data_7BOC # _entry.id 7BOC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.384 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7BOC pdb_00007boc 10.2210/pdb7boc/pdb WWPDB D_1292112072 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-09-15 2 'Structure model' 1 1 2024-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7BOC _pdbx_database_status.recvd_initial_deposition_date 2021-01-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Krzyzanowski, A.' 1 ? 't Hart, P.' 2 ? 'Waldmann, H.' 3 ? 'Gasper, R.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Chembiochem _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1439-7633 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 22 _citation.language ? _citation.page_first 1908 _citation.page_last 1914 _citation.title 'Biochemical Investigation of the Interaction of pICln, RioK1 and COPR5 with the PRMT5-MEP50 Complex.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/cbic.202100079 _citation.pdbx_database_id_PubMed 33624332 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Krzyzanowski, A.' 1 ? primary 'Gasper, R.' 2 ? primary 'Adihou, H.' 3 ? primary 't Hart, P.' 4 ? primary 'Waldmann, H.' 5 0000-0002-9606-7247 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein arginine N-methyltransferase 5' 33278.160 1 2.1.1.320 ? 'TIM barrel domain' ? 2 polymer syn peptide 1595.602 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;PRMT5,72 kDa ICln-binding protein,Histone-arginine N-methyltransferase PRMT5,Jak-binding protein 1,Shk1 kinase-binding protein 1 homolog,SKB1Hs ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNT LIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAP EDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNK KGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRP ; ;MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNT LIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAP EDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNK KGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRP ; A ? 2 'polypeptide(L)' no no SRVVPGQFDDADSSD SRVVPGQFDDADSSD B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ALA n 1 4 MET n 1 5 ALA n 1 6 VAL n 1 7 GLY n 1 8 GLY n 1 9 ALA n 1 10 GLY n 1 11 GLY n 1 12 SER n 1 13 ARG n 1 14 VAL n 1 15 SER n 1 16 SER n 1 17 GLY n 1 18 ARG n 1 19 ASP n 1 20 LEU n 1 21 ASN n 1 22 CYS n 1 23 VAL n 1 24 PRO n 1 25 GLU n 1 26 ILE n 1 27 ALA n 1 28 ASP n 1 29 THR n 1 30 LEU n 1 31 GLY n 1 32 ALA n 1 33 VAL n 1 34 ALA n 1 35 LYS n 1 36 GLN n 1 37 GLY n 1 38 PHE n 1 39 ASP n 1 40 PHE n 1 41 LEU n 1 42 CYS n 1 43 MET n 1 44 PRO n 1 45 VAL n 1 46 PHE n 1 47 HIS n 1 48 PRO n 1 49 ARG n 1 50 PHE n 1 51 LYS n 1 52 ARG n 1 53 GLU n 1 54 PHE n 1 55 ILE n 1 56 GLN n 1 57 GLU n 1 58 PRO n 1 59 ALA n 1 60 LYS n 1 61 ASN n 1 62 ARG n 1 63 PRO n 1 64 GLY n 1 65 PRO n 1 66 GLN n 1 67 THR n 1 68 ARG n 1 69 SER n 1 70 ASP n 1 71 LEU n 1 72 LEU n 1 73 LEU n 1 74 SER n 1 75 GLY n 1 76 ARG n 1 77 ASP n 1 78 TRP n 1 79 ASN n 1 80 THR n 1 81 LEU n 1 82 ILE n 1 83 VAL n 1 84 GLY n 1 85 LYS n 1 86 LEU n 1 87 SER n 1 88 PRO n 1 89 TRP n 1 90 ILE n 1 91 ARG n 1 92 PRO n 1 93 ASP n 1 94 SER n 1 95 LYS n 1 96 VAL n 1 97 GLU n 1 98 LYS n 1 99 ILE n 1 100 ARG n 1 101 ARG n 1 102 ASN n 1 103 SER n 1 104 GLU n 1 105 ALA n 1 106 ALA n 1 107 MET n 1 108 LEU n 1 109 GLN n 1 110 GLU n 1 111 LEU n 1 112 ASN n 1 113 PHE n 1 114 GLY n 1 115 ALA n 1 116 TYR n 1 117 LEU n 1 118 GLY n 1 119 LEU n 1 120 PRO n 1 121 ALA n 1 122 PHE n 1 123 LEU n 1 124 LEU n 1 125 PRO n 1 126 LEU n 1 127 ASN n 1 128 GLN n 1 129 GLU n 1 130 ASP n 1 131 ASN n 1 132 THR n 1 133 ASN n 1 134 LEU n 1 135 ALA n 1 136 ARG n 1 137 VAL n 1 138 LEU n 1 139 THR n 1 140 ASN n 1 141 HIS n 1 142 ILE n 1 143 HIS n 1 144 THR n 1 145 GLY n 1 146 HIS n 1 147 HIS n 1 148 SER n 1 149 SER n 1 150 MET n 1 151 PHE n 1 152 TRP n 1 153 MET n 1 154 ARG n 1 155 VAL n 1 156 PRO n 1 157 LEU n 1 158 VAL n 1 159 ALA n 1 160 PRO n 1 161 GLU n 1 162 ASP n 1 163 LEU n 1 164 ARG n 1 165 ASP n 1 166 ASP n 1 167 ILE n 1 168 ILE n 1 169 GLU n 1 170 ASN n 1 171 ALA n 1 172 PRO n 1 173 THR n 1 174 THR n 1 175 HIS n 1 176 THR n 1 177 GLU n 1 178 GLU n 1 179 TYR n 1 180 SER n 1 181 GLY n 1 182 GLU n 1 183 GLU n 1 184 LYS n 1 185 THR n 1 186 TRP n 1 187 MET n 1 188 TRP n 1 189 TRP n 1 190 HIS n 1 191 ASN n 1 192 PHE n 1 193 ARG n 1 194 THR n 1 195 LEU n 1 196 CYS n 1 197 ASP n 1 198 TYR n 1 199 SER n 1 200 LYS n 1 201 ARG n 1 202 ILE n 1 203 ALA n 1 204 VAL n 1 205 ALA n 1 206 LEU n 1 207 GLU n 1 208 ILE n 1 209 GLY n 1 210 ALA n 1 211 ASP n 1 212 LEU n 1 213 PRO n 1 214 SER n 1 215 ASN n 1 216 HIS n 1 217 VAL n 1 218 ILE n 1 219 ASP n 1 220 ARG n 1 221 TRP n 1 222 LEU n 1 223 GLY n 1 224 GLU n 1 225 PRO n 1 226 ILE n 1 227 LYS n 1 228 ALA n 1 229 ALA n 1 230 ILE n 1 231 LEU n 1 232 PRO n 1 233 THR n 1 234 SER n 1 235 ILE n 1 236 PHE n 1 237 LEU n 1 238 THR n 1 239 ASN n 1 240 LYS n 1 241 LYS n 1 242 GLY n 1 243 PHE n 1 244 PRO n 1 245 VAL n 1 246 LEU n 1 247 SER n 1 248 LYS n 1 249 MET n 1 250 HIS n 1 251 GLN n 1 252 ARG n 1 253 LEU n 1 254 ILE n 1 255 PHE n 1 256 ARG n 1 257 LEU n 1 258 LEU n 1 259 LYS n 1 260 LEU n 1 261 GLU n 1 262 VAL n 1 263 GLN n 1 264 PHE n 1 265 ILE n 1 266 ILE n 1 267 THR n 1 268 GLY n 1 269 THR n 1 270 ASN n 1 271 HIS n 1 272 HIS n 1 273 SER n 1 274 GLU n 1 275 LYS n 1 276 GLU n 1 277 PHE n 1 278 CYS n 1 279 SER n 1 280 TYR n 1 281 LEU n 1 282 GLN n 1 283 TYR n 1 284 LEU n 1 285 GLU n 1 286 TYR n 1 287 LEU n 1 288 SER n 1 289 GLN n 1 290 ASN n 1 291 ARG n 1 292 PRO n 2 1 SER n 2 2 ARG n 2 3 VAL n 2 4 VAL n 2 5 PRO n 2 6 GLY n 2 7 GLN n 2 8 PHE n 2 9 ASP n 2 10 ASP n 2 11 ALA n 2 12 ASP n 2 13 SER n 2 14 SER n 2 15 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 292 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PRMT5, HRMT1L5, IBP72, JBP1, SKB1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant Codon+RIPL _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pOPIN _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 15 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 MET 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 VAL 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 GLY 8 8 ? ? ? A . n A 1 9 ALA 9 9 ? ? ? A . n A 1 10 GLY 10 10 ? ? ? A . n A 1 11 GLY 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 ARG 13 13 ? ? ? A . n A 1 14 VAL 14 14 ? ? ? A . n A 1 15 SER 15 15 ? ? ? A . n A 1 16 SER 16 16 ? ? ? A . n A 1 17 GLY 17 17 ? ? ? A . n A 1 18 ARG 18 18 ? ? ? A . n A 1 19 ASP 19 19 ? ? ? A . n A 1 20 LEU 20 20 ? ? ? A . n A 1 21 ASN 21 21 ? ? ? A . n A 1 22 CYS 22 22 ? ? ? A . n A 1 23 VAL 23 23 ? ? ? A . n A 1 24 PRO 24 24 ? ? ? A . n A 1 25 GLU 25 25 ? ? ? A . n A 1 26 ILE 26 26 ? ? ? A . n A 1 27 ALA 27 27 ? ? ? A . n A 1 28 ASP 28 28 ? ? ? A . n A 1 29 THR 29 29 ? ? ? A . n A 1 30 LEU 30 30 ? ? ? A . n A 1 31 GLY 31 31 ? ? ? A . n A 1 32 ALA 32 32 ? ? ? A . n A 1 33 VAL 33 33 ? ? ? A . n A 1 34 ALA 34 34 ? ? ? A . n A 1 35 LYS 35 35 ? ? ? A . n A 1 36 GLN 36 36 ? ? ? A . n A 1 37 GLY 37 37 ? ? ? A . n A 1 38 PHE 38 38 ? ? ? A . n A 1 39 ASP 39 39 ? ? ? A . n A 1 40 PHE 40 40 ? ? ? A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ARG 52 52 ? ? ? A . n A 1 53 GLU 53 53 ? ? ? A . n A 1 54 PHE 54 54 ? ? ? A . n A 1 55 ILE 55 55 ? ? ? A . n A 1 56 GLN 56 56 ? ? ? A . n A 1 57 GLU 57 57 ? ? ? A . n A 1 58 PRO 58 58 ? ? ? A . n A 1 59 ALA 59 59 ? ? ? A . n A 1 60 LYS 60 60 ? ? ? A . n A 1 61 ASN 61 61 ? ? ? A . n A 1 62 ARG 62 62 ? ? ? A . n A 1 63 PRO 63 63 ? ? ? A . n A 1 64 GLY 64 64 ? ? ? A . n A 1 65 PRO 65 65 ? ? ? A . n A 1 66 GLN 66 66 ? ? ? A . n A 1 67 THR 67 67 ? ? ? A . n A 1 68 ARG 68 68 ? ? ? A . n A 1 69 SER 69 69 ? ? ? A . n A 1 70 ASP 70 70 ? ? ? A . n A 1 71 LEU 71 71 ? ? ? A . n A 1 72 LEU 72 72 ? ? ? A . n A 1 73 LEU 73 73 ? ? ? A . n A 1 74 SER 74 74 ? ? ? A . n A 1 75 GLY 75 75 ? ? ? A . n A 1 76 ARG 76 76 ? ? ? A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 TRP 78 78 78 TRP TRP A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 TRP 89 89 89 TRP TRP A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 MET 107 107 107 MET MET A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 PHE 122 122 122 PHE PHE A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 ASN 131 131 131 ASN ASN A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 THR 139 139 139 THR THR A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 HIS 143 143 143 HIS HIS A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 HIS 146 146 146 HIS HIS A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 MET 150 150 150 MET MET A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 TRP 152 152 152 TRP TRP A . n A 1 153 MET 153 153 153 MET MET A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 PRO 156 156 156 PRO PRO A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 ASP 165 165 ? ? ? A . n A 1 166 ASP 166 166 ? ? ? A . n A 1 167 ILE 167 167 ? ? ? A . n A 1 168 ILE 168 168 ? ? ? A . n A 1 169 GLU 169 169 ? ? ? A . n A 1 170 ASN 170 170 ? ? ? A . n A 1 171 ALA 171 171 ? ? ? A . n A 1 172 PRO 172 172 ? ? ? A . n A 1 173 THR 173 173 ? ? ? A . n A 1 174 THR 174 174 ? ? ? A . n A 1 175 HIS 175 175 ? ? ? A . n A 1 176 THR 176 176 ? ? ? A . n A 1 177 GLU 177 177 ? ? ? A . n A 1 178 GLU 178 178 ? ? ? A . n A 1 179 TYR 179 179 179 TYR TYR A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 THR 185 185 185 THR THR A . n A 1 186 TRP 186 186 186 TRP TRP A . n A 1 187 MET 187 187 187 MET MET A . n A 1 188 TRP 188 188 188 TRP TRP A . n A 1 189 TRP 189 189 189 TRP TRP A . n A 1 190 HIS 190 190 190 HIS HIS A . n A 1 191 ASN 191 191 191 ASN ASN A . n A 1 192 PHE 192 192 192 PHE PHE A . n A 1 193 ARG 193 193 193 ARG ARG A . n A 1 194 THR 194 194 194 THR THR A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 CYS 196 196 196 CYS CYS A . n A 1 197 ASP 197 197 197 ASP ASP A . n A 1 198 TYR 198 198 198 TYR TYR A . n A 1 199 SER 199 199 199 SER SER A . n A 1 200 LYS 200 200 200 LYS LYS A . n A 1 201 ARG 201 201 201 ARG ARG A . n A 1 202 ILE 202 202 202 ILE ILE A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 VAL 204 204 204 VAL VAL A . n A 1 205 ALA 205 205 205 ALA ALA A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 ILE 208 208 208 ILE ILE A . n A 1 209 GLY 209 209 209 GLY GLY A . n A 1 210 ALA 210 210 210 ALA ALA A . n A 1 211 ASP 211 211 211 ASP ASP A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 PRO 213 213 213 PRO PRO A . n A 1 214 SER 214 214 214 SER SER A . n A 1 215 ASN 215 215 215 ASN ASN A . n A 1 216 HIS 216 216 216 HIS HIS A . n A 1 217 VAL 217 217 217 VAL VAL A . n A 1 218 ILE 218 218 218 ILE ILE A . n A 1 219 ASP 219 219 219 ASP ASP A . n A 1 220 ARG 220 220 220 ARG ARG A . n A 1 221 TRP 221 221 221 TRP TRP A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 GLY 223 223 223 GLY GLY A . n A 1 224 GLU 224 224 224 GLU GLU A . n A 1 225 PRO 225 225 225 PRO PRO A . n A 1 226 ILE 226 226 226 ILE ILE A . n A 1 227 LYS 227 227 227 LYS LYS A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 ALA 229 229 229 ALA ALA A . n A 1 230 ILE 230 230 230 ILE ILE A . n A 1 231 LEU 231 231 231 LEU LEU A . n A 1 232 PRO 232 232 232 PRO PRO A . n A 1 233 THR 233 233 233 THR THR A . n A 1 234 SER 234 234 234 SER SER A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 PHE 236 236 236 PHE PHE A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 THR 238 238 238 THR THR A . n A 1 239 ASN 239 239 239 ASN ASN A . n A 1 240 LYS 240 240 240 LYS LYS A . n A 1 241 LYS 241 241 241 LYS LYS A . n A 1 242 GLY 242 242 242 GLY GLY A . n A 1 243 PHE 243 243 243 PHE PHE A . n A 1 244 PRO 244 244 244 PRO PRO A . n A 1 245 VAL 245 245 245 VAL VAL A . n A 1 246 LEU 246 246 246 LEU LEU A . n A 1 247 SER 247 247 247 SER SER A . n A 1 248 LYS 248 248 248 LYS LYS A . n A 1 249 MET 249 249 249 MET MET A . n A 1 250 HIS 250 250 250 HIS HIS A . n A 1 251 GLN 251 251 251 GLN GLN A . n A 1 252 ARG 252 252 252 ARG ARG A . n A 1 253 LEU 253 253 253 LEU LEU A . n A 1 254 ILE 254 254 254 ILE ILE A . n A 1 255 PHE 255 255 255 PHE PHE A . n A 1 256 ARG 256 256 256 ARG ARG A . n A 1 257 LEU 257 257 257 LEU LEU A . n A 1 258 LEU 258 258 258 LEU LEU A . n A 1 259 LYS 259 259 259 LYS LYS A . n A 1 260 LEU 260 260 260 LEU LEU A . n A 1 261 GLU 261 261 261 GLU GLU A . n A 1 262 VAL 262 262 262 VAL VAL A . n A 1 263 GLN 263 263 263 GLN GLN A . n A 1 264 PHE 264 264 264 PHE PHE A . n A 1 265 ILE 265 265 265 ILE ILE A . n A 1 266 ILE 266 266 266 ILE ILE A . n A 1 267 THR 267 267 267 THR THR A . n A 1 268 GLY 268 268 268 GLY GLY A . n A 1 269 THR 269 269 269 THR THR A . n A 1 270 ASN 270 270 270 ASN ASN A . n A 1 271 HIS 271 271 271 HIS HIS A . n A 1 272 HIS 272 272 272 HIS HIS A . n A 1 273 SER 273 273 273 SER SER A . n A 1 274 GLU 274 274 274 GLU GLU A . n A 1 275 LYS 275 275 275 LYS LYS A . n A 1 276 GLU 276 276 276 GLU GLU A . n A 1 277 PHE 277 277 277 PHE PHE A . n A 1 278 CYS 278 278 278 CYS CYS A . n A 1 279 SER 279 279 279 SER SER A . n A 1 280 TYR 280 280 280 TYR TYR A . n A 1 281 LEU 281 281 281 LEU LEU A . n A 1 282 GLN 282 282 282 GLN GLN A . n A 1 283 TYR 283 283 283 TYR TYR A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 GLU 285 285 285 GLU GLU A . n A 1 286 TYR 286 286 286 TYR TYR A . n A 1 287 LEU 287 287 287 LEU LEU A . n A 1 288 SER 288 288 288 SER SER A . n A 1 289 GLN 289 289 289 GLN GLN A . n A 1 290 ASN 290 290 290 ASN ASN A . n A 1 291 ARG 291 291 ? ? ? A . n A 1 292 PRO 292 292 ? ? ? A . n B 2 1 SER 1 1 1 SER SER B . n B 2 2 ARG 2 2 2 ARG ARG B . n B 2 3 VAL 3 3 3 VAL VAL B . n B 2 4 VAL 4 4 4 VAL VAL B . n B 2 5 PRO 5 5 5 PRO PRO B . n B 2 6 GLY 6 6 6 GLY GLY B . n B 2 7 GLN 7 7 7 GLN GLN B . n B 2 8 PHE 8 8 8 PHE PHE B . n B 2 9 ASP 9 9 9 ASP ASP B . n B 2 10 ASP 10 10 10 ASP ASP B . n B 2 11 ALA 11 11 11 ALA ALA B . n B 2 12 ASP 12 12 12 ASP ASP B . n B 2 13 SER 13 13 13 SER SER B . n B 2 14 SER 14 14 14 SER SER B . n B 2 15 ASP 15 15 ? ? ? B . n # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'VERSION Jan 31, 2020 BUILT=20200417' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? 'VERSION Jan 31, 2020 BUILT=20200417' 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18-3855 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7BOC _cell.details ? _cell.formula_units_Z ? _cell.length_a 96.630 _cell.length_a_esd ? _cell.length_b 96.630 _cell.length_b_esd ? _cell.length_c 112.680 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7BOC _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7BOC _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.35 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 71.75 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M NaAcetate, 30% w/v PEG400, 0.2M CaAcetate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-12-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.999859 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.999859 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate 83.077 _reflns.entry_id 7BOC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.550 _reflns.d_resolution_low 48.310 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20297 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20.164 _reflns.pdbx_Rmerge_I_obs 0.191 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.050 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.766 _reflns.pdbx_scaling_rejects 34 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.196 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 409271 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 2.550 2.620 ? 1.270 ? 31631 1498 ? 1496 99.900 ? ? ? ? 4.289 ? ? ? ? ? ? ? ? 21.144 ? ? ? ? 4.395 ? ? 1 1 0.787 ? ? 2.620 2.690 ? 1.550 ? 30066 1434 ? 1433 99.900 ? ? ? ? 3.748 ? ? ? ? ? ? ? ? 20.981 ? ? ? ? 3.842 ? ? 2 1 0.929 ? ? 2.690 2.770 ? 1.820 ? 29326 1409 ? 1408 99.900 ? ? ? ? 3.220 ? ? ? ? ? ? ? ? 20.828 ? ? ? ? 3.300 ? ? 3 1 0.849 ? ? 2.770 2.850 ? 2.350 ? 27972 1354 ? 1351 99.800 ? ? ? ? 2.521 ? ? ? ? ? ? ? ? 20.705 ? ? ? ? 2.584 ? ? 4 1 0.917 ? ? 2.850 2.940 ? 3.320 ? 26903 1320 ? 1320 100.000 ? ? ? ? 1.878 ? ? ? ? ? ? ? ? 20.381 ? ? ? ? 1.926 ? ? 5 1 0.941 ? ? 2.940 3.050 ? 4.380 ? 25690 1285 ? 1281 99.700 ? ? ? ? 1.430 ? ? ? ? ? ? ? ? 20.055 ? ? ? ? 1.467 ? ? 6 1 0.949 ? ? 3.050 3.160 ? 5.650 ? 23971 1239 ? 1237 99.800 ? ? ? ? 1.052 ? ? ? ? ? ? ? ? 19.378 ? ? ? ? 1.081 ? ? 7 1 0.976 ? ? 3.160 3.290 ? 7.180 ? 20477 1183 ? 1180 99.700 ? ? ? ? 0.728 ? ? ? ? ? ? ? ? 17.353 ? ? ? ? 0.750 ? ? 8 1 0.983 ? ? 3.290 3.440 ? 9.360 ? 23633 1151 ? 1150 99.900 ? ? ? ? 0.600 ? ? ? ? ? ? ? ? 20.550 ? ? ? ? 0.616 ? ? 9 1 0.997 ? ? 3.440 3.610 ? 12.930 ? 23633 1100 ? 1100 100.000 ? ? ? ? 0.396 ? ? ? ? ? ? ? ? 21.485 ? ? ? ? 0.406 ? ? 10 1 0.997 ? ? 3.610 3.800 ? 15.750 ? 22300 1042 ? 1042 100.000 ? ? ? ? 0.292 ? ? ? ? ? ? ? ? 21.401 ? ? ? ? 0.299 ? ? 11 1 0.998 ? ? 3.800 4.030 ? 19.590 ? 21195 1000 ? 1000 100.000 ? ? ? ? 0.202 ? ? ? ? ? ? ? ? 21.195 ? ? ? ? 0.206 ? ? 12 1 0.998 ? ? 4.030 4.310 ? 23.320 ? 19509 931 ? 931 100.000 ? ? ? ? 0.146 ? ? ? ? ? ? ? ? 20.955 ? ? ? ? 0.149 ? ? 13 1 0.998 ? ? 4.310 4.660 ? 26.030 ? 18005 887 ? 887 100.000 ? ? ? ? 0.124 ? ? ? ? ? ? ? ? 20.299 ? ? ? ? 0.127 ? ? 14 1 0.997 ? ? 4.660 5.100 ? 26.970 ? 16083 814 ? 814 100.000 ? ? ? ? 0.116 ? ? ? ? ? ? ? ? 19.758 ? ? ? ? 0.119 ? ? 15 1 0.996 ? ? 5.100 5.700 ? 27.380 ? 13928 737 ? 737 100.000 ? ? ? ? 0.113 ? ? ? ? ? ? ? ? 18.898 ? ? ? ? 0.116 ? ? 16 1 0.997 ? ? 5.700 6.580 ? 26.600 ? 10481 647 ? 647 100.000 ? ? ? ? 0.108 ? ? ? ? ? ? ? ? 16.199 ? ? ? ? 0.112 ? ? 17 1 0.997 ? ? 6.580 8.060 ? 32.480 ? 11401 570 ? 570 100.000 ? ? ? ? 0.094 ? ? ? ? ? ? ? ? 20.002 ? ? ? ? 0.096 ? ? 18 1 0.998 ? ? 8.060 11.400 ? 36.720 ? 8698 447 ? 447 100.000 ? ? ? ? 0.075 ? ? ? ? ? ? ? ? 19.459 ? ? ? ? 0.077 ? ? 19 1 0.999 ? ? 11.400 48.310 ? 34.480 ? 4369 269 ? 266 98.900 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 16.425 ? ? ? ? 0.068 ? ? 20 1 0.998 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 190.730 _refine.B_iso_mean 92.7794 _refine.B_iso_min 49.790 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7BOC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5500 _refine.ls_d_res_low 48.3100 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20221 _refine.ls_number_reflns_R_free 1011 _refine.ls_number_reflns_R_work 19210 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.5400 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2266 _refine.ls_R_factor_R_free 0.2512 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2253 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'pdbid 4x60' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.5400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5500 _refine_hist.d_res_low 48.3100 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1844 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 225 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1844 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5500 2.6800 2831 . 142 2689 99.0000 . . . 0.3438 0.0000 0.3425 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.6800 2.8500 2829 . 140 2689 99.0000 . . . 0.3788 0.0000 0.3246 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.8500 3.0700 2844 . 143 2701 99.0000 . . . 0.3664 0.0000 0.2979 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.0700 3.3800 2863 . 143 2720 100.0000 . . . 0.3136 0.0000 0.2793 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.3800 3.8700 2898 . 145 2753 100.0000 . . . 0.2673 0.0000 0.2382 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.8700 4.8700 2908 . 146 2762 100.0000 . . . 0.2134 0.0000 0.1957 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 4.8800 48.3100 3048 . 152 2896 100.0000 . . . 0.2155 0.0000 0.1948 . . . . . . . 7 . . . # _struct.entry_id 7BOC _struct.title 'Crystal structure of the PRMT5 TIM barrel domain in complex with RioK1 peptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7BOC _struct_keywords.text 'TIM barrel, Methyltransferase, Histones, Chromatin-regulator, protein-peptide interaction, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP ANM5_HUMAN O14744 ? 1 ;MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNT LIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAP EDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNK KGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRP ; 1 2 PDB 7BOC 7BOC ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7BOC A 1 ? 292 ? O14744 1 ? 292 ? 1 292 2 2 7BOC B 1 ? 15 ? 7BOC 1 ? 15 ? 1 15 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4200 ? 1 MORE -28 ? 1 'SSA (A^2)' 22710 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'assay for oligomerization' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 -x,-x+y,-z+1/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 37.5600000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 96 ? LEU A 117 ? VAL A 96 LEU A 117 1 ? 22 HELX_P HELX_P2 AA2 ASN A 131 ? GLY A 145 ? ASN A 131 GLY A 145 1 ? 15 HELX_P HELX_P3 AA3 GLU A 183 ? CYS A 196 ? GLU A 183 CYS A 196 1 ? 14 HELX_P HELX_P4 AA4 SER A 214 ? GLU A 224 ? SER A 214 GLU A 224 1 ? 11 HELX_P HELX_P5 AA5 SER A 247 ? LYS A 259 ? SER A 247 LYS A 259 1 ? 13 HELX_P HELX_P6 AA6 SER A 273 ? LEU A 287 ? SER A 273 LEU A 287 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 42 ? PRO A 48 ? CYS A 42 PRO A 48 AA1 2 TRP A 78 ? LYS A 85 ? TRP A 78 LYS A 85 AA1 3 ALA A 121 ? PRO A 125 ? ALA A 121 PRO A 125 AA1 4 PHE A 151 ? PRO A 156 ? PHE A 151 PRO A 156 AA1 5 ILE A 202 ? GLU A 207 ? ILE A 202 GLU A 207 AA1 6 ILE A 226 ? PRO A 232 ? ILE A 226 PRO A 232 AA1 7 GLN A 263 ? THR A 267 ? GLN A 263 THR A 267 AA1 8 CYS A 42 ? PRO A 48 ? CYS A 42 PRO A 48 AA2 1 PHE A 236 ? THR A 238 ? PHE A 236 THR A 238 AA2 2 PRO A 244 ? LEU A 246 ? PRO A 244 LEU A 246 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 45 ? N VAL A 45 O LEU A 81 ? O LEU A 81 AA1 2 3 N GLY A 84 ? N GLY A 84 O LEU A 123 ? O LEU A 123 AA1 3 4 N PHE A 122 ? N PHE A 122 O TRP A 152 ? O TRP A 152 AA1 4 5 N VAL A 155 ? N VAL A 155 O GLU A 207 ? O GLU A 207 AA1 5 6 N LEU A 206 ? N LEU A 206 O ILE A 230 ? O ILE A 230 AA1 6 7 N LEU A 231 ? N LEU A 231 O ILE A 265 ? O ILE A 265 AA1 7 8 O PHE A 264 ? O PHE A 264 N PHE A 46 ? N PHE A 46 AA2 1 2 N LEU A 237 ? N LEU A 237 O VAL A 245 ? O VAL A 245 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ1 A LYS 248 ? ? OD1 B ASP 10 ? ? 1.55 2 1 HE1 A TRP 189 ? ? OE1 A GLU 224 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 149 ? ? 80.50 -4.49 2 1 SER A 214 ? ? -59.78 -176.49 3 1 SER A 247 ? ? -45.57 152.03 4 1 ASP B 12 ? ? -79.96 39.96 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -32.8178 37.0153 17.6137 0.5694 ? 0.0474 ? -0.0360 ? 0.6964 ? -0.0847 ? 0.5419 ? 2.2723 ? -0.2690 ? -0.6782 ? -0.0068 ? -0.1503 ? 4.5361 ? -0.1480 ? -0.2117 ? -0.1956 ? 0.0551 ? 0.0474 ? 0.3828 ? 0.2523 ? 0.1649 ? 0.3595 ? 2 'X-RAY DIFFRACTION' ? refined -37.4828 31.1327 28.9550 0.5859 ? -0.0422 ? 0.0845 ? 0.7333 ? 0.0683 ? 0.4527 ? 4.4384 ? 1.6530 ? 0.2532 ? 7.8739 ? 0.6159 ? 4.3329 ? 0.0731 ? -0.5704 ? -0.4445 ? 0.6198 ? 0.0890 ? -0.2232 ? 0.3550 ? 0.5699 ? -0.0720 ? 3 'X-RAY DIFFRACTION' ? refined -42.6929 36.8197 27.4767 0.4724 ? 0.0807 ? 0.0078 ? 0.7118 ? -0.0311 ? 0.4644 ? 9.5209 ? 1.3929 ? -0.6898 ? 6.0500 ? -1.8354 ? 5.9257 ? -0.7858 ? -0.6078 ? 0.6358 ? 0.5625 ? 0.6768 ? 0.0633 ? 0.0165 ? 0.6012 ? 0.1755 ? 4 'X-RAY DIFFRACTION' ? refined -47.1343 21.7028 8.1471 1.0965 ? -0.2109 ? -0.0449 ? 0.9050 ? -0.0728 ? 0.5562 ? 2.6132 ? -1.3130 ? -2.6283 ? 1.0311 ? 1.3844 ? 2.9915 ? -0.4332 ? 0.6697 ? -0.9350 ? -0.7252 ? -0.0806 ? 0.0089 ? 0.9571 ? 0.0555 ? 0.3614 ? 5 'X-RAY DIFFRACTION' ? refined -51.4019 30.5145 17.6560 0.4524 ? -0.0795 ? 0.0836 ? 0.6414 ? -0.0390 ? 0.6590 ? 7.5835 ? -0.7477 ? -3.3222 ? 3.7926 ? -1.6083 ? 9.3836 ? -0.1295 ? 0.3338 ? -0.0487 ? 0.6194 ? -0.6333 ? 0.7290 ? 0.6757 ? -1.6582 ? 0.4464 ? 6 'X-RAY DIFFRACTION' ? refined -36.9266 36.3329 4.0966 0.6181 ? -0.0467 ? -0.0732 ? 0.5099 ? 0.0236 ? 0.4031 ? 5.9102 ? 0.6122 ? -3.1286 ? 3.8919 ? 0.1174 ? 5.8768 ? -0.0271 ? 0.2229 ? 0.0007 ? -0.3533 ? 0.0897 ? -0.1039 ? -0.4450 ? 0.0161 ? 0.1090 ? 7 'X-RAY DIFFRACTION' ? refined -25.8796 38.1626 -9.5446 1.1178 ? -0.2294 ? 0.1307 ? 1.0664 ? -0.1597 ? 0.6412 ? 1.5491 ? -0.7406 ? -0.2961 ? 1.4304 ? -1.3906 ? 2.6230 ? -0.1351 ? 1.2923 ? 0.0528 ? -0.6755 ? 0.3497 ? -0.1815 ? -0.3895 ? 0.9526 ? -0.3991 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 41 ? ? ? A 96 ? ? ;chain 'A' and (resid 41 through 96 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 97 ? ? ? A 131 ? ? ;chain 'A' and (resid 97 through 131 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 132 ? ? ? A 156 ? ? ;chain 'A' and (resid 132 through 156 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 157 ? ? ? A 183 ? ? ;chain 'A' and (resid 157 through 183 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 184 ? ? ? A 195 ? ? ;chain 'A' and (resid 184 through 195 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? A 196 ? ? ? A 290 ? ? ;chain 'A' and (resid 196 through 290 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? B 1 ? ? ? B 14 ? ? ;chain 'B' and (resid 1 through 14 ) ; # _pdbx_phasing_MR.entry_id 7BOC _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 4.050 _pdbx_phasing_MR.d_res_low_rotation 83.640 _pdbx_phasing_MR.d_res_high_translation 4.050 _pdbx_phasing_MR.d_res_low_translation 83.640 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A MET 4 ? A MET 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A VAL 6 ? A VAL 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 1 Y 1 A GLY 8 ? A GLY 8 9 1 Y 1 A ALA 9 ? A ALA 9 10 1 Y 1 A GLY 10 ? A GLY 10 11 1 Y 1 A GLY 11 ? A GLY 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A ARG 13 ? A ARG 13 14 1 Y 1 A VAL 14 ? A VAL 14 15 1 Y 1 A SER 15 ? A SER 15 16 1 Y 1 A SER 16 ? A SER 16 17 1 Y 1 A GLY 17 ? A GLY 17 18 1 Y 1 A ARG 18 ? A ARG 18 19 1 Y 1 A ASP 19 ? A ASP 19 20 1 Y 1 A LEU 20 ? A LEU 20 21 1 Y 1 A ASN 21 ? A ASN 21 22 1 Y 1 A CYS 22 ? A CYS 22 23 1 Y 1 A VAL 23 ? A VAL 23 24 1 Y 1 A PRO 24 ? A PRO 24 25 1 Y 1 A GLU 25 ? A GLU 25 26 1 Y 1 A ILE 26 ? A ILE 26 27 1 Y 1 A ALA 27 ? A ALA 27 28 1 Y 1 A ASP 28 ? A ASP 28 29 1 Y 1 A THR 29 ? A THR 29 30 1 Y 1 A LEU 30 ? A LEU 30 31 1 Y 1 A GLY 31 ? A GLY 31 32 1 Y 1 A ALA 32 ? A ALA 32 33 1 Y 1 A VAL 33 ? A VAL 33 34 1 Y 1 A ALA 34 ? A ALA 34 35 1 Y 1 A LYS 35 ? A LYS 35 36 1 Y 1 A GLN 36 ? A GLN 36 37 1 Y 1 A GLY 37 ? A GLY 37 38 1 Y 1 A PHE 38 ? A PHE 38 39 1 Y 1 A ASP 39 ? A ASP 39 40 1 Y 1 A PHE 40 ? A PHE 40 41 1 Y 1 A ARG 52 ? A ARG 52 42 1 Y 1 A GLU 53 ? A GLU 53 43 1 Y 1 A PHE 54 ? A PHE 54 44 1 Y 1 A ILE 55 ? A ILE 55 45 1 Y 1 A GLN 56 ? A GLN 56 46 1 Y 1 A GLU 57 ? A GLU 57 47 1 Y 1 A PRO 58 ? A PRO 58 48 1 Y 1 A ALA 59 ? A ALA 59 49 1 Y 1 A LYS 60 ? A LYS 60 50 1 Y 1 A ASN 61 ? A ASN 61 51 1 Y 1 A ARG 62 ? A ARG 62 52 1 Y 1 A PRO 63 ? A PRO 63 53 1 Y 1 A GLY 64 ? A GLY 64 54 1 Y 1 A PRO 65 ? A PRO 65 55 1 Y 1 A GLN 66 ? A GLN 66 56 1 Y 1 A THR 67 ? A THR 67 57 1 Y 1 A ARG 68 ? A ARG 68 58 1 Y 1 A SER 69 ? A SER 69 59 1 Y 1 A ASP 70 ? A ASP 70 60 1 Y 1 A LEU 71 ? A LEU 71 61 1 Y 1 A LEU 72 ? A LEU 72 62 1 Y 1 A LEU 73 ? A LEU 73 63 1 Y 1 A SER 74 ? A SER 74 64 1 Y 1 A GLY 75 ? A GLY 75 65 1 Y 1 A ARG 76 ? A ARG 76 66 1 Y 1 A ASP 165 ? A ASP 165 67 1 Y 1 A ASP 166 ? A ASP 166 68 1 Y 1 A ILE 167 ? A ILE 167 69 1 Y 1 A ILE 168 ? A ILE 168 70 1 Y 1 A GLU 169 ? A GLU 169 71 1 Y 1 A ASN 170 ? A ASN 170 72 1 Y 1 A ALA 171 ? A ALA 171 73 1 Y 1 A PRO 172 ? A PRO 172 74 1 Y 1 A THR 173 ? A THR 173 75 1 Y 1 A THR 174 ? A THR 174 76 1 Y 1 A HIS 175 ? A HIS 175 77 1 Y 1 A THR 176 ? A THR 176 78 1 Y 1 A GLU 177 ? A GLU 177 79 1 Y 1 A GLU 178 ? A GLU 178 80 1 Y 1 A ARG 291 ? A ARG 291 81 1 Y 1 A PRO 292 ? A PRO 292 82 1 Y 1 B ASP 15 ? B ASP 15 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4X60 _pdbx_initial_refinement_model.details 'pdbid 4x60' # _atom_sites.entry_id 7BOC _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010349 _atom_sites.fract_transf_matrix[1][2] 0.005975 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011950 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008875 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_