 ? B LEU 222 120 1 Y 1 B ALA 233 ? B ALA 223 121 1 Y 1 B ARG 234 ? B ARG 224 122 1 Y 1 B LYS 235 ? B LYS 225 123 1 Y 1 B ALA 236 ? B ALA 226 124 1 Y 1 B PRO 237 ? B PRO 227 125 1 Y 1 B ASN 238 ? B ASN 228 126 1 Y 1 B LEU 239 ? B LEU 229 127 1 Y 1 B SER 240 ? B SER 230 128 1 Y 1 B ALA 241 ? B ALA 231 129 1 Y 1 B GLY 242 ? B GLY 232 130 1 Y 1 B LYS 243 ? B LYS 233 131 1 Y 1 B SER 244 ? B SER 234 132 1 Y 1 B LYS 245 ? B LYS 235 133 1 Y 1 B GLY 246 ? B GLY 236 134 1 Y 1 B GLY 247 ? B GLY 237 135 1 Y 1 B ARG 248 ? B ARG 238 136 1 Y 1 B PRO 249 ? B PRO 239 137 1 Y 1 B PRO 250 ? B PRO 240 138 1 Y 1 B ARG 251 ? B ARG 241 139 1 Y 1 B VAL 252 ? B VAL 242 140 1 Y 1 B LYS 253 ? B LYS 243 141 1 Y 1 B ASP 254 ? B ASP 244 142 1 Y 1 B LYS 255 ? B LYS 245 143 1 Y 1 B LEU 256 ? B LEU 246 144 1 Y 1 B ALA 257 ? B ALA 247 145 1 Y 1 B ALA 258 ? B ALA 248 146 1 Y 1 B ALA 259 ? B ALA 249 147 1 Y 1 B LEU 260 ? B LEU 250 148 1 Y 1 B GLU 261 ? B GLU 251 149 1 Y 1 B HIS 262 ? B HIS 252 150 1 Y 1 B HIS 263 ? B HIS 253 151 1 Y 1 B HIS 264 ? B HIS 254 152 1 Y 1 B HIS 265 ? B HIS 255 153 1 Y 1 B HIS 266 ? B HIS 256 154 1 Y 1 B HIS 267 ? B HIS 257 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Royal Society' 'United Kingdom' UF140053 1 'Royal Society' 'United Kingdom' RG150448 2 'Biotechnology and Biological Sciences Research Council (BBSRC)' 'United Kingdom' BB/P018165/1 3 'Biotechnology and Biological Sciences Research Council (BBSRC)' 'United Kingdom' BBS/E/J/000PR9791 4 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 CTP ? ? CTP ? ? 'SUBJECT OF INVESTIGATION' ? 2 MG ? ? MG ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "CYTIDINE-5'-TRIPHOSPHATE" CTP 3 'MAGNESIUM ION' MG # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #