data_7C8M # _entry.id 7C8M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7C8M pdb_00007c8m 10.2210/pdb7c8m/pdb WWPDB D_1300017188 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7C8M _pdbx_database_status.recvd_initial_deposition_date 2020-06-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kunichika, K.' 1 0000-0002-6593-9778 'Takahashi, Y.' 2 0000-0001-7967-8380 'Fujishiro, T.' 3 0000-0002-0588-6045 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 60 _citation.language ? _citation.page_first 1569 _citation.page_last 1572 _citation.title ;The Structure of the Dimeric State of IscU Harboring Two Adjacent [2Fe-2S] Clusters Provides Mechanistic Insights into Cluster Conversion to [4Fe-4S]. ; _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.1c00112 _citation.pdbx_database_id_PubMed 33938220 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kunichika, K.' 1 ? primary 'Nakamura, R.' 2 ? primary 'Fujishiro, T.' 3 ? primary 'Takahashi, Y.' 4 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 123.610 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7C8M _cell.details ? _cell.formula_units_Z ? _cell.length_a 85.290 _cell.length_a_esd ? _cell.length_b 67.140 _cell.length_b_esd ? _cell.length_c 47.420 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7C8M _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nitrogen-fixing NifU domain protein' 15264.462 2 ? ? ? ? 2 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER' 175.820 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name IscU # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MIQQTGYSKKVMEHFMNPRNVGVIDDPDGYGKVGNPVCGDLMEIFIKVGDEKIEDIKFRTFGCGAAIATSSMITEMARGK SLEEAMRITRNDVADALDGLPPQKMHCSNLAADALHAAINDYLSKKQKHLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MIQQTGYSKKVMEHFMNPRNVGVIDDPDGYGKVGNPVCGDLMEIFIKVGDEKIEDIKFRTFGCGAAIATSSMITEMARGK SLEEAMRITRNDVADALDGLPPQKMHCSNLAADALHAAINDYLSKKQKHLEHHHHHH ; _entity_poly.pdbx_strand_id A,C _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 GLN n 1 4 GLN n 1 5 THR n 1 6 GLY n 1 7 TYR n 1 8 SER n 1 9 LYS n 1 10 LYS n 1 11 VAL n 1 12 MET n 1 13 GLU n 1 14 HIS n 1 15 PHE n 1 16 MET n 1 17 ASN n 1 18 PRO n 1 19 ARG n 1 20 ASN n 1 21 VAL n 1 22 GLY n 1 23 VAL n 1 24 ILE n 1 25 ASP n 1 26 ASP n 1 27 PRO n 1 28 ASP n 1 29 GLY n 1 30 TYR n 1 31 GLY n 1 32 LYS n 1 33 VAL n 1 34 GLY n 1 35 ASN n 1 36 PRO n 1 37 VAL n 1 38 CYS n 1 39 GLY n 1 40 ASP n 1 41 LEU n 1 42 MET n 1 43 GLU n 1 44 ILE n 1 45 PHE n 1 46 ILE n 1 47 LYS n 1 48 VAL n 1 49 GLY n 1 50 ASP n 1 51 GLU n 1 52 LYS n 1 53 ILE n 1 54 GLU n 1 55 ASP n 1 56 ILE n 1 57 LYS n 1 58 PHE n 1 59 ARG n 1 60 THR n 1 61 PHE n 1 62 GLY n 1 63 CYS n 1 64 GLY n 1 65 ALA n 1 66 ALA n 1 67 ILE n 1 68 ALA n 1 69 THR n 1 70 SER n 1 71 SER n 1 72 MET n 1 73 ILE n 1 74 THR n 1 75 GLU n 1 76 MET n 1 77 ALA n 1 78 ARG n 1 79 GLY n 1 80 LYS n 1 81 SER n 1 82 LEU n 1 83 GLU n 1 84 GLU n 1 85 ALA n 1 86 MET n 1 87 ARG n 1 88 ILE n 1 89 THR n 1 90 ARG n 1 91 ASN n 1 92 ASP n 1 93 VAL n 1 94 ALA n 1 95 ASP n 1 96 ALA n 1 97 LEU n 1 98 ASP n 1 99 GLY n 1 100 LEU n 1 101 PRO n 1 102 PRO n 1 103 GLN n 1 104 LYS n 1 105 MET n 1 106 HIS n 1 107 CYS n 1 108 SER n 1 109 ASN n 1 110 LEU n 1 111 ALA n 1 112 ALA n 1 113 ASP n 1 114 ALA n 1 115 LEU n 1 116 HIS n 1 117 ALA n 1 118 ALA n 1 119 ILE n 1 120 ASN n 1 121 ASP n 1 122 TYR n 1 123 LEU n 1 124 SER n 1 125 LYS n 1 126 LYS n 1 127 GLN n 1 128 LYS n 1 129 HIS n 1 130 LEU n 1 131 GLU n 1 132 HIS n 1 133 HIS n 1 134 HIS n 1 135 HIS n 1 136 HIS n 1 137 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 137 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methanothrix thermoacetophila' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2224 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant C41 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0B757_METTP _struct_ref.pdbx_db_accession A0B757 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MIQQTGYSKKVMEHFMNPRNVGVIDDPDGYGKVGNPVCGDLMEIFIKVGDEKIEDIKFRTFGCGAAIATSSMITEMARGK SLEEAMRITRNDVADALDGLPPQKMHCSNLAADALHAAINDYLSKKQKH ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7C8M A 1 ? 129 ? A0B757 1 ? 129 ? 1 129 2 1 7C8M C 1 ? 129 ? A0B757 1 ? 129 ? 1 129 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7C8M LEU A 130 ? UNP A0B757 ? ? 'expression tag' 130 1 1 7C8M GLU A 131 ? UNP A0B757 ? ? 'expression tag' 131 2 1 7C8M HIS A 132 ? UNP A0B757 ? ? 'expression tag' 132 3 1 7C8M HIS A 133 ? UNP A0B757 ? ? 'expression tag' 133 4 1 7C8M HIS A 134 ? UNP A0B757 ? ? 'expression tag' 134 5 1 7C8M HIS A 135 ? UNP A0B757 ? ? 'expression tag' 135 6 1 7C8M HIS A 136 ? UNP A0B757 ? ? 'expression tag' 136 7 1 7C8M HIS A 137 ? UNP A0B757 ? ? 'expression tag' 137 8 2 7C8M LEU C 130 ? UNP A0B757 ? ? 'expression tag' 130 9 2 7C8M GLU C 131 ? UNP A0B757 ? ? 'expression tag' 131 10 2 7C8M HIS C 132 ? UNP A0B757 ? ? 'expression tag' 132 11 2 7C8M HIS C 133 ? UNP A0B757 ? ? 'expression tag' 133 12 2 7C8M HIS C 134 ? UNP A0B757 ? ? 'expression tag' 134 13 2 7C8M HIS C 135 ? UNP A0B757 ? ? 'expression tag' 135 14 2 7C8M HIS C 136 ? UNP A0B757 ? ? 'expression tag' 136 15 2 7C8M HIS C 137 ? UNP A0B757 ? ? 'expression tag' 137 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FES non-polymer . 'FE2/S2 (INORGANIC) CLUSTER' ? 'Fe2 S2' 175.820 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7C8M _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.85 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 33.58 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30 % (w/v) PEG 1500' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-12-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ;Numerical link type Si(111) double crystal monochromator, direct water cooling using micro-channel (1st crystal),indirect water cooling (2nd crystal) ; _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-5A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-5A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate 94.123 _reflns.entry_id 7C8M _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.500 _reflns.d_resolution_low 48.790 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 2867 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.248 _reflns.pdbx_Rmerge_I_obs 0.182 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.350 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.869 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.199 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 17912 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split 3.500 3.600 ? 1.390 ? 1208 260 ? 234 90.000 ? ? ? ? 0.983 ? ? ? ? ? ? ? ? 5.162 ? ? ? ? 1.095 ? ? 1 1 0.666 ? ? 3.600 3.700 ? 1.570 ? 1141 191 ? 189 99.000 ? ? ? ? 1.124 ? ? ? ? ? ? ? ? 6.037 ? ? ? ? 1.231 ? ? 2 1 0.781 ? ? 3.700 3.800 ? 2.690 ? 1288 191 ? 193 100.000 ? ? ? ? 0.680 ? ? ? ? ? ? ? ? 6.674 ? ? ? ? 0.737 ? ? 3 1 0.895 ? ? 3.800 3.900 ? 2.450 ? 1211 191 ? 185 96.900 ? ? ? ? 0.698 ? ? ? ? ? ? ? ? 6.546 ? ? ? ? 0.758 ? ? 4 1 0.944 ? ? 3.900 4.000 ? 3.010 ? 835 126 ? 128 100.000 ? ? ? ? 0.573 ? ? ? ? ? ? ? ? 6.523 ? ? ? ? 0.622 ? ? 5 1 0.950 ? ? 4.000 4.100 ? 2.830 ? 906 139 ? 140 100.000 ? ? ? ? 0.651 ? ? ? ? ? ? ? ? 6.471 ? ? ? ? 0.709 ? ? 6 1 0.798 ? ? 4.100 4.500 ? 4.750 ? 2681 439 ? 433 98.600 ? ? ? ? 0.362 ? ? ? ? ? ? ? ? 6.192 ? ? ? ? 0.396 ? ? 7 1 0.955 ? ? 4.500 4.600 ? 6.170 ? 530 84 ? 79 94.000 ? ? ? ? 0.289 ? ? ? ? ? ? ? ? 6.709 ? ? ? ? 0.313 ? ? 8 1 0.974 ? ? 4.600 4.700 ? 5.820 ? 517 79 ? 79 100.000 ? ? ? ? 0.253 ? ? ? ? ? ? ? ? 6.544 ? ? ? ? 0.275 ? ? 9 1 0.986 ? ? 4.700 4.800 ? 6.760 ? 531 85 ? 85 100.000 ? ? ? ? 0.225 ? ? ? ? ? ? ? ? 6.247 ? ? ? ? 0.246 ? ? 10 1 0.975 ? ? 4.800 4.900 ? 5.870 ? 393 58 ? 60 100.000 ? ? ? ? 0.290 ? ? ? ? ? ? ? ? 6.550 ? ? ? ? 0.315 ? ? 11 1 0.981 ? ? 4.900 5.000 ? 6.720 ? 343 58 ? 54 93.100 ? ? ? ? 0.250 ? ? ? ? ? ? ? ? 6.352 ? ? ? ? 0.273 ? ? 12 1 0.974 ? ? 5.000 6.000 ? 7.850 ? 2670 431 ? 427 99.100 ? ? ? ? 0.192 ? ? ? ? ? ? ? ? 6.253 ? ? ? ? 0.210 ? ? 13 1 0.984 ? ? 6.000 10.000 ? 12.810 ? 2837 452 ? 446 98.700 ? ? ? ? 0.097 ? ? ? ? ? ? ? ? 6.361 ? ? ? ? 0.106 ? ? 14 1 0.994 ? ? 10.000 48.790 ? 18.420 ? 821 140 ? 135 96.400 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 6.081 ? ? ? ? 0.065 ? ? 15 1 0.999 ? ? # _refine.aniso_B[1][1] 0.3000 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.1800 _refine.aniso_B[2][2] -0.1200 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -0.2200 _refine.B_iso_max 297.490 _refine.B_iso_mean 141.5270 _refine.B_iso_min 77.670 _refine.correlation_coeff_Fo_to_Fc 0.9530 _refine.correlation_coeff_Fo_to_Fc_free 0.9580 _refine.details 'U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7C8M _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.5000 _refine.ls_d_res_low 48.7900 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 2723 _refine.ls_number_reflns_R_free 144 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.3100 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2251 _refine.ls_R_factor_R_free 0.2917 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2211 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2Z7E _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.8860 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 65.4060 _refine.overall_SU_ML 0.9220 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 3.5000 _refine_hist.d_res_low 48.7900 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1972 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 256 _refine_hist.pdbx_B_iso_mean_ligand 100.98 _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1964 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.012 2014 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.509 1.635 2690 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 5.419 5.000 254 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.815 23.400 100 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.385 15.000 368 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 21.158 15.000 10 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.125 0.200 260 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 1508 ? r_gen_planes_refined ? ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? 0.080 ? 0.050 1 'interatomic distance' ? A 4126 ? ? 1 'X-RAY DIFFRACTION' 2 ? ? 0.080 ? 0.050 2 'interatomic distance' ? C 4126 ? ? 1 # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.5020 _refine_ls_shell.d_res_low 3.5920 _refine_ls_shell.number_reflns_all 217 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 11 _refine_ls_shell.number_reflns_R_work 206 _refine_ls_shell.percent_reflns_obs 92.3400 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3690 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3330 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 A 1 2 C # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 0 A GLY 6 . A HIS 133 . A GLY 6 A HIS 133 0 ? 1 2 0 B GLY 6 . B HIS 133 . C GLY 6 C HIS 133 0 ? # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7C8M _struct.title 'Crystal structure of IscU wild-type' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7C8M _struct_keywords.text 'Iron-sulfur cluster biogenesis, BIOSYNTHETIC PROTEIN' _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 8 ? ASN A 17 ? SER A 8 ASN A 17 1 ? 10 HELX_P HELX_P2 AA2 CYS A 63 ? ARG A 78 ? CYS A 63 ARG A 78 1 ? 16 HELX_P HELX_P3 AA3 SER A 81 ? ILE A 88 ? SER A 81 ILE A 88 1 ? 8 HELX_P HELX_P4 AA4 THR A 89 ? ASP A 92 ? THR A 89 ASP A 92 5 ? 4 HELX_P HELX_P5 AA5 VAL A 93 ? ASP A 98 ? VAL A 93 ASP A 98 1 ? 6 HELX_P HELX_P6 AA6 GLN A 103 ? HIS A 132 ? GLN A 103 HIS A 132 1 ? 30 HELX_P HELX_P7 AA7 SER B 8 ? ASN B 17 ? SER C 8 ASN C 17 1 ? 10 HELX_P HELX_P8 AA8 CYS B 63 ? ARG B 78 ? CYS C 63 ARG C 78 1 ? 16 HELX_P HELX_P9 AA9 SER B 81 ? ILE B 88 ? SER C 81 ILE C 88 1 ? 8 HELX_P HELX_P10 AB1 THR B 89 ? ASP B 92 ? THR C 89 ASP C 92 5 ? 4 HELX_P HELX_P11 AB2 VAL B 93 ? ASP B 98 ? VAL C 93 ASP C 98 1 ? 6 HELX_P HELX_P12 AB3 GLN B 103 ? LEU B 130 ? GLN C 103 LEU C 130 1 ? 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 38 SG ? ? ? 1_555 C FES . FE2 ? ? A CYS 38 A FES 201 1_555 ? ? ? ? ? ? ? 2.282 ? ? metalc2 metalc ? ? A ASP 40 OD2 ? ? ? 1_555 C FES . FE2 ? ? A ASP 40 A FES 201 1_555 ? ? ? ? ? ? ? 2.017 ? ? metalc3 metalc ? ? A CYS 63 SG ? ? ? 1_555 C FES . FE1 ? ? A CYS 63 A FES 201 1_555 ? ? ? ? ? ? ? 2.293 ? ? metalc4 metalc ? ? A CYS 107 SG ? ? ? 1_555 C FES . FE1 ? ? A CYS 107 A FES 201 1_555 ? ? ? ? ? ? ? 2.293 ? ? metalc5 metalc ? ? B CYS 38 SG ? ? ? 1_555 D FES . FE2 ? ? C CYS 38 C FES 201 1_555 ? ? ? ? ? ? ? 2.319 ? ? metalc6 metalc ? ? B ASP 40 OD2 ? ? ? 1_555 D FES . FE2 ? ? C ASP 40 C FES 201 1_555 ? ? ? ? ? ? ? 2.037 ? ? metalc7 metalc ? ? B CYS 63 SG ? ? ? 1_555 D FES . FE1 ? ? C CYS 63 C FES 201 1_555 ? ? ? ? ? ? ? 2.284 ? ? metalc8 metalc ? ? B CYS 107 SG ? ? ? 1_555 D FES . FE1 ? ? C CYS 107 C FES 201 1_555 ? ? ? ? ? ? ? 2.312 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 29 ? ASN A 35 ? GLY A 29 ASN A 35 AA1 2 ASP A 40 ? GLY A 49 ? ASP A 40 GLY A 49 AA1 3 LYS A 52 ? THR A 60 ? LYS A 52 THR A 60 AA2 1 GLY B 29 ? ASN B 35 ? GLY C 29 ASN C 35 AA2 2 ASP B 40 ? GLY B 49 ? ASP C 40 GLY C 49 AA2 3 LYS B 52 ? THR B 60 ? LYS C 52 THR C 60 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 33 ? N VAL A 33 O MET A 42 ? O MET A 42 AA1 2 3 N PHE A 45 ? N PHE A 45 O LYS A 57 ? O LYS A 57 AA2 1 2 N VAL B 33 ? N VAL C 33 O MET B 42 ? O MET C 42 AA2 2 3 N PHE B 45 ? N PHE C 45 O LYS B 57 ? O LYS C 57 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A FES 201 ? 6 'binding site for residue FES A 201' AC2 Software C FES 201 ? 6 'binding site for residue FES C 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 CYS A 38 ? CYS A 38 . ? 1_555 ? 2 AC1 6 ASP A 40 ? ASP A 40 . ? 1_555 ? 3 AC1 6 CYS A 63 ? CYS A 63 . ? 1_555 ? 4 AC1 6 LYS A 104 ? LYS A 104 . ? 1_555 ? 5 AC1 6 CYS A 107 ? CYS A 107 . ? 1_555 ? 6 AC1 6 FES D . ? FES C 201 . ? 4_545 ? 7 AC2 6 FES C . ? FES A 201 . ? 4_555 ? 8 AC2 6 CYS B 38 ? CYS C 38 . ? 1_555 ? 9 AC2 6 ASP B 40 ? ASP C 40 . ? 1_555 ? 10 AC2 6 CYS B 63 ? CYS C 63 . ? 1_555 ? 11 AC2 6 LYS B 104 ? LYS C 104 . ? 1_555 ? 12 AC2 6 CYS B 107 ? CYS C 107 . ? 1_555 ? # _atom_sites.entry_id 7C8M _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011725 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.007794 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014894 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.025323 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ILE 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 GLN 4 4 ? ? ? A . n A 1 5 THR 5 5 ? ? ? A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 MET 105 105 105 MET MET A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 CYS 107 107 107 CYS CYS A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 HIS 129 129 129 HIS HIS A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 HIS 132 132 132 HIS HIS A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 HIS 134 134 ? ? ? A . n A 1 135 HIS 135 135 ? ? ? A . n A 1 136 HIS 136 136 ? ? ? A . n A 1 137 HIS 137 137 ? ? ? A . n B 1 1 MET 1 1 ? ? ? C . n B 1 2 ILE 2 2 ? ? ? C . n B 1 3 GLN 3 3 ? ? ? C . n B 1 4 GLN 4 4 ? ? ? C . n B 1 5 THR 5 5 ? ? ? C . n B 1 6 GLY 6 6 6 GLY GLY C . n B 1 7 TYR 7 7 7 TYR TYR C . n B 1 8 SER 8 8 8 SER SER C . n B 1 9 LYS 9 9 9 LYS LYS C . n B 1 10 LYS 10 10 10 LYS LYS C . n B 1 11 VAL 11 11 11 VAL VAL C . n B 1 12 MET 12 12 12 MET MET C . n B 1 13 GLU 13 13 13 GLU GLU C . n B 1 14 HIS 14 14 14 HIS HIS C . n B 1 15 PHE 15 15 15 PHE PHE C . n B 1 16 MET 16 16 16 MET MET C . n B 1 17 ASN 17 17 17 ASN ASN C . n B 1 18 PRO 18 18 18 PRO PRO C . n B 1 19 ARG 19 19 19 ARG ARG C . n B 1 20 ASN 20 20 20 ASN ASN C . n B 1 21 VAL 21 21 21 VAL VAL C . n B 1 22 GLY 22 22 22 GLY GLY C . n B 1 23 VAL 23 23 23 VAL VAL C . n B 1 24 ILE 24 24 24 ILE ILE C . n B 1 25 ASP 25 25 25 ASP ASP C . n B 1 26 ASP 26 26 26 ASP ASP C . n B 1 27 PRO 27 27 27 PRO PRO C . n B 1 28 ASP 28 28 28 ASP ASP C . n B 1 29 GLY 29 29 29 GLY GLY C . n B 1 30 TYR 30 30 30 TYR TYR C . n B 1 31 GLY 31 31 31 GLY GLY C . n B 1 32 LYS 32 32 32 LYS LYS C . n B 1 33 VAL 33 33 33 VAL VAL C . n B 1 34 GLY 34 34 34 GLY GLY C . n B 1 35 ASN 35 35 35 ASN ASN C . n B 1 36 PRO 36 36 36 PRO PRO C . n B 1 37 VAL 37 37 37 VAL VAL C . n B 1 38 CYS 38 38 38 CYS CYS C . n B 1 39 GLY 39 39 39 GLY GLY C . n B 1 40 ASP 40 40 40 ASP ASP C . n B 1 41 LEU 41 41 41 LEU LEU C . n B 1 42 MET 42 42 42 MET MET C . n B 1 43 GLU 43 43 43 GLU GLU C . n B 1 44 ILE 44 44 44 ILE ILE C . n B 1 45 PHE 45 45 45 PHE PHE C . n B 1 46 ILE 46 46 46 ILE ILE C . n B 1 47 LYS 47 47 47 LYS LYS C . n B 1 48 VAL 48 48 48 VAL VAL C . n B 1 49 GLY 49 49 49 GLY GLY C . n B 1 50 ASP 50 50 50 ASP ASP C . n B 1 51 GLU 51 51 51 GLU GLU C . n B 1 52 LYS 52 52 52 LYS LYS C . n B 1 53 ILE 53 53 53 ILE ILE C . n B 1 54 GLU 54 54 54 GLU GLU C . n B 1 55 ASP 55 55 55 ASP ASP C . n B 1 56 ILE 56 56 56 ILE ILE C . n B 1 57 LYS 57 57 57 LYS LYS C . n B 1 58 PHE 58 58 58 PHE PHE C . n B 1 59 ARG 59 59 59 ARG ARG C . n B 1 60 THR 60 60 60 THR THR C . n B 1 61 PHE 61 61 61 PHE PHE C . n B 1 62 GLY 62 62 62 GLY GLY C . n B 1 63 CYS 63 63 63 CYS CYS C . n B 1 64 GLY 64 64 64 GLY GLY C . n B 1 65 ALA 65 65 65 ALA ALA C . n B 1 66 ALA 66 66 66 ALA ALA C . n B 1 67 ILE 67 67 67 ILE ILE C . n B 1 68 ALA 68 68 68 ALA ALA C . n B 1 69 THR 69 69 69 THR THR C . n B 1 70 SER 70 70 70 SER SER C . n B 1 71 SER 71 71 71 SER SER C . n B 1 72 MET 72 72 72 MET MET C . n B 1 73 ILE 73 73 73 ILE ILE C . n B 1 74 THR 74 74 74 THR THR C . n B 1 75 GLU 75 75 75 GLU GLU C . n B 1 76 MET 76 76 76 MET MET C . n B 1 77 ALA 77 77 77 ALA ALA C . n B 1 78 ARG 78 78 78 ARG ARG C . n B 1 79 GLY 79 79 79 GLY GLY C . n B 1 80 LYS 80 80 80 LYS LYS C . n B 1 81 SER 81 81 81 SER SER C . n B 1 82 LEU 82 82 82 LEU LEU C . n B 1 83 GLU 83 83 83 GLU GLU C . n B 1 84 GLU 84 84 84 GLU GLU C . n B 1 85 ALA 85 85 85 ALA ALA C . n B 1 86 MET 86 86 86 MET MET C . n B 1 87 ARG 87 87 87 ARG ARG C . n B 1 88 ILE 88 88 88 ILE ILE C . n B 1 89 THR 89 89 89 THR THR C . n B 1 90 ARG 90 90 90 ARG ARG C . n B 1 91 ASN 91 91 91 ASN ASN C . n B 1 92 ASP 92 92 92 ASP ASP C . n B 1 93 VAL 93 93 93 VAL VAL C . n B 1 94 ALA 94 94 94 ALA ALA C . n B 1 95 ASP 95 95 95 ASP ASP C . n B 1 96 ALA 96 96 96 ALA ALA C . n B 1 97 LEU 97 97 97 LEU LEU C . n B 1 98 ASP 98 98 98 ASP ASP C . n B 1 99 GLY 99 99 99 GLY GLY C . n B 1 100 LEU 100 100 100 LEU LEU C . n B 1 101 PRO 101 101 101 PRO PRO C . n B 1 102 PRO 102 102 102 PRO PRO C . n B 1 103 GLN 103 103 103 GLN GLN C . n B 1 104 LYS 104 104 104 LYS LYS C . n B 1 105 MET 105 105 105 MET MET C . n B 1 106 HIS 106 106 106 HIS HIS C . n B 1 107 CYS 107 107 107 CYS CYS C . n B 1 108 SER 108 108 108 SER SER C . n B 1 109 ASN 109 109 109 ASN ASN C . n B 1 110 LEU 110 110 110 LEU LEU C . n B 1 111 ALA 111 111 111 ALA ALA C . n B 1 112 ALA 112 112 112 ALA ALA C . n B 1 113 ASP 113 113 113 ASP ASP C . n B 1 114 ALA 114 114 114 ALA ALA C . n B 1 115 LEU 115 115 115 LEU LEU C . n B 1 116 HIS 116 116 116 HIS HIS C . n B 1 117 ALA 117 117 117 ALA ALA C . n B 1 118 ALA 118 118 118 ALA ALA C . n B 1 119 ILE 119 119 119 ILE ILE C . n B 1 120 ASN 120 120 120 ASN ASN C . n B 1 121 ASP 121 121 121 ASP ASP C . n B 1 122 TYR 122 122 122 TYR TYR C . n B 1 123 LEU 123 123 123 LEU LEU C . n B 1 124 SER 124 124 124 SER SER C . n B 1 125 LYS 125 125 125 LYS LYS C . n B 1 126 LYS 126 126 126 LYS LYS C . n B 1 127 GLN 127 127 127 GLN GLN C . n B 1 128 LYS 128 128 128 LYS LYS C . n B 1 129 HIS 129 129 129 HIS HIS C . n B 1 130 LEU 130 130 130 LEU LEU C . n B 1 131 GLU 131 131 131 GLU GLU C . n B 1 132 HIS 132 132 132 HIS HIS C . n B 1 133 HIS 133 133 133 HIS HIS C . n B 1 134 HIS 134 134 ? ? ? C . n B 1 135 HIS 135 135 ? ? ? C . n B 1 136 HIS 136 136 ? ? ? C . n B 1 137 HIS 137 137 ? ? ? C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 FES 1 201 201 FES FES A . D 2 FES 1 201 201 FES FES C . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1600 ? 1 MORE -32 ? 1 'SSA (A^2)' 13020 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 38 ? A CYS 38 ? 1_555 FE2 ? C FES . ? A FES 201 ? 1_555 S1 ? C FES . ? A FES 201 ? 1_555 99.6 ? 2 SG ? A CYS 38 ? A CYS 38 ? 1_555 FE2 ? C FES . ? A FES 201 ? 1_555 S2 ? C FES . ? A FES 201 ? 1_555 112.0 ? 3 S1 ? C FES . ? A FES 201 ? 1_555 FE2 ? C FES . ? A FES 201 ? 1_555 S2 ? C FES . ? A FES 201 ? 1_555 89.5 ? 4 SG ? A CYS 38 ? A CYS 38 ? 1_555 FE2 ? C FES . ? A FES 201 ? 1_555 OD2 ? A ASP 40 ? A ASP 40 ? 1_555 111.8 ? 5 S1 ? C FES . ? A FES 201 ? 1_555 FE2 ? C FES . ? A FES 201 ? 1_555 OD2 ? A ASP 40 ? A ASP 40 ? 1_555 106.9 ? 6 S2 ? C FES . ? A FES 201 ? 1_555 FE2 ? C FES . ? A FES 201 ? 1_555 OD2 ? A ASP 40 ? A ASP 40 ? 1_555 129.4 ? 7 SG ? A CYS 63 ? A CYS 63 ? 1_555 FE1 ? C FES . ? A FES 201 ? 1_555 S1 ? C FES . ? A FES 201 ? 1_555 111.4 ? 8 SG ? A CYS 63 ? A CYS 63 ? 1_555 FE1 ? C FES . ? A FES 201 ? 1_555 S2 ? C FES . ? A FES 201 ? 1_555 99.3 ? 9 S1 ? C FES . ? A FES 201 ? 1_555 FE1 ? C FES . ? A FES 201 ? 1_555 S2 ? C FES . ? A FES 201 ? 1_555 88.6 ? 10 SG ? A CYS 63 ? A CYS 63 ? 1_555 FE1 ? C FES . ? A FES 201 ? 1_555 SG ? A CYS 107 ? A CYS 107 ? 1_555 101.2 ? 11 S1 ? C FES . ? A FES 201 ? 1_555 FE1 ? C FES . ? A FES 201 ? 1_555 SG ? A CYS 107 ? A CYS 107 ? 1_555 142.2 ? 12 S2 ? C FES . ? A FES 201 ? 1_555 FE1 ? C FES . ? A FES 201 ? 1_555 SG ? A CYS 107 ? A CYS 107 ? 1_555 104.9 ? 13 SG ? B CYS 38 ? C CYS 38 ? 1_555 FE2 ? D FES . ? C FES 201 ? 1_555 S1 ? D FES . ? C FES 201 ? 1_555 79.2 ? 14 SG ? B CYS 38 ? C CYS 38 ? 1_555 FE2 ? D FES . ? C FES 201 ? 1_555 S2 ? D FES . ? C FES 201 ? 1_555 111.3 ? 15 S1 ? D FES . ? C FES 201 ? 1_555 FE2 ? D FES . ? C FES 201 ? 1_555 S2 ? D FES . ? C FES 201 ? 1_555 90.2 ? 16 SG ? B CYS 38 ? C CYS 38 ? 1_555 FE2 ? D FES . ? C FES 201 ? 1_555 OD2 ? B ASP 40 ? C ASP 40 ? 1_555 106.7 ? 17 S1 ? D FES . ? C FES 201 ? 1_555 FE2 ? D FES . ? C FES 201 ? 1_555 OD2 ? B ASP 40 ? C ASP 40 ? 1_555 118.2 ? 18 S2 ? D FES . ? C FES 201 ? 1_555 FE2 ? D FES . ? C FES 201 ? 1_555 OD2 ? B ASP 40 ? C ASP 40 ? 1_555 136.1 ? 19 SG ? B CYS 63 ? C CYS 63 ? 1_555 FE1 ? D FES . ? C FES 201 ? 1_555 S1 ? D FES . ? C FES 201 ? 1_555 133.0 ? 20 SG ? B CYS 63 ? C CYS 63 ? 1_555 FE1 ? D FES . ? C FES 201 ? 1_555 S2 ? D FES . ? C FES 201 ? 1_555 96.0 ? 21 S1 ? D FES . ? C FES 201 ? 1_555 FE1 ? D FES . ? C FES 201 ? 1_555 S2 ? D FES . ? C FES 201 ? 1_555 89.9 ? 22 SG ? B CYS 63 ? C CYS 63 ? 1_555 FE1 ? D FES . ? C FES 201 ? 1_555 SG ? B CYS 107 ? C CYS 107 ? 1_555 99.7 ? 23 S1 ? D FES . ? C FES 201 ? 1_555 FE1 ? D FES . ? C FES 201 ? 1_555 SG ? B CYS 107 ? C CYS 107 ? 1_555 125.6 ? 24 S2 ? D FES . ? C FES 201 ? 1_555 FE1 ? D FES . ? C FES 201 ? 1_555 SG ? B CYS 107 ? C CYS 107 ? 1_555 98.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-05-26 2 'Structure model' 1 1 2021-06-09 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 3 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' 7 3 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 8 3 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 9 3 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 10 3 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 11 3 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 12 3 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 13 3 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 14 3 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _pdbx_entry_details.entry_id 7C8M _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 132 ? ? -45.93 109.00 2 1 LEU C 130 ? ? -94.66 38.37 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ILE 2 ? A ILE 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A GLN 4 ? A GLN 4 5 1 Y 1 A THR 5 ? A THR 5 6 1 Y 1 A HIS 134 ? A HIS 134 7 1 Y 1 A HIS 135 ? A HIS 135 8 1 Y 1 A HIS 136 ? A HIS 136 9 1 Y 1 A HIS 137 ? A HIS 137 10 1 Y 1 C MET 1 ? B MET 1 11 1 Y 1 C ILE 2 ? B ILE 2 12 1 Y 1 C GLN 3 ? B GLN 3 13 1 Y 1 C GLN 4 ? B GLN 4 14 1 Y 1 C THR 5 ? B THR 5 15 1 Y 1 C HIS 134 ? B HIS 134 16 1 Y 1 C HIS 135 ? B HIS 135 17 1 Y 1 C HIS 136 ? B HIS 136 18 1 Y 1 C HIS 137 ? B HIS 137 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FES FE1 FE N N 88 FES FE2 FE N N 89 FES S1 S N N 90 FES S2 S N N 91 GLN N N N N 92 GLN CA C N S 93 GLN C C N N 94 GLN O O N N 95 GLN CB C N N 96 GLN CG C N N 97 GLN CD C N N 98 GLN OE1 O N N 99 GLN NE2 N N N 100 GLN OXT O N N 101 GLN H H N N 102 GLN H2 H N N 103 GLN HA H N N 104 GLN HB2 H N N 105 GLN HB3 H N N 106 GLN HG2 H N N 107 GLN HG3 H N N 108 GLN HE21 H N N 109 GLN HE22 H N N 110 GLN HXT H N N 111 GLU N N N N 112 GLU CA C N S 113 GLU C C N N 114 GLU O O N N 115 GLU CB C N N 116 GLU CG C N N 117 GLU CD C N N 118 GLU OE1 O N N 119 GLU OE2 O N N 120 GLU OXT O N N 121 GLU H H N N 122 GLU H2 H N N 123 GLU HA H N N 124 GLU HB2 H N N 125 GLU HB3 H N N 126 GLU HG2 H N N 127 GLU HG3 H N N 128 GLU HE2 H N N 129 GLU HXT H N N 130 GLY N N N N 131 GLY CA C N N 132 GLY C C N N 133 GLY O O N N 134 GLY OXT O N N 135 GLY H H N N 136 GLY H2 H N N 137 GLY HA2 H N N 138 GLY HA3 H N N 139 GLY HXT H N N 140 HIS N N N N 141 HIS CA C N S 142 HIS C C N N 143 HIS O O N N 144 HIS CB C N N 145 HIS CG C Y N 146 HIS ND1 N Y N 147 HIS CD2 C Y N 148 HIS CE1 C Y N 149 HIS NE2 N Y N 150 HIS OXT O N N 151 HIS H H N N 152 HIS H2 H N N 153 HIS HA H N N 154 HIS HB2 H N N 155 HIS HB3 H N N 156 HIS HD1 H N N 157 HIS HD2 H N N 158 HIS HE1 H N N 159 HIS HE2 H N N 160 HIS HXT H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TYR N N N N 322 TYR CA C N S 323 TYR C C N N 324 TYR O O N N 325 TYR CB C N N 326 TYR CG C Y N 327 TYR CD1 C Y N 328 TYR CD2 C Y N 329 TYR CE1 C Y N 330 TYR CE2 C Y N 331 TYR CZ C Y N 332 TYR OH O N N 333 TYR OXT O N N 334 TYR H H N N 335 TYR H2 H N N 336 TYR HA H N N 337 TYR HB2 H N N 338 TYR HB3 H N N 339 TYR HD1 H N N 340 TYR HD2 H N N 341 TYR HE1 H N N 342 TYR HE2 H N N 343 TYR HH H N N 344 TYR HXT H N N 345 VAL N N N N 346 VAL CA C N S 347 VAL C C N N 348 VAL O O N N 349 VAL CB C N N 350 VAL CG1 C N N 351 VAL CG2 C N N 352 VAL OXT O N N 353 VAL H H N N 354 VAL H2 H N N 355 VAL HA H N N 356 VAL HB H N N 357 VAL HG11 H N N 358 VAL HG12 H N N 359 VAL HG13 H N N 360 VAL HG21 H N N 361 VAL HG22 H N N 362 VAL HG23 H N N 363 VAL HXT H N N 364 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FES FE1 S1 sing N N 83 FES FE1 S2 sing N N 84 FES FE2 S1 sing N N 85 FES FE2 S2 sing N N 86 GLN N CA sing N N 87 GLN N H sing N N 88 GLN N H2 sing N N 89 GLN CA C sing N N 90 GLN CA CB sing N N 91 GLN CA HA sing N N 92 GLN C O doub N N 93 GLN C OXT sing N N 94 GLN CB CG sing N N 95 GLN CB HB2 sing N N 96 GLN CB HB3 sing N N 97 GLN CG CD sing N N 98 GLN CG HG2 sing N N 99 GLN CG HG3 sing N N 100 GLN CD OE1 doub N N 101 GLN CD NE2 sing N N 102 GLN NE2 HE21 sing N N 103 GLN NE2 HE22 sing N N 104 GLN OXT HXT sing N N 105 GLU N CA sing N N 106 GLU N H sing N N 107 GLU N H2 sing N N 108 GLU CA C sing N N 109 GLU CA CB sing N N 110 GLU CA HA sing N N 111 GLU C O doub N N 112 GLU C OXT sing N N 113 GLU CB CG sing N N 114 GLU CB HB2 sing N N 115 GLU CB HB3 sing N N 116 GLU CG CD sing N N 117 GLU CG HG2 sing N N 118 GLU CG HG3 sing N N 119 GLU CD OE1 doub N N 120 GLU CD OE2 sing N N 121 GLU OE2 HE2 sing N N 122 GLU OXT HXT sing N N 123 GLY N CA sing N N 124 GLY N H sing N N 125 GLY N H2 sing N N 126 GLY CA C sing N N 127 GLY CA HA2 sing N N 128 GLY CA HA3 sing N N 129 GLY C O doub N N 130 GLY C OXT sing N N 131 GLY OXT HXT sing N N 132 HIS N CA sing N N 133 HIS N H sing N N 134 HIS N H2 sing N N 135 HIS CA C sing N N 136 HIS CA CB sing N N 137 HIS CA HA sing N N 138 HIS C O doub N N 139 HIS C OXT sing N N 140 HIS CB CG sing N N 141 HIS CB HB2 sing N N 142 HIS CB HB3 sing N N 143 HIS CG ND1 sing Y N 144 HIS CG CD2 doub Y N 145 HIS ND1 CE1 doub Y N 146 HIS ND1 HD1 sing N N 147 HIS CD2 NE2 sing Y N 148 HIS CD2 HD2 sing N N 149 HIS CE1 NE2 sing Y N 150 HIS CE1 HE1 sing N N 151 HIS NE2 HE2 sing N N 152 HIS OXT HXT sing N N 153 ILE N CA sing N N 154 ILE N H sing N N 155 ILE N H2 sing N N 156 ILE CA C sing N N 157 ILE CA CB sing N N 158 ILE CA HA sing N N 159 ILE C O doub N N 160 ILE C OXT sing N N 161 ILE CB CG1 sing N N 162 ILE CB CG2 sing N N 163 ILE CB HB sing N N 164 ILE CG1 CD1 sing N N 165 ILE CG1 HG12 sing N N 166 ILE CG1 HG13 sing N N 167 ILE CG2 HG21 sing N N 168 ILE CG2 HG22 sing N N 169 ILE CG2 HG23 sing N N 170 ILE CD1 HD11 sing N N 171 ILE CD1 HD12 sing N N 172 ILE CD1 HD13 sing N N 173 ILE OXT HXT sing N N 174 LEU N CA sing N N 175 LEU N H sing N N 176 LEU N H2 sing N N 177 LEU CA C sing N N 178 LEU CA CB sing N N 179 LEU CA HA sing N N 180 LEU C O doub N N 181 LEU C OXT sing N N 182 LEU CB CG sing N N 183 LEU CB HB2 sing N N 184 LEU CB HB3 sing N N 185 LEU CG CD1 sing N N 186 LEU CG CD2 sing N N 187 LEU CG HG sing N N 188 LEU CD1 HD11 sing N N 189 LEU CD1 HD12 sing N N 190 LEU CD1 HD13 sing N N 191 LEU CD2 HD21 sing N N 192 LEU CD2 HD22 sing N N 193 LEU CD2 HD23 sing N N 194 LEU OXT HXT sing N N 195 LYS N CA sing N N 196 LYS N H sing N N 197 LYS N H2 sing N N 198 LYS CA C sing N N 199 LYS CA CB sing N N 200 LYS CA HA sing N N 201 LYS C O doub N N 202 LYS C OXT sing N N 203 LYS CB CG sing N N 204 LYS CB HB2 sing N N 205 LYS CB HB3 sing N N 206 LYS CG CD sing N N 207 LYS CG HG2 sing N N 208 LYS CG HG3 sing N N 209 LYS CD CE sing N N 210 LYS CD HD2 sing N N 211 LYS CD HD3 sing N N 212 LYS CE NZ sing N N 213 LYS CE HE2 sing N N 214 LYS CE HE3 sing N N 215 LYS NZ HZ1 sing N N 216 LYS NZ HZ2 sing N N 217 LYS NZ HZ3 sing N N 218 LYS OXT HXT sing N N 219 MET N CA sing N N 220 MET N H sing N N 221 MET N H2 sing N N 222 MET CA C sing N N 223 MET CA CB sing N N 224 MET CA HA sing N N 225 MET C O doub N N 226 MET C OXT sing N N 227 MET CB CG sing N N 228 MET CB HB2 sing N N 229 MET CB HB3 sing N N 230 MET CG SD sing N N 231 MET CG HG2 sing N N 232 MET CG HG3 sing N N 233 MET SD CE sing N N 234 MET CE HE1 sing N N 235 MET CE HE2 sing N N 236 MET CE HE3 sing N N 237 MET OXT HXT sing N N 238 PHE N CA sing N N 239 PHE N H sing N N 240 PHE N H2 sing N N 241 PHE CA C sing N N 242 PHE CA CB sing N N 243 PHE CA HA sing N N 244 PHE C O doub N N 245 PHE C OXT sing N N 246 PHE CB CG sing N N 247 PHE CB HB2 sing N N 248 PHE CB HB3 sing N N 249 PHE CG CD1 doub Y N 250 PHE CG CD2 sing Y N 251 PHE CD1 CE1 sing Y N 252 PHE CD1 HD1 sing N N 253 PHE CD2 CE2 doub Y N 254 PHE CD2 HD2 sing N N 255 PHE CE1 CZ doub Y N 256 PHE CE1 HE1 sing N N 257 PHE CE2 CZ sing Y N 258 PHE CE2 HE2 sing N N 259 PHE CZ HZ sing N N 260 PHE OXT HXT sing N N 261 PRO N CA sing N N 262 PRO N CD sing N N 263 PRO N H sing N N 264 PRO CA C sing N N 265 PRO CA CB sing N N 266 PRO CA HA sing N N 267 PRO C O doub N N 268 PRO C OXT sing N N 269 PRO CB CG sing N N 270 PRO CB HB2 sing N N 271 PRO CB HB3 sing N N 272 PRO CG CD sing N N 273 PRO CG HG2 sing N N 274 PRO CG HG3 sing N N 275 PRO CD HD2 sing N N 276 PRO CD HD3 sing N N 277 PRO OXT HXT sing N N 278 SER N CA sing N N 279 SER N H sing N N 280 SER N H2 sing N N 281 SER CA C sing N N 282 SER CA CB sing N N 283 SER CA HA sing N N 284 SER C O doub N N 285 SER C OXT sing N N 286 SER CB OG sing N N 287 SER CB HB2 sing N N 288 SER CB HB3 sing N N 289 SER OG HG sing N N 290 SER OXT HXT sing N N 291 THR N CA sing N N 292 THR N H sing N N 293 THR N H2 sing N N 294 THR CA C sing N N 295 THR CA CB sing N N 296 THR CA HA sing N N 297 THR C O doub N N 298 THR C OXT sing N N 299 THR CB OG1 sing N N 300 THR CB CG2 sing N N 301 THR CB HB sing N N 302 THR OG1 HG1 sing N N 303 THR CG2 HG21 sing N N 304 THR CG2 HG22 sing N N 305 THR CG2 HG23 sing N N 306 THR OXT HXT sing N N 307 TYR N CA sing N N 308 TYR N H sing N N 309 TYR N H2 sing N N 310 TYR CA C sing N N 311 TYR CA CB sing N N 312 TYR CA HA sing N N 313 TYR C O doub N N 314 TYR C OXT sing N N 315 TYR CB CG sing N N 316 TYR CB HB2 sing N N 317 TYR CB HB3 sing N N 318 TYR CG CD1 doub Y N 319 TYR CG CD2 sing Y N 320 TYR CD1 CE1 sing Y N 321 TYR CD1 HD1 sing N N 322 TYR CD2 CE2 doub Y N 323 TYR CD2 HD2 sing N N 324 TYR CE1 CZ doub Y N 325 TYR CE1 HE1 sing N N 326 TYR CE2 CZ sing Y N 327 TYR CE2 HE2 sing N N 328 TYR CZ OH sing N N 329 TYR OH HH sing N N 330 TYR OXT HXT sing N N 331 VAL N CA sing N N 332 VAL N H sing N N 333 VAL N H2 sing N N 334 VAL CA C sing N N 335 VAL CA CB sing N N 336 VAL CA HA sing N N 337 VAL C O doub N N 338 VAL C OXT sing N N 339 VAL CB CG1 sing N N 340 VAL CB CG2 sing N N 341 VAL CB HB sing N N 342 VAL CG1 HG11 sing N N 343 VAL CG1 HG12 sing N N 344 VAL CG1 HG13 sing N N 345 VAL CG2 HG21 sing N N 346 VAL CG2 HG22 sing N N 347 VAL CG2 HG23 sing N N 348 VAL OXT HXT sing N N 349 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science (JSPS)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 17K14510 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'FE2/S2 (INORGANIC) CLUSTER' _pdbx_entity_nonpoly.comp_id FES # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2Z7E _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #