data_7CFI # _entry.id 7CFI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7CFI pdb_00007cfi 10.2210/pdb7cfi/pdb WWPDB D_1300017517 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7CFI _pdbx_database_status.recvd_initial_deposition_date 2020-06-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Huang, Y.' 1 ? 'Jin, F.' 2 ? 'Hattori, M.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Adv' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2375-2548 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural basis for the Mg 2+ recognition and regulation of the CorC Mg 2+ transporter.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/sciadv.abe6140 _citation.pdbx_database_id_PubMed 33568487 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huang, Y.' 1 0000-0001-6964-3993 primary 'Jin, F.' 2 0000-0001-9961-1423 primary 'Funato, Y.' 3 0000-0002-4288-7717 primary 'Xu, Z.' 4 0000-0002-3063-8473 primary 'Zhu, W.' 5 0000-0001-6699-5299 primary 'Wang, J.' 6 ? primary 'Sun, M.' 7 ? primary 'Zhao, Y.' 8 0000-0002-8913-3568 primary 'Yu, Y.' 9 ? primary 'Miki, H.' 10 0000-0003-0454-7006 primary 'Hattori, M.' 11 0000-0002-5327-5337 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7CFI _cell.details ? _cell.formula_units_Z ? _cell.length_a 61.890 _cell.length_a_esd ? _cell.length_b 87.300 _cell.length_b_esd ? _cell.length_c 201.970 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7CFI _symmetry.cell_setting ? _symmetry.Int_Tables_number 22 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'F 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Hemolysin 16404.643 1 ? ? ? ? 2 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE" 507.181 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 4 water nat water 18.015 9 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PQEEEMIHSILELEETPVREIMTPRVEMVAIEDEATLEDLLALYREHRYSRVPVYRESVDHIVGVAYAKDLLDYYCEEDL KGRTVASITHPPYFVPENMDAWSLLKELRRRKVHMAIVVDEFGGTAGLVTLEDVIEEIVGEI ; _entity_poly.pdbx_seq_one_letter_code_can ;PQEEEMIHSILELEETPVREIMTPRVEMVAIEDEATLEDLLALYREHRYSRVPVYRESVDHIVGVAYAKDLLDYYCEEDL KGRTVASITHPPYFVPENMDAWSLLKELRRRKVHMAIVVDEFGGTAGLVTLEDVIEEIVGEI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 GLN n 1 3 GLU n 1 4 GLU n 1 5 GLU n 1 6 MET n 1 7 ILE n 1 8 HIS n 1 9 SER n 1 10 ILE n 1 11 LEU n 1 12 GLU n 1 13 LEU n 1 14 GLU n 1 15 GLU n 1 16 THR n 1 17 PRO n 1 18 VAL n 1 19 ARG n 1 20 GLU n 1 21 ILE n 1 22 MET n 1 23 THR n 1 24 PRO n 1 25 ARG n 1 26 VAL n 1 27 GLU n 1 28 MET n 1 29 VAL n 1 30 ALA n 1 31 ILE n 1 32 GLU n 1 33 ASP n 1 34 GLU n 1 35 ALA n 1 36 THR n 1 37 LEU n 1 38 GLU n 1 39 ASP n 1 40 LEU n 1 41 LEU n 1 42 ALA n 1 43 LEU n 1 44 TYR n 1 45 ARG n 1 46 GLU n 1 47 HIS n 1 48 ARG n 1 49 TYR n 1 50 SER n 1 51 ARG n 1 52 VAL n 1 53 PRO n 1 54 VAL n 1 55 TYR n 1 56 ARG n 1 57 GLU n 1 58 SER n 1 59 VAL n 1 60 ASP n 1 61 HIS n 1 62 ILE n 1 63 VAL n 1 64 GLY n 1 65 VAL n 1 66 ALA n 1 67 TYR n 1 68 ALA n 1 69 LYS n 1 70 ASP n 1 71 LEU n 1 72 LEU n 1 73 ASP n 1 74 TYR n 1 75 TYR n 1 76 CYS n 1 77 GLU n 1 78 GLU n 1 79 ASP n 1 80 LEU n 1 81 LYS n 1 82 GLY n 1 83 ARG n 1 84 THR n 1 85 VAL n 1 86 ALA n 1 87 SER n 1 88 ILE n 1 89 THR n 1 90 HIS n 1 91 PRO n 1 92 PRO n 1 93 TYR n 1 94 PHE n 1 95 VAL n 1 96 PRO n 1 97 GLU n 1 98 ASN n 1 99 MET n 1 100 ASP n 1 101 ALA n 1 102 TRP n 1 103 SER n 1 104 LEU n 1 105 LEU n 1 106 LYS n 1 107 GLU n 1 108 LEU n 1 109 ARG n 1 110 ARG n 1 111 ARG n 1 112 LYS n 1 113 VAL n 1 114 HIS n 1 115 MET n 1 116 ALA n 1 117 ILE n 1 118 VAL n 1 119 VAL n 1 120 ASP n 1 121 GLU n 1 122 PHE n 1 123 GLY n 1 124 GLY n 1 125 THR n 1 126 ALA n 1 127 GLY n 1 128 LEU n 1 129 VAL n 1 130 THR n 1 131 LEU n 1 132 GLU n 1 133 ASP n 1 134 VAL n 1 135 ILE n 1 136 GLU n 1 137 GLU n 1 138 ILE n 1 139 VAL n 1 140 GLY n 1 141 GLU n 1 142 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 142 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene AV541_07030 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus parvatiensis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 456163 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A109QFA5_9DEIN _struct_ref.pdbx_db_accession A0A109QFA5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PQEEEMIHSILELEETPVREIMTPRVEMVAIEDEATLEDLLALYREHRYSRVPVYRESVDHIVGVAYAKDLLDYYCEEDL KGRTVASITHPPYFVPENMDAWSLLKELRRRKVHMAIVVDEFGGTAGLVTLEDVIEEIVGEI ; _struct_ref.pdbx_align_begin 207 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7CFI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 142 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A109QFA5 _struct_ref_seq.db_align_beg 207 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 348 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 207 _struct_ref_seq.pdbx_auth_seq_align_end 348 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 ATP non-polymer . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7CFI _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.16 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 66.87 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M CaCl2, 0.1 M HEPES pH 7.5 and 5% PEG 8000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-10-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL32XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL32XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate 66.48 _reflns.entry_id 7CFI _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.45 _reflns.d_resolution_low 43.65 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10115 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.45 _reflns_shell.d_res_low 2.65 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1293 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.515 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7CFI _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.45 _refine.ls_d_res_low 43.65 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10115 _refine.ls_number_reflns_R_free 1012 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.18 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2466 _refine.ls_R_factor_R_free 0.2591 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2453 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7CFH _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.40 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.32 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.45 _refine_hist.d_res_low 43.65 _refine_hist.number_atoms_solvent 7 _refine_hist.number_atoms_total 1096 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1054 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 35 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 ? 1109 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.903 ? 1522 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 18.196 ? 169 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.049 ? 180 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 191 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.45 2.58 . . 144 1293 99.00 . . . 0.3254 . 0.2898 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.58 2.74 . . 141 1285 99.00 . . . 0.3320 . 0.2909 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.74 2.95 . . 145 1301 99.00 . . . 0.3092 . 0.2951 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.95 3.25 . . 143 1286 98.00 . . . 0.3107 . 0.2628 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.25 3.72 . . 143 1282 97.00 . . . 0.2999 . 0.2590 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.72 4.68 . . 145 1303 98.00 . . . 0.2441 . 0.2229 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.69 43.65 . . 151 1353 96.00 . . . 0.2212 . 0.2341 . . . . . . . . . . . # _struct.entry_id 7CFI _struct.title 'Structure of the CBS domain of the bacterial CNNM/CorC family Mg2+ transporter in complex with ATP' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7CFI _struct_keywords.text 'transporter, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 2 ? GLU A 12 ? GLN A 208 GLU A 218 1 ? 11 HELX_P HELX_P2 AA2 LEU A 13 ? THR A 16 ? LEU A 219 THR A 222 5 ? 4 HELX_P HELX_P3 AA3 PRO A 17 ? ILE A 21 ? PRO A 223 ILE A 227 5 ? 5 HELX_P HELX_P4 AA4 VAL A 26 ? MET A 28 ? VAL A 232 MET A 234 5 ? 3 HELX_P HELX_P5 AA5 THR A 36 ? ARG A 48 ? THR A 242 ARG A 254 1 ? 13 HELX_P HELX_P6 AA6 LYS A 69 ? TYR A 74 ? LYS A 275 TYR A 280 5 ? 6 HELX_P HELX_P7 AA7 GLU A 78 ? ARG A 83 ? GLU A 284 ARG A 289 1 ? 6 HELX_P HELX_P8 AA8 THR A 84 ? THR A 89 ? THR A 290 THR A 295 5 ? 6 HELX_P HELX_P9 AA9 ASP A 100 ? LYS A 112 ? ASP A 306 LYS A 318 1 ? 13 HELX_P HELX_P10 AB1 LEU A 131 ? GLY A 140 ? LEU A 337 GLY A 346 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 76 SG ? ? ? 1_555 A CYS 76 SG ? ? A CYS 282 A CYS 282 14_455 ? ? ? ? ? ? ? 2.036 ? ? metalc1 metalc ? ? A GLU 132 OE2 ? ? ? 1_555 C MG . MG ? ? A GLU 338 A MG 402 1_555 ? ? ? ? ? ? ? 2.203 ? ? metalc2 metalc ? ? A GLU 136 OE2 ? ? ? 1_555 C MG . MG ? ? A GLU 342 A MG 402 1_555 ? ? ? ? ? ? ? 2.232 ? ? metalc3 metalc ? ? A ILE 142 O ? ? ? 1_555 C MG . MG ? ? A ILE 348 A MG 402 1_555 ? ? ? ? ? ? ? 2.930 ? ? metalc4 metalc ? ? B ATP . O2G ? ? ? 1_555 D MG . MG ? ? A ATP 401 A MG 403 1_555 ? ? ? ? ? ? ? 2.763 ? ? metalc5 metalc ? ? B ATP . O1B ? ? ? 1_555 D MG . MG ? ? A ATP 401 A MG 403 1_555 ? ? ? ? ? ? ? 2.854 ? ? metalc6 metalc ? ? B ATP . O1A ? ? ? 1_555 D MG . MG ? ? A ATP 401 A MG 403 1_555 ? ? ? ? ? ? ? 2.985 ? ? metalc7 metalc ? ? D MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 403 A HOH 501 1_555 ? ? ? ? ? ? ? 2.180 ? ? metalc8 metalc ? ? D MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 403 A HOH 508 1_555 ? ? ? ? ? ? ? 2.181 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 23 ? PRO A 24 ? THR A 229 PRO A 230 AA1 2 THR A 125 ? THR A 130 ? THR A 331 THR A 336 AA1 3 MET A 115 ? VAL A 119 ? MET A 321 VAL A 325 AA1 4 PHE A 94 ? PRO A 96 ? PHE A 300 PRO A 302 AA2 1 ILE A 31 ? GLU A 32 ? ILE A 237 GLU A 238 AA2 2 ARG A 51 ? TYR A 55 ? ARG A 257 TYR A 261 AA2 3 ILE A 62 ? TYR A 67 ? ILE A 268 TYR A 273 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 23 ? N THR A 229 O LEU A 128 ? O LEU A 334 AA1 2 3 O VAL A 129 ? O VAL A 335 N ALA A 116 ? N ALA A 322 AA1 3 4 O ILE A 117 ? O ILE A 323 N VAL A 95 ? N VAL A 301 AA2 1 2 N ILE A 31 ? N ILE A 237 O TYR A 55 ? O TYR A 261 AA2 2 3 N VAL A 54 ? N VAL A 260 O VAL A 63 ? O VAL A 269 # _atom_sites.entry_id 7CFI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.016158 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011455 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004951 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? 9.41153 2.53737 ? ? 2.59044 63.03566 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 207 207 PRO PRO A . n A 1 2 GLN 2 208 208 GLN GLN A . n A 1 3 GLU 3 209 209 GLU GLU A . n A 1 4 GLU 4 210 210 GLU GLU A . n A 1 5 GLU 5 211 211 GLU GLU A . n A 1 6 MET 6 212 212 MET MET A . n A 1 7 ILE 7 213 213 ILE ILE A . n A 1 8 HIS 8 214 214 HIS HIS A . n A 1 9 SER 9 215 215 SER SER A . n A 1 10 ILE 10 216 216 ILE ILE A . n A 1 11 LEU 11 217 217 LEU LEU A . n A 1 12 GLU 12 218 218 GLU GLU A . n A 1 13 LEU 13 219 219 LEU LEU A . n A 1 14 GLU 14 220 220 GLU GLU A . n A 1 15 GLU 15 221 221 GLU GLU A . n A 1 16 THR 16 222 222 THR THR A . n A 1 17 PRO 17 223 223 PRO PRO A . n A 1 18 VAL 18 224 224 VAL VAL A . n A 1 19 ARG 19 225 225 ARG ARG A . n A 1 20 GLU 20 226 226 GLU GLU A . n A 1 21 ILE 21 227 227 ILE ILE A . n A 1 22 MET 22 228 228 MET MET A . n A 1 23 THR 23 229 229 THR THR A . n A 1 24 PRO 24 230 230 PRO PRO A . n A 1 25 ARG 25 231 231 ARG ARG A . n A 1 26 VAL 26 232 232 VAL VAL A . n A 1 27 GLU 27 233 233 GLU GLU A . n A 1 28 MET 28 234 234 MET MET A . n A 1 29 VAL 29 235 235 VAL VAL A . n A 1 30 ALA 30 236 236 ALA ALA A . n A 1 31 ILE 31 237 237 ILE ILE A . n A 1 32 GLU 32 238 238 GLU GLU A . n A 1 33 ASP 33 239 239 ASP ASP A . n A 1 34 GLU 34 240 240 GLU GLU A . n A 1 35 ALA 35 241 241 ALA ALA A . n A 1 36 THR 36 242 242 THR THR A . n A 1 37 LEU 37 243 243 LEU LEU A . n A 1 38 GLU 38 244 244 GLU GLU A . n A 1 39 ASP 39 245 245 ASP ASP A . n A 1 40 LEU 40 246 246 LEU LEU A . n A 1 41 LEU 41 247 247 LEU LEU A . n A 1 42 ALA 42 248 248 ALA ALA A . n A 1 43 LEU 43 249 249 LEU LEU A . n A 1 44 TYR 44 250 250 TYR TYR A . n A 1 45 ARG 45 251 251 ARG ARG A . n A 1 46 GLU 46 252 252 GLU GLU A . n A 1 47 HIS 47 253 253 HIS HIS A . n A 1 48 ARG 48 254 254 ARG ARG A . n A 1 49 TYR 49 255 255 TYR TYR A . n A 1 50 SER 50 256 256 SER SER A . n A 1 51 ARG 51 257 257 ARG ARG A . n A 1 52 VAL 52 258 258 VAL VAL A . n A 1 53 PRO 53 259 259 PRO PRO A . n A 1 54 VAL 54 260 260 VAL VAL A . n A 1 55 TYR 55 261 261 TYR TYR A . n A 1 56 ARG 56 262 262 ARG ARG A . n A 1 57 GLU 57 263 263 GLU GLU A . n A 1 58 SER 58 264 264 SER SER A . n A 1 59 VAL 59 265 265 VAL VAL A . n A 1 60 ASP 60 266 266 ASP ASP A . n A 1 61 HIS 61 267 267 HIS HIS A . n A 1 62 ILE 62 268 268 ILE ILE A . n A 1 63 VAL 63 269 269 VAL VAL A . n A 1 64 GLY 64 270 270 GLY GLY A . n A 1 65 VAL 65 271 271 VAL VAL A . n A 1 66 ALA 66 272 272 ALA ALA A . n A 1 67 TYR 67 273 273 TYR TYR A . n A 1 68 ALA 68 274 274 ALA ALA A . n A 1 69 LYS 69 275 275 LYS LYS A . n A 1 70 ASP 70 276 276 ASP ASP A . n A 1 71 LEU 71 277 277 LEU LEU A . n A 1 72 LEU 72 278 278 LEU LEU A . n A 1 73 ASP 73 279 279 ASP ASP A . n A 1 74 TYR 74 280 280 TYR TYR A . n A 1 75 TYR 75 281 281 TYR TYR A . n A 1 76 CYS 76 282 282 CYS CYS A . n A 1 77 GLU 77 283 283 GLU GLU A . n A 1 78 GLU 78 284 284 GLU GLU A . n A 1 79 ASP 79 285 285 ASP ASP A . n A 1 80 LEU 80 286 286 LEU LEU A . n A 1 81 LYS 81 287 287 LYS LYS A . n A 1 82 GLY 82 288 288 GLY GLY A . n A 1 83 ARG 83 289 289 ARG ARG A . n A 1 84 THR 84 290 290 THR THR A . n A 1 85 VAL 85 291 291 VAL VAL A . n A 1 86 ALA 86 292 292 ALA ALA A . n A 1 87 SER 87 293 293 SER SER A . n A 1 88 ILE 88 294 294 ILE ILE A . n A 1 89 THR 89 295 295 THR THR A . n A 1 90 HIS 90 296 296 HIS HIS A . n A 1 91 PRO 91 297 297 PRO PRO A . n A 1 92 PRO 92 298 298 PRO PRO A . n A 1 93 TYR 93 299 299 TYR TYR A . n A 1 94 PHE 94 300 300 PHE PHE A . n A 1 95 VAL 95 301 301 VAL VAL A . n A 1 96 PRO 96 302 302 PRO PRO A . n A 1 97 GLU 97 303 303 GLU GLU A . n A 1 98 ASN 98 304 304 ASN ASN A . n A 1 99 MET 99 305 305 MET MET A . n A 1 100 ASP 100 306 306 ASP ASP A . n A 1 101 ALA 101 307 307 ALA ALA A . n A 1 102 TRP 102 308 308 TRP TRP A . n A 1 103 SER 103 309 309 SER SER A . n A 1 104 LEU 104 310 310 LEU LEU A . n A 1 105 LEU 105 311 311 LEU LEU A . n A 1 106 LYS 106 312 312 LYS LYS A . n A 1 107 GLU 107 313 313 GLU GLU A . n A 1 108 LEU 108 314 314 LEU LEU A . n A 1 109 ARG 109 315 315 ARG ARG A . n A 1 110 ARG 110 316 316 ARG ARG A . n A 1 111 ARG 111 317 317 ARG ARG A . n A 1 112 LYS 112 318 318 LYS LYS A . n A 1 113 VAL 113 319 319 VAL VAL A . n A 1 114 HIS 114 320 320 HIS HIS A . n A 1 115 MET 115 321 321 MET MET A . n A 1 116 ALA 116 322 322 ALA ALA A . n A 1 117 ILE 117 323 323 ILE ILE A . n A 1 118 VAL 118 324 324 VAL VAL A . n A 1 119 VAL 119 325 325 VAL VAL A . n A 1 120 ASP 120 326 326 ASP ASP A . n A 1 121 GLU 121 327 327 GLU GLU A . n A 1 122 PHE 122 328 328 PHE PHE A . n A 1 123 GLY 123 329 329 GLY GLY A . n A 1 124 GLY 124 330 330 GLY GLY A . n A 1 125 THR 125 331 331 THR THR A . n A 1 126 ALA 126 332 332 ALA ALA A . n A 1 127 GLY 127 333 333 GLY GLY A . n A 1 128 LEU 128 334 334 LEU LEU A . n A 1 129 VAL 129 335 335 VAL VAL A . n A 1 130 THR 130 336 336 THR THR A . n A 1 131 LEU 131 337 337 LEU LEU A . n A 1 132 GLU 132 338 338 GLU GLU A . n A 1 133 ASP 133 339 339 ASP ASP A . n A 1 134 VAL 134 340 340 VAL VAL A . n A 1 135 ILE 135 341 341 ILE ILE A . n A 1 136 GLU 136 342 342 GLU GLU A . n A 1 137 GLU 137 343 343 GLU GLU A . n A 1 138 ILE 138 344 344 ILE ILE A . n A 1 139 VAL 139 345 345 VAL VAL A . n A 1 140 GLY 140 346 346 GLY GLY A . n A 1 141 GLU 141 347 347 GLU GLU A . n A 1 142 ILE 142 348 348 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ATP 1 401 1 ATP ATP A . C 3 MG 1 402 2 MG MG A . D 3 MG 1 403 1 MG MO6 A . E 4 HOH 1 501 1 HOH MO6 A . E 4 HOH 2 502 1 HOH HOH A . E 4 HOH 3 503 6 HOH HOH A . E 4 HOH 4 504 3 HOH HOH A . E 4 HOH 5 505 2 HOH HOH A . E 4 HOH 6 506 5 HOH HOH A . E 4 HOH 7 507 7 HOH HOH A . E 4 HOH 8 508 1 HOH MO6 A . E 4 HOH 9 509 4 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4410 ? 1 MORE -54 ? 1 'SSA (A^2)' 13310 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 14_455 -x-1/2,-y+1/2,z -1.0000000000 0.0000000000 0.0000000000 -30.9450000000 0.0000000000 -1.0000000000 0.0000000000 43.6500000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 132 ? A GLU 338 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OE2 ? A GLU 136 ? A GLU 342 ? 1_555 79.3 ? 2 OE2 ? A GLU 132 ? A GLU 338 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? A ILE 142 ? A ILE 348 ? 1_555 86.2 ? 3 OE2 ? A GLU 136 ? A GLU 342 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? A ILE 142 ? A ILE 348 ? 1_555 90.1 ? 4 O2G ? B ATP . ? A ATP 401 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O1B ? B ATP . ? A ATP 401 ? 1_555 58.9 ? 5 O2G ? B ATP . ? A ATP 401 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O1A ? B ATP . ? A ATP 401 ? 1_555 62.9 ? 6 O1B ? B ATP . ? A ATP 401 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O1A ? B ATP . ? A ATP 401 ? 1_555 55.0 ? 7 O2G ? B ATP . ? A ATP 401 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? E HOH . ? A HOH 501 ? 1_555 67.3 ? 8 O1B ? B ATP . ? A ATP 401 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? E HOH . ? A HOH 501 ? 1_555 102.1 ? 9 O1A ? B ATP . ? A ATP 401 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? E HOH . ? A HOH 501 ? 1_555 51.9 ? 10 O2G ? B ATP . ? A ATP 401 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? E HOH . ? A HOH 508 ? 1_555 108.1 ? 11 O1B ? B ATP . ? A ATP 401 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? E HOH . ? A HOH 508 ? 1_555 73.5 ? 12 O1A ? B ATP . ? A ATP 401 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? E HOH . ? A HOH 508 ? 1_555 124.8 ? 13 O ? E HOH . ? A HOH 501 ? 1_555 MG ? D MG . ? A MG 403 ? 1_555 O ? E HOH . ? A HOH 508 ? 1_555 175.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-02-24 2 'Structure model' 1 1 2021-03-10 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' struct 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_struct.title' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z 4 -x,-y,z 5 x,y+1/2,z+1/2 6 x,-y+1/2,-z+1/2 7 -x,y+1/2,-z+1/2 8 -x,-y+1/2,z+1/2 9 x+1/2,y,z+1/2 10 x+1/2,-y,-z+1/2 11 -x+1/2,y,-z+1/2 12 -x+1/2,-y,z+1/2 13 x+1/2,y+1/2,z 14 x+1/2,-y+1/2,-z 15 -x+1/2,y+1/2,-z 16 -x+1/2,-y+1/2,z # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.18.2_3874: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 7CFI _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 338 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 501 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.01 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 262 ? ? -81.66 -81.84 2 1 GLU A 284 ? ? -155.71 -23.07 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 208 ? CD ? A GLN 2 CD 2 1 Y 1 A GLN 208 ? OE1 ? A GLN 2 OE1 3 1 Y 1 A GLN 208 ? NE2 ? A GLN 2 NE2 4 1 Y 1 A GLU 210 ? CG ? A GLU 4 CG 5 1 Y 1 A GLU 210 ? CD ? A GLU 4 CD 6 1 Y 1 A GLU 210 ? OE1 ? A GLU 4 OE1 7 1 Y 1 A GLU 210 ? OE2 ? A GLU 4 OE2 8 1 Y 1 A GLU 211 ? CG ? A GLU 5 CG 9 1 Y 1 A GLU 211 ? CD ? A GLU 5 CD 10 1 Y 1 A GLU 211 ? OE1 ? A GLU 5 OE1 11 1 Y 1 A GLU 211 ? OE2 ? A GLU 5 OE2 12 1 Y 1 A ILE 213 ? CG1 ? A ILE 7 CG1 13 1 Y 1 A ILE 213 ? CG2 ? A ILE 7 CG2 14 1 Y 1 A ILE 213 ? CD1 ? A ILE 7 CD1 15 1 Y 1 A HIS 214 ? CG ? A HIS 8 CG 16 1 Y 1 A HIS 214 ? ND1 ? A HIS 8 ND1 17 1 Y 1 A HIS 214 ? CD2 ? A HIS 8 CD2 18 1 Y 1 A HIS 214 ? CE1 ? A HIS 8 CE1 19 1 Y 1 A HIS 214 ? NE2 ? A HIS 8 NE2 20 1 Y 1 A ILE 216 ? CG1 ? A ILE 10 CG1 21 1 Y 1 A ILE 216 ? CG2 ? A ILE 10 CG2 22 1 Y 1 A ILE 216 ? CD1 ? A ILE 10 CD1 23 1 Y 1 A LEU 217 ? CG ? A LEU 11 CG 24 1 Y 1 A LEU 217 ? CD1 ? A LEU 11 CD1 25 1 Y 1 A LEU 217 ? CD2 ? A LEU 11 CD2 26 1 Y 1 A LEU 219 ? CD1 ? A LEU 13 CD1 27 1 Y 1 A LEU 219 ? CD2 ? A LEU 13 CD2 28 1 Y 1 A GLU 220 ? CG ? A GLU 14 CG 29 1 Y 1 A GLU 220 ? CD ? A GLU 14 CD 30 1 Y 1 A GLU 220 ? OE1 ? A GLU 14 OE1 31 1 Y 1 A GLU 220 ? OE2 ? A GLU 14 OE2 32 1 Y 1 A PRO 223 ? CG ? A PRO 17 CG 33 1 Y 1 A PRO 223 ? CD ? A PRO 17 CD 34 1 Y 1 A GLU 226 ? CG ? A GLU 20 CG 35 1 Y 1 A GLU 226 ? CD ? A GLU 20 CD 36 1 Y 1 A GLU 226 ? OE1 ? A GLU 20 OE1 37 1 Y 1 A GLU 226 ? OE2 ? A GLU 20 OE2 38 1 Y 1 A GLU 244 ? CG ? A GLU 38 CG 39 1 Y 1 A GLU 244 ? CD ? A GLU 38 CD 40 1 Y 1 A GLU 244 ? OE1 ? A GLU 38 OE1 41 1 Y 1 A GLU 244 ? OE2 ? A GLU 38 OE2 42 1 Y 1 A GLU 252 ? CG ? A GLU 46 CG 43 1 Y 1 A GLU 252 ? CD ? A GLU 46 CD 44 1 Y 1 A GLU 252 ? OE1 ? A GLU 46 OE1 45 1 Y 1 A GLU 252 ? OE2 ? A GLU 46 OE2 46 1 Y 1 A GLU 263 ? CG ? A GLU 57 CG 47 1 Y 1 A GLU 263 ? CD ? A GLU 57 CD 48 1 Y 1 A GLU 263 ? OE1 ? A GLU 57 OE1 49 1 Y 1 A GLU 263 ? OE2 ? A GLU 57 OE2 50 1 Y 1 A LYS 275 ? CG ? A LYS 69 CG 51 1 Y 1 A LYS 275 ? CD ? A LYS 69 CD 52 1 Y 1 A LYS 275 ? CE ? A LYS 69 CE 53 1 Y 1 A LYS 275 ? NZ ? A LYS 69 NZ 54 1 Y 1 A GLU 283 ? CG ? A GLU 77 CG 55 1 Y 1 A GLU 283 ? CD ? A GLU 77 CD 56 1 Y 1 A GLU 283 ? OE1 ? A GLU 77 OE1 57 1 Y 1 A GLU 283 ? OE2 ? A GLU 77 OE2 58 1 Y 1 A GLU 284 ? CG ? A GLU 78 CG 59 1 Y 1 A GLU 284 ? CD ? A GLU 78 CD 60 1 Y 1 A GLU 284 ? OE1 ? A GLU 78 OE1 61 1 Y 1 A GLU 284 ? OE2 ? A GLU 78 OE2 62 1 Y 1 A LYS 287 ? CG ? A LYS 81 CG 63 1 Y 1 A LYS 287 ? CD ? A LYS 81 CD 64 1 Y 1 A LYS 287 ? CE ? A LYS 81 CE 65 1 Y 1 A LYS 287 ? NZ ? A LYS 81 NZ 66 1 Y 1 A ARG 289 ? CG ? A ARG 83 CG 67 1 Y 1 A ARG 289 ? CD ? A ARG 83 CD 68 1 Y 1 A ARG 289 ? NE ? A ARG 83 NE 69 1 Y 1 A ARG 289 ? CZ ? A ARG 83 CZ 70 1 Y 1 A ARG 289 ? NH1 ? A ARG 83 NH1 71 1 Y 1 A ARG 289 ? NH2 ? A ARG 83 NH2 72 1 Y 1 A LYS 312 ? CG ? A LYS 106 CG 73 1 Y 1 A LYS 312 ? CD ? A LYS 106 CD 74 1 Y 1 A LYS 312 ? CE ? A LYS 106 CE 75 1 Y 1 A LYS 312 ? NZ ? A LYS 106 NZ 76 1 Y 1 A ARG 315 ? CG ? A ARG 109 CG 77 1 Y 1 A ARG 315 ? CD ? A ARG 109 CD 78 1 Y 1 A ARG 315 ? NE ? A ARG 109 NE 79 1 Y 1 A ARG 315 ? CZ ? A ARG 109 CZ 80 1 Y 1 A ARG 315 ? NH1 ? A ARG 109 NH1 81 1 Y 1 A ARG 315 ? NH2 ? A ARG 109 NH2 82 1 Y 1 A LYS 318 ? CG ? A LYS 112 CG 83 1 Y 1 A LYS 318 ? CD ? A LYS 112 CD 84 1 Y 1 A LYS 318 ? CE ? A LYS 112 CE 85 1 Y 1 A LYS 318 ? NZ ? A LYS 112 NZ 86 1 Y 1 A VAL 319 ? CG1 ? A VAL 113 CG1 87 1 Y 1 A VAL 319 ? CG2 ? A VAL 113 CG2 88 1 Y 1 A VAL 324 ? CG1 ? A VAL 118 CG1 89 1 Y 1 A VAL 324 ? CG2 ? A VAL 118 CG2 90 1 Y 1 A LEU 337 ? CG ? A LEU 131 CG 91 1 Y 1 A LEU 337 ? CD1 ? A LEU 131 CD1 92 1 Y 1 A LEU 337 ? CD2 ? A LEU 131 CD2 93 1 Y 1 A GLU 347 ? CG ? A GLU 141 CG 94 1 Y 1 A GLU 347 ? CD ? A GLU 141 CD 95 1 Y 1 A GLU 347 ? OE1 ? A GLU 141 OE1 96 1 Y 1 A GLU 347 ? OE2 ? A GLU 141 OE2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 ATP PG P N N 74 ATP O1G O N N 75 ATP O2G O N N 76 ATP O3G O N N 77 ATP PB P N R 78 ATP O1B O N N 79 ATP O2B O N N 80 ATP O3B O N N 81 ATP PA P N R 82 ATP O1A O N N 83 ATP O2A O N N 84 ATP O3A O N N 85 ATP "O5'" O N N 86 ATP "C5'" C N N 87 ATP "C4'" C N R 88 ATP "O4'" O N N 89 ATP "C3'" C N S 90 ATP "O3'" O N N 91 ATP "C2'" C N R 92 ATP "O2'" O N N 93 ATP "C1'" C N R 94 ATP N9 N Y N 95 ATP C8 C Y N 96 ATP N7 N Y N 97 ATP C5 C Y N 98 ATP C6 C Y N 99 ATP N6 N N N 100 ATP N1 N Y N 101 ATP C2 C Y N 102 ATP N3 N Y N 103 ATP C4 C Y N 104 ATP HOG2 H N N 105 ATP HOG3 H N N 106 ATP HOB2 H N N 107 ATP HOA2 H N N 108 ATP "H5'1" H N N 109 ATP "H5'2" H N N 110 ATP "H4'" H N N 111 ATP "H3'" H N N 112 ATP "HO3'" H N N 113 ATP "H2'" H N N 114 ATP "HO2'" H N N 115 ATP "H1'" H N N 116 ATP H8 H N N 117 ATP HN61 H N N 118 ATP HN62 H N N 119 ATP H2 H N N 120 CYS N N N N 121 CYS CA C N R 122 CYS C C N N 123 CYS O O N N 124 CYS CB C N N 125 CYS SG S N N 126 CYS OXT O N N 127 CYS H H N N 128 CYS H2 H N N 129 CYS HA H N N 130 CYS HB2 H N N 131 CYS HB3 H N N 132 CYS HG H N N 133 CYS HXT H N N 134 GLN N N N N 135 GLN CA C N S 136 GLN C C N N 137 GLN O O N N 138 GLN CB C N N 139 GLN CG C N N 140 GLN CD C N N 141 GLN OE1 O N N 142 GLN NE2 N N N 143 GLN OXT O N N 144 GLN H H N N 145 GLN H2 H N N 146 GLN HA H N N 147 GLN HB2 H N N 148 GLN HB3 H N N 149 GLN HG2 H N N 150 GLN HG3 H N N 151 GLN HE21 H N N 152 GLN HE22 H N N 153 GLN HXT H N N 154 GLU N N N N 155 GLU CA C N S 156 GLU C C N N 157 GLU O O N N 158 GLU CB C N N 159 GLU CG C N N 160 GLU CD C N N 161 GLU OE1 O N N 162 GLU OE2 O N N 163 GLU OXT O N N 164 GLU H H N N 165 GLU H2 H N N 166 GLU HA H N N 167 GLU HB2 H N N 168 GLU HB3 H N N 169 GLU HG2 H N N 170 GLU HG3 H N N 171 GLU HE2 H N N 172 GLU HXT H N N 173 GLY N N N N 174 GLY CA C N N 175 GLY C C N N 176 GLY O O N N 177 GLY OXT O N N 178 GLY H H N N 179 GLY H2 H N N 180 GLY HA2 H N N 181 GLY HA3 H N N 182 GLY HXT H N N 183 HIS N N N N 184 HIS CA C N S 185 HIS C C N N 186 HIS O O N N 187 HIS CB C N N 188 HIS CG C Y N 189 HIS ND1 N Y N 190 HIS CD2 C Y N 191 HIS CE1 C Y N 192 HIS NE2 N Y N 193 HIS OXT O N N 194 HIS H H N N 195 HIS H2 H N N 196 HIS HA H N N 197 HIS HB2 H N N 198 HIS HB3 H N N 199 HIS HD1 H N N 200 HIS HD2 H N N 201 HIS HE1 H N N 202 HIS HE2 H N N 203 HIS HXT H N N 204 HOH O O N N 205 HOH H1 H N N 206 HOH H2 H N N 207 ILE N N N N 208 ILE CA C N S 209 ILE C C N N 210 ILE O O N N 211 ILE CB C N S 212 ILE CG1 C N N 213 ILE CG2 C N N 214 ILE CD1 C N N 215 ILE OXT O N N 216 ILE H H N N 217 ILE H2 H N N 218 ILE HA H N N 219 ILE HB H N N 220 ILE HG12 H N N 221 ILE HG13 H N N 222 ILE HG21 H N N 223 ILE HG22 H N N 224 ILE HG23 H N N 225 ILE HD11 H N N 226 ILE HD12 H N N 227 ILE HD13 H N N 228 ILE HXT H N N 229 LEU N N N N 230 LEU CA C N S 231 LEU C C N N 232 LEU O O N N 233 LEU CB C N N 234 LEU CG C N N 235 LEU CD1 C N N 236 LEU CD2 C N N 237 LEU OXT O N N 238 LEU H H N N 239 LEU H2 H N N 240 LEU HA H N N 241 LEU HB2 H N N 242 LEU HB3 H N N 243 LEU HG H N N 244 LEU HD11 H N N 245 LEU HD12 H N N 246 LEU HD13 H N N 247 LEU HD21 H N N 248 LEU HD22 H N N 249 LEU HD23 H N N 250 LEU HXT H N N 251 LYS N N N N 252 LYS CA C N S 253 LYS C C N N 254 LYS O O N N 255 LYS CB C N N 256 LYS CG C N N 257 LYS CD C N N 258 LYS CE C N N 259 LYS NZ N N N 260 LYS OXT O N N 261 LYS H H N N 262 LYS H2 H N N 263 LYS HA H N N 264 LYS HB2 H N N 265 LYS HB3 H N N 266 LYS HG2 H N N 267 LYS HG3 H N N 268 LYS HD2 H N N 269 LYS HD3 H N N 270 LYS HE2 H N N 271 LYS HE3 H N N 272 LYS HZ1 H N N 273 LYS HZ2 H N N 274 LYS HZ3 H N N 275 LYS HXT H N N 276 MET N N N N 277 MET CA C N S 278 MET C C N N 279 MET O O N N 280 MET CB C N N 281 MET CG C N N 282 MET SD S N N 283 MET CE C N N 284 MET OXT O N N 285 MET H H N N 286 MET H2 H N N 287 MET HA H N N 288 MET HB2 H N N 289 MET HB3 H N N 290 MET HG2 H N N 291 MET HG3 H N N 292 MET HE1 H N N 293 MET HE2 H N N 294 MET HE3 H N N 295 MET HXT H N N 296 MG MG MG N N 297 PHE N N N N 298 PHE CA C N S 299 PHE C C N N 300 PHE O O N N 301 PHE CB C N N 302 PHE CG C Y N 303 PHE CD1 C Y N 304 PHE CD2 C Y N 305 PHE CE1 C Y N 306 PHE CE2 C Y N 307 PHE CZ C Y N 308 PHE OXT O N N 309 PHE H H N N 310 PHE H2 H N N 311 PHE HA H N N 312 PHE HB2 H N N 313 PHE HB3 H N N 314 PHE HD1 H N N 315 PHE HD2 H N N 316 PHE HE1 H N N 317 PHE HE2 H N N 318 PHE HZ H N N 319 PHE HXT H N N 320 PRO N N N N 321 PRO CA C N S 322 PRO C C N N 323 PRO O O N N 324 PRO CB C N N 325 PRO CG C N N 326 PRO CD C N N 327 PRO OXT O N N 328 PRO H H N N 329 PRO HA H N N 330 PRO HB2 H N N 331 PRO HB3 H N N 332 PRO HG2 H N N 333 PRO HG3 H N N 334 PRO HD2 H N N 335 PRO HD3 H N N 336 PRO HXT H N N 337 SER N N N N 338 SER CA C N S 339 SER C C N N 340 SER O O N N 341 SER CB C N N 342 SER OG O N N 343 SER OXT O N N 344 SER H H N N 345 SER H2 H N N 346 SER HA H N N 347 SER HB2 H N N 348 SER HB3 H N N 349 SER HG H N N 350 SER HXT H N N 351 THR N N N N 352 THR CA C N S 353 THR C C N N 354 THR O O N N 355 THR CB C N R 356 THR OG1 O N N 357 THR CG2 C N N 358 THR OXT O N N 359 THR H H N N 360 THR H2 H N N 361 THR HA H N N 362 THR HB H N N 363 THR HG1 H N N 364 THR HG21 H N N 365 THR HG22 H N N 366 THR HG23 H N N 367 THR HXT H N N 368 TRP N N N N 369 TRP CA C N S 370 TRP C C N N 371 TRP O O N N 372 TRP CB C N N 373 TRP CG C Y N 374 TRP CD1 C Y N 375 TRP CD2 C Y N 376 TRP NE1 N Y N 377 TRP CE2 C Y N 378 TRP CE3 C Y N 379 TRP CZ2 C Y N 380 TRP CZ3 C Y N 381 TRP CH2 C Y N 382 TRP OXT O N N 383 TRP H H N N 384 TRP H2 H N N 385 TRP HA H N N 386 TRP HB2 H N N 387 TRP HB3 H N N 388 TRP HD1 H N N 389 TRP HE1 H N N 390 TRP HE3 H N N 391 TRP HZ2 H N N 392 TRP HZ3 H N N 393 TRP HH2 H N N 394 TRP HXT H N N 395 TYR N N N N 396 TYR CA C N S 397 TYR C C N N 398 TYR O O N N 399 TYR CB C N N 400 TYR CG C Y N 401 TYR CD1 C Y N 402 TYR CD2 C Y N 403 TYR CE1 C Y N 404 TYR CE2 C Y N 405 TYR CZ C Y N 406 TYR OH O N N 407 TYR OXT O N N 408 TYR H H N N 409 TYR H2 H N N 410 TYR HA H N N 411 TYR HB2 H N N 412 TYR HB3 H N N 413 TYR HD1 H N N 414 TYR HD2 H N N 415 TYR HE1 H N N 416 TYR HE2 H N N 417 TYR HH H N N 418 TYR HXT H N N 419 VAL N N N N 420 VAL CA C N S 421 VAL C C N N 422 VAL O O N N 423 VAL CB C N N 424 VAL CG1 C N N 425 VAL CG2 C N N 426 VAL OXT O N N 427 VAL H H N N 428 VAL H2 H N N 429 VAL HA H N N 430 VAL HB H N N 431 VAL HG11 H N N 432 VAL HG12 H N N 433 VAL HG13 H N N 434 VAL HG21 H N N 435 VAL HG22 H N N 436 VAL HG23 H N N 437 VAL HXT H N N 438 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 ATP PG O1G doub N N 70 ATP PG O2G sing N N 71 ATP PG O3G sing N N 72 ATP PG O3B sing N N 73 ATP O2G HOG2 sing N N 74 ATP O3G HOG3 sing N N 75 ATP PB O1B doub N N 76 ATP PB O2B sing N N 77 ATP PB O3B sing N N 78 ATP PB O3A sing N N 79 ATP O2B HOB2 sing N N 80 ATP PA O1A doub N N 81 ATP PA O2A sing N N 82 ATP PA O3A sing N N 83 ATP PA "O5'" sing N N 84 ATP O2A HOA2 sing N N 85 ATP "O5'" "C5'" sing N N 86 ATP "C5'" "C4'" sing N N 87 ATP "C5'" "H5'1" sing N N 88 ATP "C5'" "H5'2" sing N N 89 ATP "C4'" "O4'" sing N N 90 ATP "C4'" "C3'" sing N N 91 ATP "C4'" "H4'" sing N N 92 ATP "O4'" "C1'" sing N N 93 ATP "C3'" "O3'" sing N N 94 ATP "C3'" "C2'" sing N N 95 ATP "C3'" "H3'" sing N N 96 ATP "O3'" "HO3'" sing N N 97 ATP "C2'" "O2'" sing N N 98 ATP "C2'" "C1'" sing N N 99 ATP "C2'" "H2'" sing N N 100 ATP "O2'" "HO2'" sing N N 101 ATP "C1'" N9 sing N N 102 ATP "C1'" "H1'" sing N N 103 ATP N9 C8 sing Y N 104 ATP N9 C4 sing Y N 105 ATP C8 N7 doub Y N 106 ATP C8 H8 sing N N 107 ATP N7 C5 sing Y N 108 ATP C5 C6 sing Y N 109 ATP C5 C4 doub Y N 110 ATP C6 N6 sing N N 111 ATP C6 N1 doub Y N 112 ATP N6 HN61 sing N N 113 ATP N6 HN62 sing N N 114 ATP N1 C2 sing Y N 115 ATP C2 N3 doub Y N 116 ATP C2 H2 sing N N 117 ATP N3 C4 sing Y N 118 CYS N CA sing N N 119 CYS N H sing N N 120 CYS N H2 sing N N 121 CYS CA C sing N N 122 CYS CA CB sing N N 123 CYS CA HA sing N N 124 CYS C O doub N N 125 CYS C OXT sing N N 126 CYS CB SG sing N N 127 CYS CB HB2 sing N N 128 CYS CB HB3 sing N N 129 CYS SG HG sing N N 130 CYS OXT HXT sing N N 131 GLN N CA sing N N 132 GLN N H sing N N 133 GLN N H2 sing N N 134 GLN CA C sing N N 135 GLN CA CB sing N N 136 GLN CA HA sing N N 137 GLN C O doub N N 138 GLN C OXT sing N N 139 GLN CB CG sing N N 140 GLN CB HB2 sing N N 141 GLN CB HB3 sing N N 142 GLN CG CD sing N N 143 GLN CG HG2 sing N N 144 GLN CG HG3 sing N N 145 GLN CD OE1 doub N N 146 GLN CD NE2 sing N N 147 GLN NE2 HE21 sing N N 148 GLN NE2 HE22 sing N N 149 GLN OXT HXT sing N N 150 GLU N CA sing N N 151 GLU N H sing N N 152 GLU N H2 sing N N 153 GLU CA C sing N N 154 GLU CA CB sing N N 155 GLU CA HA sing N N 156 GLU C O doub N N 157 GLU C OXT sing N N 158 GLU CB CG sing N N 159 GLU CB HB2 sing N N 160 GLU CB HB3 sing N N 161 GLU CG CD sing N N 162 GLU CG HG2 sing N N 163 GLU CG HG3 sing N N 164 GLU CD OE1 doub N N 165 GLU CD OE2 sing N N 166 GLU OE2 HE2 sing N N 167 GLU OXT HXT sing N N 168 GLY N CA sing N N 169 GLY N H sing N N 170 GLY N H2 sing N N 171 GLY CA C sing N N 172 GLY CA HA2 sing N N 173 GLY CA HA3 sing N N 174 GLY C O doub N N 175 GLY C OXT sing N N 176 GLY OXT HXT sing N N 177 HIS N CA sing N N 178 HIS N H sing N N 179 HIS N H2 sing N N 180 HIS CA C sing N N 181 HIS CA CB sing N N 182 HIS CA HA sing N N 183 HIS C O doub N N 184 HIS C OXT sing N N 185 HIS CB CG sing N N 186 HIS CB HB2 sing N N 187 HIS CB HB3 sing N N 188 HIS CG ND1 sing Y N 189 HIS CG CD2 doub Y N 190 HIS ND1 CE1 doub Y N 191 HIS ND1 HD1 sing N N 192 HIS CD2 NE2 sing Y N 193 HIS CD2 HD2 sing N N 194 HIS CE1 NE2 sing Y N 195 HIS CE1 HE1 sing N N 196 HIS NE2 HE2 sing N N 197 HIS OXT HXT sing N N 198 HOH O H1 sing N N 199 HOH O H2 sing N N 200 ILE N CA sing N N 201 ILE N H sing N N 202 ILE N H2 sing N N 203 ILE CA C sing N N 204 ILE CA CB sing N N 205 ILE CA HA sing N N 206 ILE C O doub N N 207 ILE C OXT sing N N 208 ILE CB CG1 sing N N 209 ILE CB CG2 sing N N 210 ILE CB HB sing N N 211 ILE CG1 CD1 sing N N 212 ILE CG1 HG12 sing N N 213 ILE CG1 HG13 sing N N 214 ILE CG2 HG21 sing N N 215 ILE CG2 HG22 sing N N 216 ILE CG2 HG23 sing N N 217 ILE CD1 HD11 sing N N 218 ILE CD1 HD12 sing N N 219 ILE CD1 HD13 sing N N 220 ILE OXT HXT sing N N 221 LEU N CA sing N N 222 LEU N H sing N N 223 LEU N H2 sing N N 224 LEU CA C sing N N 225 LEU CA CB sing N N 226 LEU CA HA sing N N 227 LEU C O doub N N 228 LEU C OXT sing N N 229 LEU CB CG sing N N 230 LEU CB HB2 sing N N 231 LEU CB HB3 sing N N 232 LEU CG CD1 sing N N 233 LEU CG CD2 sing N N 234 LEU CG HG sing N N 235 LEU CD1 HD11 sing N N 236 LEU CD1 HD12 sing N N 237 LEU CD1 HD13 sing N N 238 LEU CD2 HD21 sing N N 239 LEU CD2 HD22 sing N N 240 LEU CD2 HD23 sing N N 241 LEU OXT HXT sing N N 242 LYS N CA sing N N 243 LYS N H sing N N 244 LYS N H2 sing N N 245 LYS CA C sing N N 246 LYS CA CB sing N N 247 LYS CA HA sing N N 248 LYS C O doub N N 249 LYS C OXT sing N N 250 LYS CB CG sing N N 251 LYS CB HB2 sing N N 252 LYS CB HB3 sing N N 253 LYS CG CD sing N N 254 LYS CG HG2 sing N N 255 LYS CG HG3 sing N N 256 LYS CD CE sing N N 257 LYS CD HD2 sing N N 258 LYS CD HD3 sing N N 259 LYS CE NZ sing N N 260 LYS CE HE2 sing N N 261 LYS CE HE3 sing N N 262 LYS NZ HZ1 sing N N 263 LYS NZ HZ2 sing N N 264 LYS NZ HZ3 sing N N 265 LYS OXT HXT sing N N 266 MET N CA sing N N 267 MET N H sing N N 268 MET N H2 sing N N 269 MET CA C sing N N 270 MET CA CB sing N N 271 MET CA HA sing N N 272 MET C O doub N N 273 MET C OXT sing N N 274 MET CB CG sing N N 275 MET CB HB2 sing N N 276 MET CB HB3 sing N N 277 MET CG SD sing N N 278 MET CG HG2 sing N N 279 MET CG HG3 sing N N 280 MET SD CE sing N N 281 MET CE HE1 sing N N 282 MET CE HE2 sing N N 283 MET CE HE3 sing N N 284 MET OXT HXT sing N N 285 PHE N CA sing N N 286 PHE N H sing N N 287 PHE N H2 sing N N 288 PHE CA C sing N N 289 PHE CA CB sing N N 290 PHE CA HA sing N N 291 PHE C O doub N N 292 PHE C OXT sing N N 293 PHE CB CG sing N N 294 PHE CB HB2 sing N N 295 PHE CB HB3 sing N N 296 PHE CG CD1 doub Y N 297 PHE CG CD2 sing Y N 298 PHE CD1 CE1 sing Y N 299 PHE CD1 HD1 sing N N 300 PHE CD2 CE2 doub Y N 301 PHE CD2 HD2 sing N N 302 PHE CE1 CZ doub Y N 303 PHE CE1 HE1 sing N N 304 PHE CE2 CZ sing Y N 305 PHE CE2 HE2 sing N N 306 PHE CZ HZ sing N N 307 PHE OXT HXT sing N N 308 PRO N CA sing N N 309 PRO N CD sing N N 310 PRO N H sing N N 311 PRO CA C sing N N 312 PRO CA CB sing N N 313 PRO CA HA sing N N 314 PRO C O doub N N 315 PRO C OXT sing N N 316 PRO CB CG sing N N 317 PRO CB HB2 sing N N 318 PRO CB HB3 sing N N 319 PRO CG CD sing N N 320 PRO CG HG2 sing N N 321 PRO CG HG3 sing N N 322 PRO CD HD2 sing N N 323 PRO CD HD3 sing N N 324 PRO OXT HXT sing N N 325 SER N CA sing N N 326 SER N H sing N N 327 SER N H2 sing N N 328 SER CA C sing N N 329 SER CA CB sing N N 330 SER CA HA sing N N 331 SER C O doub N N 332 SER C OXT sing N N 333 SER CB OG sing N N 334 SER CB HB2 sing N N 335 SER CB HB3 sing N N 336 SER OG HG sing N N 337 SER OXT HXT sing N N 338 THR N CA sing N N 339 THR N H sing N N 340 THR N H2 sing N N 341 THR CA C sing N N 342 THR CA CB sing N N 343 THR CA HA sing N N 344 THR C O doub N N 345 THR C OXT sing N N 346 THR CB OG1 sing N N 347 THR CB CG2 sing N N 348 THR CB HB sing N N 349 THR OG1 HG1 sing N N 350 THR CG2 HG21 sing N N 351 THR CG2 HG22 sing N N 352 THR CG2 HG23 sing N N 353 THR OXT HXT sing N N 354 TRP N CA sing N N 355 TRP N H sing N N 356 TRP N H2 sing N N 357 TRP CA C sing N N 358 TRP CA CB sing N N 359 TRP CA HA sing N N 360 TRP C O doub N N 361 TRP C OXT sing N N 362 TRP CB CG sing N N 363 TRP CB HB2 sing N N 364 TRP CB HB3 sing N N 365 TRP CG CD1 doub Y N 366 TRP CG CD2 sing Y N 367 TRP CD1 NE1 sing Y N 368 TRP CD1 HD1 sing N N 369 TRP CD2 CE2 doub Y N 370 TRP CD2 CE3 sing Y N 371 TRP NE1 CE2 sing Y N 372 TRP NE1 HE1 sing N N 373 TRP CE2 CZ2 sing Y N 374 TRP CE3 CZ3 doub Y N 375 TRP CE3 HE3 sing N N 376 TRP CZ2 CH2 doub Y N 377 TRP CZ2 HZ2 sing N N 378 TRP CZ3 CH2 sing Y N 379 TRP CZ3 HZ3 sing N N 380 TRP CH2 HH2 sing N N 381 TRP OXT HXT sing N N 382 TYR N CA sing N N 383 TYR N H sing N N 384 TYR N H2 sing N N 385 TYR CA C sing N N 386 TYR CA CB sing N N 387 TYR CA HA sing N N 388 TYR C O doub N N 389 TYR C OXT sing N N 390 TYR CB CG sing N N 391 TYR CB HB2 sing N N 392 TYR CB HB3 sing N N 393 TYR CG CD1 doub Y N 394 TYR CG CD2 sing Y N 395 TYR CD1 CE1 sing Y N 396 TYR CD1 HD1 sing N N 397 TYR CD2 CE2 doub Y N 398 TYR CD2 HD2 sing N N 399 TYR CE1 CZ doub Y N 400 TYR CE1 HE1 sing N N 401 TYR CE2 CZ sing Y N 402 TYR CE2 HE2 sing N N 403 TYR CZ OH sing N N 404 TYR OH HH sing N N 405 TYR OXT HXT sing N N 406 VAL N CA sing N N 407 VAL N H sing N N 408 VAL N H2 sing N N 409 VAL CA C sing N N 410 VAL CA CB sing N N 411 VAL CA HA sing N N 412 VAL C O doub N N 413 VAL C OXT sing N N 414 VAL CB CG1 sing N N 415 VAL CB CG2 sing N N 416 VAL CB HB sing N N 417 VAL CG1 HG11 sing N N 418 VAL CG1 HG12 sing N N 419 VAL CG1 HG13 sing N N 420 VAL CG2 HG21 sing N N 421 VAL CG2 HG22 sing N N 422 VAL CG2 HG23 sing N N 423 VAL OXT HXT sing N N 424 # _pdbx_audit_support.funding_organization 'Ministry of Science and Technology (MoST, China)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ATP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ATP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "ADENOSINE-5'-TRIPHOSPHATE" ATP 3 'MAGNESIUM ION' MG 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7CFH _pdbx_initial_refinement_model.details ? # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 cross-linking ? 2 1 'gel filtration' ? # _space_group.name_H-M_alt 'F 2 2 2' _space_group.name_Hall 'F 2 2' _space_group.IT_number 22 _space_group.crystal_system orthorhombic _space_group.id 1 #