data_7BWI # _entry.id 7BWI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7BWI pdb_00007bwi 10.2210/pdb7bwi/pdb WWPDB D_1300016548 ? ? BMRB 36345 ? 10.13018/BMR36345 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-12-23 2 'Structure model' 1 1 2021-07-14 3 'Structure model' 1 2 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_entry_details 7 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7BWI _pdbx_database_status.recvd_initial_deposition_date 2020-04-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of recombinant APETx1' _pdbx_database_related.db_id 36345 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Matsumura, K.' 1 0000-0002-6888-408X 'Kobayashi, N.' 2 0000-0001-5136-2077 'Kurita, J.' 3 ? 'Nishimura, Y.' 4 0000-0002-5148-3458 'Yokogawa, M.' 5 ? 'Imai, S.' 6 0000-0001-9346-2359 'Shimada, I.' 7 0000-0001-9864-3407 'Osawa, M.' 8 0000-0002-1285-4316 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Bmc Mol Cell Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2661-8850 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 22 _citation.language ? _citation.page_first 3 _citation.page_last 3 _citation.title 'Mechanism of hERG inhibition by gating-modifier toxin, APETx1, deduced by functional characterization.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1186/s12860-020-00337-3 _citation.pdbx_database_id_PubMed 33413079 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Matsumura, K.' 1 ? primary 'Shimomura, T.' 2 ? primary 'Kubo, Y.' 3 ? primary 'Oka, T.' 4 ? primary 'Kobayashi, N.' 5 ? primary 'Imai, S.' 6 ? primary 'Yanase, N.' 7 ? primary 'Akimoto, M.' 8 ? primary 'Fukuda, M.' 9 ? primary 'Yokogawa, M.' 10 ? primary 'Ikeda, K.' 11 ? primary 'Kurita, J.I.' 12 ? primary 'Nishimura, Y.' 13 ? primary 'Shimada, I.' 14 ? primary 'Osawa, M.' 15 0000-0002-1285-4316 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Kappa-actitoxin-Ael2a _entity.formula_weight 4561.226 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Kappa-AITX-Ael2a,Toxin APETx1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GTTCYCGKTIGIYWFGTKTCPSNRGYTGSCGYFLGICCYPVD _entity_poly.pdbx_seq_one_letter_code_can GTTCYCGKTIGIYWFGTKTCPSNRGYTGSCGYFLGICCYPVD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 THR n 1 3 THR n 1 4 CYS n 1 5 TYR n 1 6 CYS n 1 7 GLY n 1 8 LYS n 1 9 THR n 1 10 ILE n 1 11 GLY n 1 12 ILE n 1 13 TYR n 1 14 TRP n 1 15 PHE n 1 16 GLY n 1 17 THR n 1 18 LYS n 1 19 THR n 1 20 CYS n 1 21 PRO n 1 22 SER n 1 23 ASN n 1 24 ARG n 1 25 GLY n 1 26 TYR n 1 27 THR n 1 28 GLY n 1 29 SER n 1 30 CYS n 1 31 GLY n 1 32 TYR n 1 33 PHE n 1 34 LEU n 1 35 GLY n 1 36 ILE n 1 37 CYS n 1 38 CYS n 1 39 TYR n 1 40 PRO n 1 41 VAL n 1 42 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 42 _entity_src_gen.gene_src_common_name 'Green aggregating anemone' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Anthopleura elegantissima' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6110 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 TRP 14 14 14 TRP TRP A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ASP 42 42 42 ASP ASP A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7BWI _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7BWI _struct.title 'Solution structure of recombinant APETx1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7BWI _struct_keywords.text TOXIN _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BDS1_ANTEL _struct_ref.pdbx_db_accession P61541 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GTTCYCGKTIGIYWFGTKTCPSNRGYTGSCGYFLGICCYPVD _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7BWI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 42 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P61541 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 42 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 42 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 21 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 25 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 21 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 25 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 4 A CYS 37 1_555 ? ? ? ? ? ? ? 2.018 ? ? disulf2 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 6 A CYS 30 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 20 A CYS 38 1_555 ? ? ? ? ? ? ? 2.027 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 4 ? CYS A 37 ? CYS A 4 ? 1_555 CYS A 37 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 6 ? CYS A 30 ? CYS A 6 ? 1_555 CYS A 30 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 20 ? CYS A 38 ? CYS A 20 ? 1_555 CYS A 38 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 39 A . ? TYR 39 A PRO 40 A ? PRO 40 A 1 2.72 2 TYR 39 A . ? TYR 39 A PRO 40 A ? PRO 40 A 2 1.76 3 TYR 39 A . ? TYR 39 A PRO 40 A ? PRO 40 A 3 1.31 4 TYR 39 A . ? TYR 39 A PRO 40 A ? PRO 40 A 4 0.95 5 TYR 39 A . ? TYR 39 A PRO 40 A ? PRO 40 A 5 2.51 6 TYR 39 A . ? TYR 39 A PRO 40 A ? PRO 40 A 6 0.55 7 TYR 39 A . ? TYR 39 A PRO 40 A ? PRO 40 A 7 2.56 8 TYR 39 A . ? TYR 39 A PRO 40 A ? PRO 40 A 8 2.45 9 TYR 39 A . ? TYR 39 A PRO 40 A ? PRO 40 A 9 1.36 10 TYR 39 A . ? TYR 39 A PRO 40 A ? PRO 40 A 10 -0.05 11 TYR 39 A . ? TYR 39 A PRO 40 A ? PRO 40 A 11 1.20 12 TYR 39 A . ? TYR 39 A PRO 40 A ? PRO 40 A 12 3.38 13 TYR 39 A . ? TYR 39 A PRO 40 A ? PRO 40 A 13 2.15 14 TYR 39 A . ? TYR 39 A PRO 40 A ? PRO 40 A 14 0.56 15 TYR 39 A . ? TYR 39 A PRO 40 A ? PRO 40 A 15 1.07 16 TYR 39 A . ? TYR 39 A PRO 40 A ? PRO 40 A 16 1.59 17 TYR 39 A . ? TYR 39 A PRO 40 A ? PRO 40 A 17 0.56 18 TYR 39 A . ? TYR 39 A PRO 40 A ? PRO 40 A 18 2.15 19 TYR 39 A . ? TYR 39 A PRO 40 A ? PRO 40 A 19 0.05 20 TYR 39 A . ? TYR 39 A PRO 40 A ? PRO 40 A 20 -0.16 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 3 ? CYS A 6 ? THR A 3 CYS A 6 AA1 2 THR A 9 ? PHE A 15 ? THR A 9 PHE A 15 AA1 3 GLY A 35 ? TYR A 39 ? GLY A 35 TYR A 39 AA1 4 GLY A 28 ? TYR A 32 ? GLY A 28 TYR A 32 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N CYS A 4 ? N CYS A 4 O GLY A 11 ? O GLY A 11 AA1 2 3 N TRP A 14 ? N TRP A 14 O ILE A 36 ? O ILE A 36 AA1 3 4 O CYS A 37 ? O CYS A 37 N CYS A 30 ? N CYS A 30 # _pdbx_entry_details.entry_id 7BWI _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.85 120.30 3.55 0.50 N 2 2 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.87 120.30 3.57 0.50 N 3 10 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.87 120.30 3.57 0.50 N 4 15 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.31 120.30 3.01 0.50 N 5 17 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.30 120.30 3.00 0.50 N 6 18 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.94 120.30 3.64 0.50 N 7 19 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.75 120.30 3.45 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 8 ? ? 58.46 19.21 2 2 LYS A 18 ? ? 62.19 -20.33 3 2 LEU A 34 ? ? 59.29 2.24 4 3 LEU A 34 ? ? 59.10 0.89 5 4 LEU A 34 ? ? 60.70 -60.54 6 5 LEU A 34 ? ? 58.92 4.77 7 6 LEU A 34 ? ? 59.21 3.66 8 7 LYS A 18 ? ? 61.28 -25.90 9 7 LEU A 34 ? ? 59.46 -0.80 10 8 LYS A 18 ? ? 63.02 -21.62 11 8 LEU A 34 ? ? 56.81 3.41 12 9 TYR A 32 ? ? -124.46 -169.13 13 9 LEU A 34 ? ? 54.22 5.94 14 10 LEU A 34 ? ? 59.39 2.53 15 11 PRO A 21 ? ? -69.61 98.92 16 11 PHE A 33 ? ? 44.95 -96.87 17 12 LYS A 8 ? ? 58.42 18.17 18 12 LEU A 34 ? ? 61.15 -57.58 19 13 LEU A 34 ? ? 60.87 -62.01 20 14 LYS A 18 ? ? 61.80 -22.62 21 14 LEU A 34 ? ? 56.34 4.96 22 15 LYS A 8 ? ? 58.34 18.91 23 15 LYS A 18 ? ? 63.09 -27.25 24 15 LEU A 34 ? ? 56.89 3.93 25 16 LYS A 8 ? ? 57.80 19.02 26 16 LYS A 18 ? ? 61.40 -11.79 27 16 LEU A 34 ? ? 55.37 8.79 28 17 LYS A 18 ? ? 59.15 -15.67 29 17 LEU A 34 ? ? 56.84 2.36 30 18 LEU A 34 ? ? 56.53 4.40 31 19 LYS A 8 ? ? 57.91 19.73 32 19 LYS A 18 ? ? 64.15 -29.08 33 19 LEU A 34 ? ? 56.37 6.24 34 20 LEU A 34 ? ? 61.40 -61.56 # _pdbx_nmr_ensemble.entry_id 7BWI _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7BWI _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.691 mM [U-100% 13C; U-100% 15N] APETx1, 20 mM potassium phosphate, 100 mM sodium chloride, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label APETx1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 APETx1 0.691 ? mM '[U-100% 13C; U-100% 15N]' 1 'potassium phosphate' 20 ? mM 'natural abundance' 1 'sodium chloride' 100 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label APETx1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 3 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 4 1 1 '3D HNCACB' 2 isotropic 5 1 1 '3D CBCA(CO)NH' 2 isotropic 6 1 1 '3D HNCO' 2 isotropic 8 1 1 '3D HCCH-TOCSY' 2 isotropic 7 1 1 '3D HCCH-COSY' 2 isotropic 12 1 1 '3D 1H-15N TOCSY' 2 isotropic 15 1 1 '3D 1H-15N NOESY' 2 isotropic 14 1 1 '3D 1H-13C NOESY aliphatic' 2 isotropic 13 1 1 '3D 1H-13C NOESY aromatic' 2 isotropic 9 1 1 '3D 1H-15N NOESY' 1 isotropic 10 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 11 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic # _pdbx_nmr_refine.entry_id 7BWI _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 7 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin 3.5 'Bruker Biospin' 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'chemical shift assignment' Sparky ? Goddard 4 'peak picking' MAGRO 2.01.28 'Kobayashi, N.' 5 'data analysis' NMRView ? 'Johnson, One Moon Scientific' 6 'structure calculation' CYANA 3.98 'Guntert, Mumenthaler and Wuthrich' 7 refinement Amber 12 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' 8 'data analysis' MAGRO 2.01.28 'Kobayashi, N.' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 CYS N N N N 61 CYS CA C N R 62 CYS C C N N 63 CYS O O N N 64 CYS CB C N N 65 CYS SG S N N 66 CYS OXT O N N 67 CYS H H N N 68 CYS H2 H N N 69 CYS HA H N N 70 CYS HB2 H N N 71 CYS HB3 H N N 72 CYS HG H N N 73 CYS HXT H N N 74 GLY N N N N 75 GLY CA C N N 76 GLY C C N N 77 GLY O O N N 78 GLY OXT O N N 79 GLY H H N N 80 GLY H2 H N N 81 GLY HA2 H N N 82 GLY HA3 H N N 83 GLY HXT H N N 84 ILE N N N N 85 ILE CA C N S 86 ILE C C N N 87 ILE O O N N 88 ILE CB C N S 89 ILE CG1 C N N 90 ILE CG2 C N N 91 ILE CD1 C N N 92 ILE OXT O N N 93 ILE H H N N 94 ILE H2 H N N 95 ILE HA H N N 96 ILE HB H N N 97 ILE HG12 H N N 98 ILE HG13 H N N 99 ILE HG21 H N N 100 ILE HG22 H N N 101 ILE HG23 H N N 102 ILE HD11 H N N 103 ILE HD12 H N N 104 ILE HD13 H N N 105 ILE HXT H N N 106 LEU N N N N 107 LEU CA C N S 108 LEU C C N N 109 LEU O O N N 110 LEU CB C N N 111 LEU CG C N N 112 LEU CD1 C N N 113 LEU CD2 C N N 114 LEU OXT O N N 115 LEU H H N N 116 LEU H2 H N N 117 LEU HA H N N 118 LEU HB2 H N N 119 LEU HB3 H N N 120 LEU HG H N N 121 LEU HD11 H N N 122 LEU HD12 H N N 123 LEU HD13 H N N 124 LEU HD21 H N N 125 LEU HD22 H N N 126 LEU HD23 H N N 127 LEU HXT H N N 128 LYS N N N N 129 LYS CA C N S 130 LYS C C N N 131 LYS O O N N 132 LYS CB C N N 133 LYS CG C N N 134 LYS CD C N N 135 LYS CE C N N 136 LYS NZ N N N 137 LYS OXT O N N 138 LYS H H N N 139 LYS H2 H N N 140 LYS HA H N N 141 LYS HB2 H N N 142 LYS HB3 H N N 143 LYS HG2 H N N 144 LYS HG3 H N N 145 LYS HD2 H N N 146 LYS HD3 H N N 147 LYS HE2 H N N 148 LYS HE3 H N N 149 LYS HZ1 H N N 150 LYS HZ2 H N N 151 LYS HZ3 H N N 152 LYS HXT H N N 153 PHE N N N N 154 PHE CA C N S 155 PHE C C N N 156 PHE O O N N 157 PHE CB C N N 158 PHE CG C Y N 159 PHE CD1 C Y N 160 PHE CD2 C Y N 161 PHE CE1 C Y N 162 PHE CE2 C Y N 163 PHE CZ C Y N 164 PHE OXT O N N 165 PHE H H N N 166 PHE H2 H N N 167 PHE HA H N N 168 PHE HB2 H N N 169 PHE HB3 H N N 170 PHE HD1 H N N 171 PHE HD2 H N N 172 PHE HE1 H N N 173 PHE HE2 H N N 174 PHE HZ H N N 175 PHE HXT H N N 176 PRO N N N N 177 PRO CA C N S 178 PRO C C N N 179 PRO O O N N 180 PRO CB C N N 181 PRO CG C N N 182 PRO CD C N N 183 PRO OXT O N N 184 PRO H H N N 185 PRO HA H N N 186 PRO HB2 H N N 187 PRO HB3 H N N 188 PRO HG2 H N N 189 PRO HG3 H N N 190 PRO HD2 H N N 191 PRO HD3 H N N 192 PRO HXT H N N 193 SER N N N N 194 SER CA C N S 195 SER C C N N 196 SER O O N N 197 SER CB C N N 198 SER OG O N N 199 SER OXT O N N 200 SER H H N N 201 SER H2 H N N 202 SER HA H N N 203 SER HB2 H N N 204 SER HB3 H N N 205 SER HG H N N 206 SER HXT H N N 207 THR N N N N 208 THR CA C N S 209 THR C C N N 210 THR O O N N 211 THR CB C N R 212 THR OG1 O N N 213 THR CG2 C N N 214 THR OXT O N N 215 THR H H N N 216 THR H2 H N N 217 THR HA H N N 218 THR HB H N N 219 THR HG1 H N N 220 THR HG21 H N N 221 THR HG22 H N N 222 THR HG23 H N N 223 THR HXT H N N 224 TRP N N N N 225 TRP CA C N S 226 TRP C C N N 227 TRP O O N N 228 TRP CB C N N 229 TRP CG C Y N 230 TRP CD1 C Y N 231 TRP CD2 C Y N 232 TRP NE1 N Y N 233 TRP CE2 C Y N 234 TRP CE3 C Y N 235 TRP CZ2 C Y N 236 TRP CZ3 C Y N 237 TRP CH2 C Y N 238 TRP OXT O N N 239 TRP H H N N 240 TRP H2 H N N 241 TRP HA H N N 242 TRP HB2 H N N 243 TRP HB3 H N N 244 TRP HD1 H N N 245 TRP HE1 H N N 246 TRP HE3 H N N 247 TRP HZ2 H N N 248 TRP HZ3 H N N 249 TRP HH2 H N N 250 TRP HXT H N N 251 TYR N N N N 252 TYR CA C N S 253 TYR C C N N 254 TYR O O N N 255 TYR CB C N N 256 TYR CG C Y N 257 TYR CD1 C Y N 258 TYR CD2 C Y N 259 TYR CE1 C Y N 260 TYR CE2 C Y N 261 TYR CZ C Y N 262 TYR OH O N N 263 TYR OXT O N N 264 TYR H H N N 265 TYR H2 H N N 266 TYR HA H N N 267 TYR HB2 H N N 268 TYR HB3 H N N 269 TYR HD1 H N N 270 TYR HD2 H N N 271 TYR HE1 H N N 272 TYR HE2 H N N 273 TYR HH H N N 274 TYR HXT H N N 275 VAL N N N N 276 VAL CA C N S 277 VAL C C N N 278 VAL O O N N 279 VAL CB C N N 280 VAL CG1 C N N 281 VAL CG2 C N N 282 VAL OXT O N N 283 VAL H H N N 284 VAL H2 H N N 285 VAL HA H N N 286 VAL HB H N N 287 VAL HG11 H N N 288 VAL HG12 H N N 289 VAL HG13 H N N 290 VAL HG21 H N N 291 VAL HG22 H N N 292 VAL HG23 H N N 293 VAL HXT H N N 294 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 CYS N CA sing N N 58 CYS N H sing N N 59 CYS N H2 sing N N 60 CYS CA C sing N N 61 CYS CA CB sing N N 62 CYS CA HA sing N N 63 CYS C O doub N N 64 CYS C OXT sing N N 65 CYS CB SG sing N N 66 CYS CB HB2 sing N N 67 CYS CB HB3 sing N N 68 CYS SG HG sing N N 69 CYS OXT HXT sing N N 70 GLY N CA sing N N 71 GLY N H sing N N 72 GLY N H2 sing N N 73 GLY CA C sing N N 74 GLY CA HA2 sing N N 75 GLY CA HA3 sing N N 76 GLY C O doub N N 77 GLY C OXT sing N N 78 GLY OXT HXT sing N N 79 ILE N CA sing N N 80 ILE N H sing N N 81 ILE N H2 sing N N 82 ILE CA C sing N N 83 ILE CA CB sing N N 84 ILE CA HA sing N N 85 ILE C O doub N N 86 ILE C OXT sing N N 87 ILE CB CG1 sing N N 88 ILE CB CG2 sing N N 89 ILE CB HB sing N N 90 ILE CG1 CD1 sing N N 91 ILE CG1 HG12 sing N N 92 ILE CG1 HG13 sing N N 93 ILE CG2 HG21 sing N N 94 ILE CG2 HG22 sing N N 95 ILE CG2 HG23 sing N N 96 ILE CD1 HD11 sing N N 97 ILE CD1 HD12 sing N N 98 ILE CD1 HD13 sing N N 99 ILE OXT HXT sing N N 100 LEU N CA sing N N 101 LEU N H sing N N 102 LEU N H2 sing N N 103 LEU CA C sing N N 104 LEU CA CB sing N N 105 LEU CA HA sing N N 106 LEU C O doub N N 107 LEU C OXT sing N N 108 LEU CB CG sing N N 109 LEU CB HB2 sing N N 110 LEU CB HB3 sing N N 111 LEU CG CD1 sing N N 112 LEU CG CD2 sing N N 113 LEU CG HG sing N N 114 LEU CD1 HD11 sing N N 115 LEU CD1 HD12 sing N N 116 LEU CD1 HD13 sing N N 117 LEU CD2 HD21 sing N N 118 LEU CD2 HD22 sing N N 119 LEU CD2 HD23 sing N N 120 LEU OXT HXT sing N N 121 LYS N CA sing N N 122 LYS N H sing N N 123 LYS N H2 sing N N 124 LYS CA C sing N N 125 LYS CA CB sing N N 126 LYS CA HA sing N N 127 LYS C O doub N N 128 LYS C OXT sing N N 129 LYS CB CG sing N N 130 LYS CB HB2 sing N N 131 LYS CB HB3 sing N N 132 LYS CG CD sing N N 133 LYS CG HG2 sing N N 134 LYS CG HG3 sing N N 135 LYS CD CE sing N N 136 LYS CD HD2 sing N N 137 LYS CD HD3 sing N N 138 LYS CE NZ sing N N 139 LYS CE HE2 sing N N 140 LYS CE HE3 sing N N 141 LYS NZ HZ1 sing N N 142 LYS NZ HZ2 sing N N 143 LYS NZ HZ3 sing N N 144 LYS OXT HXT sing N N 145 PHE N CA sing N N 146 PHE N H sing N N 147 PHE N H2 sing N N 148 PHE CA C sing N N 149 PHE CA CB sing N N 150 PHE CA HA sing N N 151 PHE C O doub N N 152 PHE C OXT sing N N 153 PHE CB CG sing N N 154 PHE CB HB2 sing N N 155 PHE CB HB3 sing N N 156 PHE CG CD1 doub Y N 157 PHE CG CD2 sing Y N 158 PHE CD1 CE1 sing Y N 159 PHE CD1 HD1 sing N N 160 PHE CD2 CE2 doub Y N 161 PHE CD2 HD2 sing N N 162 PHE CE1 CZ doub Y N 163 PHE CE1 HE1 sing N N 164 PHE CE2 CZ sing Y N 165 PHE CE2 HE2 sing N N 166 PHE CZ HZ sing N N 167 PHE OXT HXT sing N N 168 PRO N CA sing N N 169 PRO N CD sing N N 170 PRO N H sing N N 171 PRO CA C sing N N 172 PRO CA CB sing N N 173 PRO CA HA sing N N 174 PRO C O doub N N 175 PRO C OXT sing N N 176 PRO CB CG sing N N 177 PRO CB HB2 sing N N 178 PRO CB HB3 sing N N 179 PRO CG CD sing N N 180 PRO CG HG2 sing N N 181 PRO CG HG3 sing N N 182 PRO CD HD2 sing N N 183 PRO CD HD3 sing N N 184 PRO OXT HXT sing N N 185 SER N CA sing N N 186 SER N H sing N N 187 SER N H2 sing N N 188 SER CA C sing N N 189 SER CA CB sing N N 190 SER CA HA sing N N 191 SER C O doub N N 192 SER C OXT sing N N 193 SER CB OG sing N N 194 SER CB HB2 sing N N 195 SER CB HB3 sing N N 196 SER OG HG sing N N 197 SER OXT HXT sing N N 198 THR N CA sing N N 199 THR N H sing N N 200 THR N H2 sing N N 201 THR CA C sing N N 202 THR CA CB sing N N 203 THR CA HA sing N N 204 THR C O doub N N 205 THR C OXT sing N N 206 THR CB OG1 sing N N 207 THR CB CG2 sing N N 208 THR CB HB sing N N 209 THR OG1 HG1 sing N N 210 THR CG2 HG21 sing N N 211 THR CG2 HG22 sing N N 212 THR CG2 HG23 sing N N 213 THR OXT HXT sing N N 214 TRP N CA sing N N 215 TRP N H sing N N 216 TRP N H2 sing N N 217 TRP CA C sing N N 218 TRP CA CB sing N N 219 TRP CA HA sing N N 220 TRP C O doub N N 221 TRP C OXT sing N N 222 TRP CB CG sing N N 223 TRP CB HB2 sing N N 224 TRP CB HB3 sing N N 225 TRP CG CD1 doub Y N 226 TRP CG CD2 sing Y N 227 TRP CD1 NE1 sing Y N 228 TRP CD1 HD1 sing N N 229 TRP CD2 CE2 doub Y N 230 TRP CD2 CE3 sing Y N 231 TRP NE1 CE2 sing Y N 232 TRP NE1 HE1 sing N N 233 TRP CE2 CZ2 sing Y N 234 TRP CE3 CZ3 doub Y N 235 TRP CE3 HE3 sing N N 236 TRP CZ2 CH2 doub Y N 237 TRP CZ2 HZ2 sing N N 238 TRP CZ3 CH2 sing Y N 239 TRP CZ3 HZ3 sing N N 240 TRP CH2 HH2 sing N N 241 TRP OXT HXT sing N N 242 TYR N CA sing N N 243 TYR N H sing N N 244 TYR N H2 sing N N 245 TYR CA C sing N N 246 TYR CA CB sing N N 247 TYR CA HA sing N N 248 TYR C O doub N N 249 TYR C OXT sing N N 250 TYR CB CG sing N N 251 TYR CB HB2 sing N N 252 TYR CB HB3 sing N N 253 TYR CG CD1 doub Y N 254 TYR CG CD2 sing Y N 255 TYR CD1 CE1 sing Y N 256 TYR CD1 HD1 sing N N 257 TYR CD2 CE2 doub Y N 258 TYR CD2 HD2 sing N N 259 TYR CE1 CZ doub Y N 260 TYR CE1 HE1 sing N N 261 TYR CE2 CZ sing Y N 262 TYR CE2 HE2 sing N N 263 TYR CZ OH sing N N 264 TYR OH HH sing N N 265 TYR OXT HXT sing N N 266 VAL N CA sing N N 267 VAL N H sing N N 268 VAL N H2 sing N N 269 VAL CA C sing N N 270 VAL CA CB sing N N 271 VAL CA HA sing N N 272 VAL C O doub N N 273 VAL C OXT sing N N 274 VAL CB CG1 sing N N 275 VAL CB CG2 sing N N 276 VAL CB HB sing N N 277 VAL CG1 HG11 sing N N 278 VAL CG1 HG12 sing N N 279 VAL CG1 HG13 sing N N 280 VAL CG2 HG21 sing N N 281 VAL CG2 HG22 sing N N 282 VAL CG2 HG23 sing N N 283 VAL OXT HXT sing N N 284 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science (JSPS)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number JP17H03978 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III HD' ? Bruker 700 ? 2 'Avance 600' ? Bruker 600 ? # _atom_sites.entry_id 7BWI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #