data_7CA4 # _entry.id 7CA4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7CA4 pdb_00007ca4 10.2210/pdb7ca4/pdb WWPDB D_1300017234 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7CA4 _pdbx_database_status.recvd_initial_deposition_date 2020-06-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, F.' 1 ? 'Lv, Z.' 2 ? 'Lin, D.' 3 ? 'Huang, Y.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'The Crystal Structure of human Bcl-2-like protein 1 from Biortus.' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, F.' 1 ? primary 'Lv, Z.' 2 ? primary 'Lin, D.' 3 ? primary 'Huang, Y.' 4 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7CA4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 63.213 _cell.length_a_esd ? _cell.length_b 63.213 _cell.length_b_esd ? _cell.length_c 111.009 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7CA4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bcl-2-like protein 1' 25662.111 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 3 water nat water 18.015 30 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Bcl2-L-1,Apoptosis regulator Bcl-X' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGGSHHHHHHENLYFQGMSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSP AVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAF FSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFN ; _entity_poly.pdbx_seq_one_letter_code_can ;MGGSHHHHHHENLYFQGMSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSP AVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAF FSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 GLY n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 GLU n 1 12 ASN n 1 13 LEU n 1 14 TYR n 1 15 PHE n 1 16 GLN n 1 17 GLY n 1 18 MET n 1 19 SER n 1 20 GLN n 1 21 SER n 1 22 ASN n 1 23 ARG n 1 24 GLU n 1 25 LEU n 1 26 VAL n 1 27 VAL n 1 28 ASP n 1 29 PHE n 1 30 LEU n 1 31 SER n 1 32 TYR n 1 33 LYS n 1 34 LEU n 1 35 SER n 1 36 GLN n 1 37 LYS n 1 38 GLY n 1 39 TYR n 1 40 SER n 1 41 TRP n 1 42 SER n 1 43 GLN n 1 44 PHE n 1 45 SER n 1 46 ASP n 1 47 VAL n 1 48 GLU n 1 49 GLU n 1 50 ASN n 1 51 ARG n 1 52 THR n 1 53 GLU n 1 54 ALA n 1 55 PRO n 1 56 GLU n 1 57 GLY n 1 58 THR n 1 59 GLU n 1 60 SER n 1 61 GLU n 1 62 MET n 1 63 GLU n 1 64 THR n 1 65 PRO n 1 66 SER n 1 67 ALA n 1 68 ILE n 1 69 ASN n 1 70 GLY n 1 71 ASN n 1 72 PRO n 1 73 SER n 1 74 TRP n 1 75 HIS n 1 76 LEU n 1 77 ALA n 1 78 ASP n 1 79 SER n 1 80 PRO n 1 81 ALA n 1 82 VAL n 1 83 ASN n 1 84 GLY n 1 85 ALA n 1 86 THR n 1 87 GLY n 1 88 HIS n 1 89 SER n 1 90 SER n 1 91 SER n 1 92 LEU n 1 93 ASP n 1 94 ALA n 1 95 ARG n 1 96 GLU n 1 97 VAL n 1 98 ILE n 1 99 PRO n 1 100 MET n 1 101 ALA n 1 102 ALA n 1 103 VAL n 1 104 LYS n 1 105 GLN n 1 106 ALA n 1 107 LEU n 1 108 ARG n 1 109 GLU n 1 110 ALA n 1 111 GLY n 1 112 ASP n 1 113 GLU n 1 114 PHE n 1 115 GLU n 1 116 LEU n 1 117 ARG n 1 118 TYR n 1 119 ARG n 1 120 ARG n 1 121 ALA n 1 122 PHE n 1 123 SER n 1 124 ASP n 1 125 LEU n 1 126 THR n 1 127 SER n 1 128 GLN n 1 129 LEU n 1 130 HIS n 1 131 ILE n 1 132 THR n 1 133 PRO n 1 134 GLY n 1 135 THR n 1 136 ALA n 1 137 TYR n 1 138 GLN n 1 139 SER n 1 140 PHE n 1 141 GLU n 1 142 GLN n 1 143 VAL n 1 144 VAL n 1 145 ASN n 1 146 GLU n 1 147 LEU n 1 148 PHE n 1 149 ARG n 1 150 ASP n 1 151 GLY n 1 152 VAL n 1 153 ASN n 1 154 TRP n 1 155 GLY n 1 156 ARG n 1 157 ILE n 1 158 VAL n 1 159 ALA n 1 160 PHE n 1 161 PHE n 1 162 SER n 1 163 PHE n 1 164 GLY n 1 165 GLY n 1 166 ALA n 1 167 LEU n 1 168 CYS n 1 169 VAL n 1 170 GLU n 1 171 SER n 1 172 VAL n 1 173 ASP n 1 174 LYS n 1 175 GLU n 1 176 MET n 1 177 GLN n 1 178 VAL n 1 179 LEU n 1 180 VAL n 1 181 SER n 1 182 ARG n 1 183 ILE n 1 184 ALA n 1 185 ALA n 1 186 TRP n 1 187 MET n 1 188 ALA n 1 189 THR n 1 190 TYR n 1 191 LEU n 1 192 ASN n 1 193 ASP n 1 194 HIS n 1 195 LEU n 1 196 GLU n 1 197 PRO n 1 198 TRP n 1 199 ILE n 1 200 GLN n 1 201 GLU n 1 202 ASN n 1 203 GLY n 1 204 GLY n 1 205 TRP n 1 206 ASP n 1 207 THR n 1 208 PHE n 1 209 VAL n 1 210 GLU n 1 211 LEU n 1 212 TYR n 1 213 GLY n 1 214 ASN n 1 215 ASN n 1 216 ALA n 1 217 ALA n 1 218 ALA n 1 219 GLU n 1 220 SER n 1 221 ARG n 1 222 LYS n 1 223 GLY n 1 224 GLN n 1 225 GLU n 1 226 ARG n 1 227 PHE n 1 228 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 228 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BCL2L1, BCL2L, BCLX' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B2CL1_HUMAN _struct_ref.pdbx_db_accession Q07817 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFN ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7CA4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 18 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 228 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q07817 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 211 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 211 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7CA4 MET A 1 ? UNP Q07817 ? ? 'initiating methionine' -16 1 1 7CA4 GLY A 2 ? UNP Q07817 ? ? 'expression tag' -15 2 1 7CA4 GLY A 3 ? UNP Q07817 ? ? 'expression tag' -14 3 1 7CA4 SER A 4 ? UNP Q07817 ? ? 'expression tag' -13 4 1 7CA4 HIS A 5 ? UNP Q07817 ? ? 'expression tag' -12 5 1 7CA4 HIS A 6 ? UNP Q07817 ? ? 'expression tag' -11 6 1 7CA4 HIS A 7 ? UNP Q07817 ? ? 'expression tag' -10 7 1 7CA4 HIS A 8 ? UNP Q07817 ? ? 'expression tag' -9 8 1 7CA4 HIS A 9 ? UNP Q07817 ? ? 'expression tag' -8 9 1 7CA4 HIS A 10 ? UNP Q07817 ? ? 'expression tag' -7 10 1 7CA4 GLU A 11 ? UNP Q07817 ? ? 'expression tag' -6 11 1 7CA4 ASN A 12 ? UNP Q07817 ? ? 'expression tag' -5 12 1 7CA4 LEU A 13 ? UNP Q07817 ? ? 'expression tag' -4 13 1 7CA4 TYR A 14 ? UNP Q07817 ? ? 'expression tag' -3 14 1 7CA4 PHE A 15 ? UNP Q07817 ? ? 'expression tag' -2 15 1 7CA4 GLN A 16 ? UNP Q07817 ? ? 'expression tag' -1 16 1 7CA4 GLY A 17 ? UNP Q07817 ? ? 'expression tag' 0 17 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7CA4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.34 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.07 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '50mM MES, pH6.2, 1.8M ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU SATURN 944+' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-01-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54178 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU FR-E SUPERBRIGHT' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54178 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7CA4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.7 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6656 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.7 _reflns.pdbx_Rmerge_I_obs 0.124 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.69 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.70 _reflns_shell.d_res_low 2.75 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 330 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.601 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.341 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] 0.341 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] -0.683 _refine.B_iso_max ? _refine.B_iso_mean 40.404 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.940 _refine.correlation_coeff_Fo_to_Fc_free 0.923 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7CA4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.700 _refine.ls_d_res_low 31.954 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6625 _refine.ls_number_reflns_R_free 327 _refine.ls_number_reflns_R_work 6298 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.759 _refine.ls_percent_reflns_R_free 4.936 _refine.ls_R_factor_all 0.200 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2284 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1984 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3cva _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.493 _refine.pdbx_overall_ESU_R_Free 0.275 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 9.373 _refine.overall_SU_ML 0.194 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.700 _refine_hist.d_res_low 31.954 _refine_hist.number_atoms_solvent 30 _refine_hist.number_atoms_total 1206 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1161 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 0.013 1202 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.018 1050 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.236 1.628 1627 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.153 1.571 2424 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.480 5.000 141 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.386 22.361 72 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.828 15.000 192 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 23.327 15.000 8 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.050 0.200 142 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 1349 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 287 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.192 0.200 269 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.187 0.200 911 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.166 0.200 582 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.081 0.200 530 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.157 0.200 30 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.167 0.200 13 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.189 0.200 33 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.125 0.200 6 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 1.803 4.167 570 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.804 4.161 569 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.111 6.224 709 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.109 6.231 710 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 1.940 4.575 632 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 1.909 4.437 618 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 3.383 6.756 918 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.362 6.561 900 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.025 47.757 1407 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 7.024 47.790 1405 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.700 2.770 . . 28 454 99.5868 . . . 0.316 . 0.223 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.770 2.846 . . 19 440 100.0000 . . . 0.270 . 0.242 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.846 2.928 . . 22 423 100.0000 . . . 0.210 . 0.240 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.928 3.018 . . 15 429 100.0000 . . . 0.317 . 0.232 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.018 3.117 . . 21 399 100.0000 . . . 0.235 . 0.238 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.117 3.226 . . 19 396 100.0000 . . . 0.274 . 0.218 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.226 3.347 . . 22 381 100.0000 . . . 0.248 . 0.214 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.347 3.483 . . 24 355 100.0000 . . . 0.283 . 0.222 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.483 3.638 . . 15 356 100.0000 . . . 0.166 . 0.220 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.638 3.814 . . 25 337 100.0000 . . . 0.194 . 0.186 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.814 4.019 . . 12 325 100.0000 . . . 0.204 . 0.179 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.019 4.262 . . 14 323 100.0000 . . . 0.316 . 0.177 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.262 4.554 . . 17 290 100.0000 . . . 0.180 . 0.160 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.554 4.916 . . 14 268 99.6466 . . . 0.253 . 0.166 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.916 5.381 . . 12 252 100.0000 . . . 0.150 . 0.179 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.381 6.009 . . 17 236 100.0000 . . . 0.284 . 0.214 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.009 6.925 . . 12 210 100.0000 . . . 0.317 . 0.228 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.925 8.448 . . 7 183 99.4764 . . . 0.212 . 0.149 . . . . . . . . . . . 'X-RAY DIFFRACTION' 8.448 11.808 . . 7 153 99.3789 . . . 0.131 . 0.146 . . . . . . . . . . . 'X-RAY DIFFRACTION' 11.808 31.954 . . 5 88 89.4231 . . . 0.160 . 0.247 . . . . . . . . . . . # _struct.entry_id 7CA4 _struct.title 'The Crystal Structure of human Bcl-2-like protein 1 from Biortus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7CA4 _struct_keywords.text 'Apoptosis regulator proteins, Bcl-2 family, APOPTOSIS' _struct_keywords.pdbx_keywords APOPTOSIS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 18 ? LYS A 37 ? MET A 1 LYS A 20 1 ? 20 HELX_P HELX_P2 AA2 MET A 100 ? TYR A 118 ? MET A 83 TYR A 101 1 ? 19 HELX_P HELX_P3 AA3 PHE A 122 ? HIS A 130 ? PHE A 105 HIS A 113 1 ? 9 HELX_P HELX_P4 AA4 ALA A 136 ? ASN A 145 ? ALA A 119 ASN A 128 1 ? 10 HELX_P HELX_P5 AA5 GLU A 146 ? ARG A 149 ? GLU A 129 ARG A 132 5 ? 4 HELX_P HELX_P6 AA6 ASN A 153 ? LYS A 174 ? ASN A 136 LYS A 157 1 ? 22 HELX_P HELX_P7 AA7 VAL A 178 ? LEU A 195 ? VAL A 161 LEU A 178 1 ? 18 HELX_P HELX_P8 AA8 LEU A 195 ? ASN A 202 ? LEU A 178 ASN A 185 1 ? 8 HELX_P HELX_P9 AA9 GLY A 203 ? GLY A 213 ? GLY A 186 GLY A 196 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 301 ? 6 'binding site for residue SO4 A 301' AC2 Software A SO4 302 ? 3 'binding site for residue SO4 A 302' AC3 Software A SO4 303 ? 3 'binding site for residue SO4 A 303' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLN A 36 ? GLN A 19 . ? 1_555 ? 2 AC1 6 LYS A 37 ? LYS A 20 . ? 1_555 ? 3 AC1 6 ASP A 112 ? ASP A 95 . ? 1_555 ? 4 AC1 6 GLU A 115 ? GLU A 98 . ? 1_555 ? 5 AC1 6 LEU A 116 ? LEU A 99 . ? 1_555 ? 6 AC1 6 GLU A 201 ? GLU A 184 . ? 4_444 ? 7 AC2 3 ALA A 136 ? ALA A 119 . ? 1_555 ? 8 AC2 3 TYR A 137 ? TYR A 120 . ? 1_555 ? 9 AC2 3 TRP A 186 ? TRP A 169 . ? 1_555 ? 10 AC3 3 ARG A 117 ? ARG A 100 . ? 1_555 ? 11 AC3 3 TYR A 118 ? TYR A 101 . ? 1_555 ? 12 AC3 3 GLU A 175 ? GLU A 158 . ? 5_455 ? # _atom_sites.entry_id 7CA4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.015820 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015820 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009008 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 0.867 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -16 ? ? ? A . n A 1 2 GLY 2 -15 ? ? ? A . n A 1 3 GLY 3 -14 ? ? ? A . n A 1 4 SER 4 -13 ? ? ? A . n A 1 5 HIS 5 -12 ? ? ? A . n A 1 6 HIS 6 -11 ? ? ? A . n A 1 7 HIS 7 -10 ? ? ? A . n A 1 8 HIS 8 -9 ? ? ? A . n A 1 9 HIS 9 -8 ? ? ? A . n A 1 10 HIS 10 -7 ? ? ? A . n A 1 11 GLU 11 -6 ? ? ? A . n A 1 12 ASN 12 -5 ? ? ? A . n A 1 13 LEU 13 -4 ? ? ? A . n A 1 14 TYR 14 -3 ? ? ? A . n A 1 15 PHE 15 -2 ? ? ? A . n A 1 16 GLN 16 -1 ? ? ? A . n A 1 17 GLY 17 0 ? ? ? A . n A 1 18 MET 18 1 1 MET MET A . n A 1 19 SER 19 2 2 SER SER A . n A 1 20 GLN 20 3 3 GLN GLN A . n A 1 21 SER 21 4 4 SER SER A . n A 1 22 ASN 22 5 5 ASN ASN A . n A 1 23 ARG 23 6 6 ARG ARG A . n A 1 24 GLU 24 7 7 GLU GLU A . n A 1 25 LEU 25 8 8 LEU LEU A . n A 1 26 VAL 26 9 9 VAL VAL A . n A 1 27 VAL 27 10 10 VAL VAL A . n A 1 28 ASP 28 11 11 ASP ASP A . n A 1 29 PHE 29 12 12 PHE PHE A . n A 1 30 LEU 30 13 13 LEU LEU A . n A 1 31 SER 31 14 14 SER SER A . n A 1 32 TYR 32 15 15 TYR TYR A . n A 1 33 LYS 33 16 16 LYS LYS A . n A 1 34 LEU 34 17 17 LEU LEU A . n A 1 35 SER 35 18 18 SER SER A . n A 1 36 GLN 36 19 19 GLN GLN A . n A 1 37 LYS 37 20 20 LYS LYS A . n A 1 38 GLY 38 21 21 GLY GLY A . n A 1 39 TYR 39 22 22 TYR TYR A . n A 1 40 SER 40 23 23 SER SER A . n A 1 41 TRP 41 24 24 TRP TRP A . n A 1 42 SER 42 25 25 SER SER A . n A 1 43 GLN 43 26 26 GLN GLN A . n A 1 44 PHE 44 27 27 PHE PHE A . n A 1 45 SER 45 28 ? ? ? A . n A 1 46 ASP 46 29 ? ? ? A . n A 1 47 VAL 47 30 ? ? ? A . n A 1 48 GLU 48 31 ? ? ? A . n A 1 49 GLU 49 32 ? ? ? A . n A 1 50 ASN 50 33 ? ? ? A . n A 1 51 ARG 51 34 ? ? ? A . n A 1 52 THR 52 35 ? ? ? A . n A 1 53 GLU 53 36 ? ? ? A . n A 1 54 ALA 54 37 ? ? ? A . n A 1 55 PRO 55 38 ? ? ? A . n A 1 56 GLU 56 39 ? ? ? A . n A 1 57 GLY 57 40 ? ? ? A . n A 1 58 THR 58 41 ? ? ? A . n A 1 59 GLU 59 42 ? ? ? A . n A 1 60 SER 60 43 ? ? ? A . n A 1 61 GLU 61 44 ? ? ? A . n A 1 62 MET 62 45 ? ? ? A . n A 1 63 GLU 63 46 ? ? ? A . n A 1 64 THR 64 47 ? ? ? A . n A 1 65 PRO 65 48 ? ? ? A . n A 1 66 SER 66 49 ? ? ? A . n A 1 67 ALA 67 50 ? ? ? A . n A 1 68 ILE 68 51 ? ? ? A . n A 1 69 ASN 69 52 ? ? ? A . n A 1 70 GLY 70 53 ? ? ? A . n A 1 71 ASN 71 54 ? ? ? A . n A 1 72 PRO 72 55 ? ? ? A . n A 1 73 SER 73 56 ? ? ? A . n A 1 74 TRP 74 57 ? ? ? A . n A 1 75 HIS 75 58 ? ? ? A . n A 1 76 LEU 76 59 ? ? ? A . n A 1 77 ALA 77 60 ? ? ? A . n A 1 78 ASP 78 61 ? ? ? A . n A 1 79 SER 79 62 ? ? ? A . n A 1 80 PRO 80 63 ? ? ? A . n A 1 81 ALA 81 64 ? ? ? A . n A 1 82 VAL 82 65 ? ? ? A . n A 1 83 ASN 83 66 ? ? ? A . n A 1 84 GLY 84 67 ? ? ? A . n A 1 85 ALA 85 68 ? ? ? A . n A 1 86 THR 86 69 ? ? ? A . n A 1 87 GLY 87 70 ? ? ? A . n A 1 88 HIS 88 71 ? ? ? A . n A 1 89 SER 89 72 ? ? ? A . n A 1 90 SER 90 73 ? ? ? A . n A 1 91 SER 91 74 ? ? ? A . n A 1 92 LEU 92 75 ? ? ? A . n A 1 93 ASP 93 76 ? ? ? A . n A 1 94 ALA 94 77 ? ? ? A . n A 1 95 ARG 95 78 ? ? ? A . n A 1 96 GLU 96 79 ? ? ? A . n A 1 97 VAL 97 80 ? ? ? A . n A 1 98 ILE 98 81 ? ? ? A . n A 1 99 PRO 99 82 82 PRO PRO A . n A 1 100 MET 100 83 83 MET MET A . n A 1 101 ALA 101 84 84 ALA ALA A . n A 1 102 ALA 102 85 85 ALA ALA A . n A 1 103 VAL 103 86 86 VAL VAL A . n A 1 104 LYS 104 87 87 LYS LYS A . n A 1 105 GLN 105 88 88 GLN GLN A . n A 1 106 ALA 106 89 89 ALA ALA A . n A 1 107 LEU 107 90 90 LEU LEU A . n A 1 108 ARG 108 91 91 ARG ARG A . n A 1 109 GLU 109 92 92 GLU GLU A . n A 1 110 ALA 110 93 93 ALA ALA A . n A 1 111 GLY 111 94 94 GLY GLY A . n A 1 112 ASP 112 95 95 ASP ASP A . n A 1 113 GLU 113 96 96 GLU GLU A . n A 1 114 PHE 114 97 97 PHE PHE A . n A 1 115 GLU 115 98 98 GLU GLU A . n A 1 116 LEU 116 99 99 LEU LEU A . n A 1 117 ARG 117 100 100 ARG ARG A . n A 1 118 TYR 118 101 101 TYR TYR A . n A 1 119 ARG 119 102 102 ARG ARG A . n A 1 120 ARG 120 103 103 ARG ARG A . n A 1 121 ALA 121 104 104 ALA ALA A . n A 1 122 PHE 122 105 105 PHE PHE A . n A 1 123 SER 123 106 106 SER SER A . n A 1 124 ASP 124 107 107 ASP ASP A . n A 1 125 LEU 125 108 108 LEU LEU A . n A 1 126 THR 126 109 109 THR THR A . n A 1 127 SER 127 110 110 SER SER A . n A 1 128 GLN 128 111 111 GLN GLN A . n A 1 129 LEU 129 112 112 LEU LEU A . n A 1 130 HIS 130 113 113 HIS HIS A . n A 1 131 ILE 131 114 114 ILE ILE A . n A 1 132 THR 132 115 115 THR THR A . n A 1 133 PRO 133 116 116 PRO PRO A . n A 1 134 GLY 134 117 117 GLY GLY A . n A 1 135 THR 135 118 118 THR THR A . n A 1 136 ALA 136 119 119 ALA ALA A . n A 1 137 TYR 137 120 120 TYR TYR A . n A 1 138 GLN 138 121 121 GLN GLN A . n A 1 139 SER 139 122 122 SER SER A . n A 1 140 PHE 140 123 123 PHE PHE A . n A 1 141 GLU 141 124 124 GLU GLU A . n A 1 142 GLN 142 125 125 GLN GLN A . n A 1 143 VAL 143 126 126 VAL VAL A . n A 1 144 VAL 144 127 127 VAL VAL A . n A 1 145 ASN 145 128 128 ASN ASN A . n A 1 146 GLU 146 129 129 GLU GLU A . n A 1 147 LEU 147 130 130 LEU LEU A . n A 1 148 PHE 148 131 131 PHE PHE A . n A 1 149 ARG 149 132 132 ARG ARG A . n A 1 150 ASP 150 133 133 ASP ASP A . n A 1 151 GLY 151 134 134 GLY GLY A . n A 1 152 VAL 152 135 135 VAL VAL A . n A 1 153 ASN 153 136 136 ASN ASN A . n A 1 154 TRP 154 137 137 TRP TRP A . n A 1 155 GLY 155 138 138 GLY GLY A . n A 1 156 ARG 156 139 139 ARG ARG A . n A 1 157 ILE 157 140 140 ILE ILE A . n A 1 158 VAL 158 141 141 VAL VAL A . n A 1 159 ALA 159 142 142 ALA ALA A . n A 1 160 PHE 160 143 143 PHE PHE A . n A 1 161 PHE 161 144 144 PHE PHE A . n A 1 162 SER 162 145 145 SER SER A . n A 1 163 PHE 163 146 146 PHE PHE A . n A 1 164 GLY 164 147 147 GLY GLY A . n A 1 165 GLY 165 148 148 GLY GLY A . n A 1 166 ALA 166 149 149 ALA ALA A . n A 1 167 LEU 167 150 150 LEU LEU A . n A 1 168 CYS 168 151 151 CYS CYS A . n A 1 169 VAL 169 152 152 VAL VAL A . n A 1 170 GLU 170 153 153 GLU GLU A . n A 1 171 SER 171 154 154 SER SER A . n A 1 172 VAL 172 155 155 VAL VAL A . n A 1 173 ASP 173 156 156 ASP ASP A . n A 1 174 LYS 174 157 157 LYS LYS A . n A 1 175 GLU 175 158 158 GLU GLU A . n A 1 176 MET 176 159 159 MET MET A . n A 1 177 GLN 177 160 160 GLN GLN A . n A 1 178 VAL 178 161 161 VAL VAL A . n A 1 179 LEU 179 162 162 LEU LEU A . n A 1 180 VAL 180 163 163 VAL VAL A . n A 1 181 SER 181 164 164 SER SER A . n A 1 182 ARG 182 165 165 ARG ARG A . n A 1 183 ILE 183 166 166 ILE ILE A . n A 1 184 ALA 184 167 167 ALA ALA A . n A 1 185 ALA 185 168 168 ALA ALA A . n A 1 186 TRP 186 169 169 TRP TRP A . n A 1 187 MET 187 170 170 MET MET A . n A 1 188 ALA 188 171 171 ALA ALA A . n A 1 189 THR 189 172 172 THR THR A . n A 1 190 TYR 190 173 173 TYR TYR A . n A 1 191 LEU 191 174 174 LEU LEU A . n A 1 192 ASN 192 175 175 ASN ASN A . n A 1 193 ASP 193 176 176 ASP ASP A . n A 1 194 HIS 194 177 177 HIS HIS A . n A 1 195 LEU 195 178 178 LEU LEU A . n A 1 196 GLU 196 179 179 GLU GLU A . n A 1 197 PRO 197 180 180 PRO PRO A . n A 1 198 TRP 198 181 181 TRP TRP A . n A 1 199 ILE 199 182 182 ILE ILE A . n A 1 200 GLN 200 183 183 GLN GLN A . n A 1 201 GLU 201 184 184 GLU GLU A . n A 1 202 ASN 202 185 185 ASN ASN A . n A 1 203 GLY 203 186 186 GLY GLY A . n A 1 204 GLY 204 187 187 GLY GLY A . n A 1 205 TRP 205 188 188 TRP TRP A . n A 1 206 ASP 206 189 189 ASP ASP A . n A 1 207 THR 207 190 190 THR THR A . n A 1 208 PHE 208 191 191 PHE PHE A . n A 1 209 VAL 209 192 192 VAL VAL A . n A 1 210 GLU 210 193 193 GLU GLU A . n A 1 211 LEU 211 194 194 LEU LEU A . n A 1 212 TYR 212 195 195 TYR TYR A . n A 1 213 GLY 213 196 196 GLY GLY A . n A 1 214 ASN 214 197 197 ASN ASN A . n A 1 215 ASN 215 198 ? ? ? A . n A 1 216 ALA 216 199 ? ? ? A . n A 1 217 ALA 217 200 ? ? ? A . n A 1 218 ALA 218 201 ? ? ? A . n A 1 219 GLU 219 202 ? ? ? A . n A 1 220 SER 220 203 ? ? ? A . n A 1 221 ARG 221 204 ? ? ? A . n A 1 222 LYS 222 205 ? ? ? A . n A 1 223 GLY 223 206 ? ? ? A . n A 1 224 GLN 224 207 ? ? ? A . n A 1 225 GLU 225 208 ? ? ? A . n A 1 226 ARG 226 209 ? ? ? A . n A 1 227 PHE 227 210 ? ? ? A . n A 1 228 ASN 228 211 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 301 1 SO4 SO4 A . C 2 SO4 1 302 2 SO4 SO4 A . D 2 SO4 1 303 3 SO4 SO4 A . E 3 HOH 1 401 30 HOH HOH A . E 3 HOH 2 402 27 HOH HOH A . E 3 HOH 3 403 20 HOH HOH A . E 3 HOH 4 404 11 HOH HOH A . E 3 HOH 5 405 4 HOH HOH A . E 3 HOH 6 406 15 HOH HOH A . E 3 HOH 7 407 2 HOH HOH A . E 3 HOH 8 408 13 HOH HOH A . E 3 HOH 9 409 9 HOH HOH A . E 3 HOH 10 410 8 HOH HOH A . E 3 HOH 11 411 5 HOH HOH A . E 3 HOH 12 412 25 HOH HOH A . E 3 HOH 13 413 17 HOH HOH A . E 3 HOH 14 414 1 HOH HOH A . E 3 HOH 15 415 21 HOH HOH A . E 3 HOH 16 416 18 HOH HOH A . E 3 HOH 17 417 23 HOH HOH A . E 3 HOH 18 418 19 HOH HOH A . E 3 HOH 19 419 7 HOH HOH A . E 3 HOH 20 420 6 HOH HOH A . E 3 HOH 21 421 10 HOH HOH A . E 3 HOH 22 422 28 HOH HOH A . E 3 HOH 23 423 3 HOH HOH A . E 3 HOH 24 424 29 HOH HOH A . E 3 HOH 25 425 12 HOH HOH A . E 3 HOH 26 426 14 HOH HOH A . E 3 HOH 27 427 16 HOH HOH A . E 3 HOH 28 428 22 HOH HOH A . E 3 HOH 29 429 24 HOH HOH A . E 3 HOH 30 430 26 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 210 ? 1 MORE -15 ? 1 'SSA (A^2)' 7330 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2020-07-08 2 'Structure model' 1 1 2022-02-09 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' database_2 3 2 'Structure model' struct 4 3 'Structure model' atom_type 5 3 'Structure model' chem_comp_atom 6 3 'Structure model' chem_comp_bond 7 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.title' 2 2 'Structure model' '_database_2.pdbx_DOI' 3 2 'Structure model' '_database_2.pdbx_database_accession' 4 2 'Structure model' '_struct.title' 5 3 'Structure model' '_atom_type.pdbx_N_electrons' 6 3 'Structure model' '_atom_type.pdbx_scat_Z' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 7CA4 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 26 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -69.38 _pdbx_validate_torsion.psi 40.62 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -16 ? A MET 1 2 1 Y 1 A GLY -15 ? A GLY 2 3 1 Y 1 A GLY -14 ? A GLY 3 4 1 Y 1 A SER -13 ? A SER 4 5 1 Y 1 A HIS -12 ? A HIS 5 6 1 Y 1 A HIS -11 ? A HIS 6 7 1 Y 1 A HIS -10 ? A HIS 7 8 1 Y 1 A HIS -9 ? A HIS 8 9 1 Y 1 A HIS -8 ? A HIS 9 10 1 Y 1 A HIS -7 ? A HIS 10 11 1 Y 1 A GLU -6 ? A GLU 11 12 1 Y 1 A ASN -5 ? A ASN 12 13 1 Y 1 A LEU -4 ? A LEU 13 14 1 Y 1 A TYR -3 ? A TYR 14 15 1 Y 1 A PHE -2 ? A PHE 15 16 1 Y 1 A GLN -1 ? A GLN 16 17 1 Y 1 A GLY 0 ? A GLY 17 18 1 Y 1 A SER 28 ? A SER 45 19 1 Y 1 A ASP 29 ? A ASP 46 20 1 Y 1 A VAL 30 ? A VAL 47 21 1 Y 1 A GLU 31 ? A GLU 48 22 1 Y 1 A GLU 32 ? A GLU 49 23 1 Y 1 A ASN 33 ? A ASN 50 24 1 Y 1 A ARG 34 ? A ARG 51 25 1 Y 1 A THR 35 ? A THR 52 26 1 Y 1 A GLU 36 ? A GLU 53 27 1 Y 1 A ALA 37 ? A ALA 54 28 1 Y 1 A PRO 38 ? A PRO 55 29 1 Y 1 A GLU 39 ? A GLU 56 30 1 Y 1 A GLY 40 ? A GLY 57 31 1 Y 1 A THR 41 ? A THR 58 32 1 Y 1 A GLU 42 ? A GLU 59 33 1 Y 1 A SER 43 ? A SER 60 34 1 Y 1 A GLU 44 ? A GLU 61 35 1 Y 1 A MET 45 ? A MET 62 36 1 Y 1 A GLU 46 ? A GLU 63 37 1 Y 1 A THR 47 ? A THR 64 38 1 Y 1 A PRO 48 ? A PRO 65 39 1 Y 1 A SER 49 ? A SER 66 40 1 Y 1 A ALA 50 ? A ALA 67 41 1 Y 1 A ILE 51 ? A ILE 68 42 1 Y 1 A ASN 52 ? A ASN 69 43 1 Y 1 A GLY 53 ? A GLY 70 44 1 Y 1 A ASN 54 ? A ASN 71 45 1 Y 1 A PRO 55 ? A PRO 72 46 1 Y 1 A SER 56 ? A SER 73 47 1 Y 1 A TRP 57 ? A TRP 74 48 1 Y 1 A HIS 58 ? A HIS 75 49 1 Y 1 A LEU 59 ? A LEU 76 50 1 Y 1 A ALA 60 ? A ALA 77 51 1 Y 1 A ASP 61 ? A ASP 78 52 1 Y 1 A SER 62 ? A SER 79 53 1 Y 1 A PRO 63 ? A PRO 80 54 1 Y 1 A ALA 64 ? A ALA 81 55 1 Y 1 A VAL 65 ? A VAL 82 56 1 Y 1 A ASN 66 ? A ASN 83 57 1 Y 1 A GLY 67 ? A GLY 84 58 1 Y 1 A ALA 68 ? A ALA 85 59 1 Y 1 A THR 69 ? A THR 86 60 1 Y 1 A GLY 70 ? A GLY 87 61 1 Y 1 A HIS 71 ? A HIS 88 62 1 Y 1 A SER 72 ? A SER 89 63 1 Y 1 A SER 73 ? A SER 90 64 1 Y 1 A SER 74 ? A SER 91 65 1 Y 1 A LEU 75 ? A LEU 92 66 1 Y 1 A ASP 76 ? A ASP 93 67 1 Y 1 A ALA 77 ? A ALA 94 68 1 Y 1 A ARG 78 ? A ARG 95 69 1 Y 1 A GLU 79 ? A GLU 96 70 1 Y 1 A VAL 80 ? A VAL 97 71 1 Y 1 A ILE 81 ? A ILE 98 72 1 Y 1 A ASN 198 ? A ASN 215 73 1 Y 1 A ALA 199 ? A ALA 216 74 1 Y 1 A ALA 200 ? A ALA 217 75 1 Y 1 A ALA 201 ? A ALA 218 76 1 Y 1 A GLU 202 ? A GLU 219 77 1 Y 1 A SER 203 ? A SER 220 78 1 Y 1 A ARG 204 ? A ARG 221 79 1 Y 1 A LYS 205 ? A LYS 222 80 1 Y 1 A GLY 206 ? A GLY 223 81 1 Y 1 A GLN 207 ? A GLN 224 82 1 Y 1 A GLU 208 ? A GLU 225 83 1 Y 1 A ARG 209 ? A ARG 226 84 1 Y 1 A PHE 210 ? A PHE 227 85 1 Y 1 A ASN 211 ? A ASN 228 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 SO4 S S N N 304 SO4 O1 O N N 305 SO4 O2 O N N 306 SO4 O3 O N N 307 SO4 O4 O N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3CVA _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #