data_7CGU # _entry.id 7CGU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7CGU pdb_00007cgu 10.2210/pdb7cgu/pdb WWPDB D_1300017581 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-07-07 2 'Structure model' 1 1 2023-11-29 3 'Structure model' 1 2 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 3 'Structure model' pdbx_entry_details 6 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7CGU _pdbx_database_status.recvd_initial_deposition_date 2020-07-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yan, Y.J.' 1 0000-0001-7727-8084 'Huang, S.X.' 2 0000-0002-3616-8556 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal Structure of AbHAR' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yan, Y.J.' 1 0000-0001-7727-8084 primary 'Huang, S.X.' 2 0000-0002-3616-8556 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Alcohol dehydrogenase' 39098.875 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 water nat water 18.015 39 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASEKSLEEKQAENTFGWAAMDSSGVLSPFTFSRRATGEEDVRLKVLYCGICHSDLGCIKNEWGWCSYPLVPGHEIVGIA TEVGSKVTKFKVGDRVGVGCMVGSCGTCQNCTQNQESYCPEVIMTCASAYPDGTPTYGGFSNQMVANEKFVIRIPNSLPL DAAAPLLCAGSTVYSAMKFYGLCSQGLHLGVVGLGGLGHVAVKFAKAFGMKVTVISTSLGKKEEAINQLGADSFLINTDT EQMQGAMEVMDGIIDTVSALHPIEPLLGLLKSHQGKLIIVGLPNKQPELPVFSLINGRKMIGGSAVGGVKETQEMIDFAA EHNITADIEIVPMDYVNTAMERLEKGDVKFRFVIDVENTLVAAQT ; _entity_poly.pdbx_seq_one_letter_code_can ;MASEKSLEEKQAENTFGWAAMDSSGVLSPFTFSRRATGEEDVRLKVLYCGICHSDLGCIKNEWGWCSYPLVPGHEIVGIA TEVGSKVTKFKVGDRVGVGCMVGSCGTCQNCTQNQESYCPEVIMTCASAYPDGTPTYGGFSNQMVANEKFVIRIPNSLPL DAAAPLLCAGSTVYSAMKFYGLCSQGLHLGVVGLGGLGHVAVKFAKAFGMKVTVISTSLGKKEEAINQLGADSFLINTDT EQMQGAMEVMDGIIDTVSALHPIEPLLGLLKSHQGKLIIVGLPNKQPELPVFSLINGRKMIGGSAVGGVKETQEMIDFAA EHNITADIEIVPMDYVNTAMERLEKGDVKFRFVIDVENTLVAAQT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'SULFATE ION' SO4 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 GLU n 1 5 LYS n 1 6 SER n 1 7 LEU n 1 8 GLU n 1 9 GLU n 1 10 LYS n 1 11 GLN n 1 12 ALA n 1 13 GLU n 1 14 ASN n 1 15 THR n 1 16 PHE n 1 17 GLY n 1 18 TRP n 1 19 ALA n 1 20 ALA n 1 21 MET n 1 22 ASP n 1 23 SER n 1 24 SER n 1 25 GLY n 1 26 VAL n 1 27 LEU n 1 28 SER n 1 29 PRO n 1 30 PHE n 1 31 THR n 1 32 PHE n 1 33 SER n 1 34 ARG n 1 35 ARG n 1 36 ALA n 1 37 THR n 1 38 GLY n 1 39 GLU n 1 40 GLU n 1 41 ASP n 1 42 VAL n 1 43 ARG n 1 44 LEU n 1 45 LYS n 1 46 VAL n 1 47 LEU n 1 48 TYR n 1 49 CYS n 1 50 GLY n 1 51 ILE n 1 52 CYS n 1 53 HIS n 1 54 SER n 1 55 ASP n 1 56 LEU n 1 57 GLY n 1 58 CYS n 1 59 ILE n 1 60 LYS n 1 61 ASN n 1 62 GLU n 1 63 TRP n 1 64 GLY n 1 65 TRP n 1 66 CYS n 1 67 SER n 1 68 TYR n 1 69 PRO n 1 70 LEU n 1 71 VAL n 1 72 PRO n 1 73 GLY n 1 74 HIS n 1 75 GLU n 1 76 ILE n 1 77 VAL n 1 78 GLY n 1 79 ILE n 1 80 ALA n 1 81 THR n 1 82 GLU n 1 83 VAL n 1 84 GLY n 1 85 SER n 1 86 LYS n 1 87 VAL n 1 88 THR n 1 89 LYS n 1 90 PHE n 1 91 LYS n 1 92 VAL n 1 93 GLY n 1 94 ASP n 1 95 ARG n 1 96 VAL n 1 97 GLY n 1 98 VAL n 1 99 GLY n 1 100 CYS n 1 101 MET n 1 102 VAL n 1 103 GLY n 1 104 SER n 1 105 CYS n 1 106 GLY n 1 107 THR n 1 108 CYS n 1 109 GLN n 1 110 ASN n 1 111 CYS n 1 112 THR n 1 113 GLN n 1 114 ASN n 1 115 GLN n 1 116 GLU n 1 117 SER n 1 118 TYR n 1 119 CYS n 1 120 PRO n 1 121 GLU n 1 122 VAL n 1 123 ILE n 1 124 MET n 1 125 THR n 1 126 CYS n 1 127 ALA n 1 128 SER n 1 129 ALA n 1 130 TYR n 1 131 PRO n 1 132 ASP n 1 133 GLY n 1 134 THR n 1 135 PRO n 1 136 THR n 1 137 TYR n 1 138 GLY n 1 139 GLY n 1 140 PHE n 1 141 SER n 1 142 ASN n 1 143 GLN n 1 144 MET n 1 145 VAL n 1 146 ALA n 1 147 ASN n 1 148 GLU n 1 149 LYS n 1 150 PHE n 1 151 VAL n 1 152 ILE n 1 153 ARG n 1 154 ILE n 1 155 PRO n 1 156 ASN n 1 157 SER n 1 158 LEU n 1 159 PRO n 1 160 LEU n 1 161 ASP n 1 162 ALA n 1 163 ALA n 1 164 ALA n 1 165 PRO n 1 166 LEU n 1 167 LEU n 1 168 CYS n 1 169 ALA n 1 170 GLY n 1 171 SER n 1 172 THR n 1 173 VAL n 1 174 TYR n 1 175 SER n 1 176 ALA n 1 177 MET n 1 178 LYS n 1 179 PHE n 1 180 TYR n 1 181 GLY n 1 182 LEU n 1 183 CYS n 1 184 SER n 1 185 GLN n 1 186 GLY n 1 187 LEU n 1 188 HIS n 1 189 LEU n 1 190 GLY n 1 191 VAL n 1 192 VAL n 1 193 GLY n 1 194 LEU n 1 195 GLY n 1 196 GLY n 1 197 LEU n 1 198 GLY n 1 199 HIS n 1 200 VAL n 1 201 ALA n 1 202 VAL n 1 203 LYS n 1 204 PHE n 1 205 ALA n 1 206 LYS n 1 207 ALA n 1 208 PHE n 1 209 GLY n 1 210 MET n 1 211 LYS n 1 212 VAL n 1 213 THR n 1 214 VAL n 1 215 ILE n 1 216 SER n 1 217 THR n 1 218 SER n 1 219 LEU n 1 220 GLY n 1 221 LYS n 1 222 LYS n 1 223 GLU n 1 224 GLU n 1 225 ALA n 1 226 ILE n 1 227 ASN n 1 228 GLN n 1 229 LEU n 1 230 GLY n 1 231 ALA n 1 232 ASP n 1 233 SER n 1 234 PHE n 1 235 LEU n 1 236 ILE n 1 237 ASN n 1 238 THR n 1 239 ASP n 1 240 THR n 1 241 GLU n 1 242 GLN n 1 243 MET n 1 244 GLN n 1 245 GLY n 1 246 ALA n 1 247 MET n 1 248 GLU n 1 249 VAL n 1 250 MET n 1 251 ASP n 1 252 GLY n 1 253 ILE n 1 254 ILE n 1 255 ASP n 1 256 THR n 1 257 VAL n 1 258 SER n 1 259 ALA n 1 260 LEU n 1 261 HIS n 1 262 PRO n 1 263 ILE n 1 264 GLU n 1 265 PRO n 1 266 LEU n 1 267 LEU n 1 268 GLY n 1 269 LEU n 1 270 LEU n 1 271 LYS n 1 272 SER n 1 273 HIS n 1 274 GLN n 1 275 GLY n 1 276 LYS n 1 277 LEU n 1 278 ILE n 1 279 ILE n 1 280 VAL n 1 281 GLY n 1 282 LEU n 1 283 PRO n 1 284 ASN n 1 285 LYS n 1 286 GLN n 1 287 PRO n 1 288 GLU n 1 289 LEU n 1 290 PRO n 1 291 VAL n 1 292 PHE n 1 293 SER n 1 294 LEU n 1 295 ILE n 1 296 ASN n 1 297 GLY n 1 298 ARG n 1 299 LYS n 1 300 MET n 1 301 ILE n 1 302 GLY n 1 303 GLY n 1 304 SER n 1 305 ALA n 1 306 VAL n 1 307 GLY n 1 308 GLY n 1 309 VAL n 1 310 LYS n 1 311 GLU n 1 312 THR n 1 313 GLN n 1 314 GLU n 1 315 MET n 1 316 ILE n 1 317 ASP n 1 318 PHE n 1 319 ALA n 1 320 ALA n 1 321 GLU n 1 322 HIS n 1 323 ASN n 1 324 ILE n 1 325 THR n 1 326 ALA n 1 327 ASP n 1 328 ILE n 1 329 GLU n 1 330 ILE n 1 331 VAL n 1 332 PRO n 1 333 MET n 1 334 ASP n 1 335 TYR n 1 336 VAL n 1 337 ASN n 1 338 THR n 1 339 ALA n 1 340 MET n 1 341 GLU n 1 342 ARG n 1 343 LEU n 1 344 GLU n 1 345 LYS n 1 346 GLY n 1 347 ASP n 1 348 VAL n 1 349 LYS n 1 350 PHE n 1 351 ARG n 1 352 PHE n 1 353 VAL n 1 354 ILE n 1 355 ASP n 1 356 VAL n 1 357 GLU n 1 358 ASN n 1 359 THR n 1 360 LEU n 1 361 VAL n 1 362 ALA n 1 363 ALA n 1 364 GLN n 1 365 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 365 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Atropa belladonna' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 33113 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 ALA 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 GLU 4 -16 ? ? ? A . n A 1 5 LYS 5 -15 ? ? ? A . n A 1 6 SER 6 -14 ? ? ? A . n A 1 7 LEU 7 -13 ? ? ? A . n A 1 8 GLU 8 -12 ? ? ? A . n A 1 9 GLU 9 -11 ? ? ? A . n A 1 10 LYS 10 -10 ? ? ? A . n A 1 11 GLN 11 -9 ? ? ? A . n A 1 12 ALA 12 -8 -8 ALA ALA A . n A 1 13 GLU 13 -7 -7 GLU GLU A . n A 1 14 ASN 14 -6 -6 ASN ASN A . n A 1 15 THR 15 -5 -5 THR THR A . n A 1 16 PHE 16 -4 -4 PHE PHE A . n A 1 17 GLY 17 -3 -3 GLY GLY A . n A 1 18 TRP 18 -2 -2 TRP TRP A . n A 1 19 ALA 19 -1 -1 ALA ALA A . n A 1 20 ALA 20 0 0 ALA ALA A . n A 1 21 MET 21 1 1 MET MET A . n A 1 22 ASP 22 2 2 ASP ASP A . n A 1 23 SER 23 3 3 SER SER A . n A 1 24 SER 24 4 4 SER SER A . n A 1 25 GLY 25 5 5 GLY GLY A . n A 1 26 VAL 26 6 6 VAL VAL A . n A 1 27 LEU 27 7 7 LEU LEU A . n A 1 28 SER 28 8 8 SER SER A . n A 1 29 PRO 29 9 9 PRO PRO A . n A 1 30 PHE 30 10 10 PHE PHE A . n A 1 31 THR 31 11 11 THR THR A . n A 1 32 PHE 32 12 12 PHE PHE A . n A 1 33 SER 33 13 13 SER SER A . n A 1 34 ARG 34 14 14 ARG ARG A . n A 1 35 ARG 35 15 15 ARG ARG A . n A 1 36 ALA 36 16 16 ALA ALA A . n A 1 37 THR 37 17 17 THR THR A . n A 1 38 GLY 38 18 18 GLY GLY A . n A 1 39 GLU 39 19 19 GLU GLU A . n A 1 40 GLU 40 20 20 GLU GLU A . n A 1 41 ASP 41 21 21 ASP ASP A . n A 1 42 VAL 42 22 22 VAL VAL A . n A 1 43 ARG 43 23 23 ARG ARG A . n A 1 44 LEU 44 24 24 LEU LEU A . n A 1 45 LYS 45 25 25 LYS LYS A . n A 1 46 VAL 46 26 26 VAL VAL A . n A 1 47 LEU 47 27 27 LEU LEU A . n A 1 48 TYR 48 28 28 TYR TYR A . n A 1 49 CYS 49 29 29 CYS CYS A . n A 1 50 GLY 50 30 30 GLY GLY A . n A 1 51 ILE 51 31 31 ILE ILE A . n A 1 52 CYS 52 32 32 CYS CYS A . n A 1 53 HIS 53 33 33 HIS HIS A . n A 1 54 SER 54 34 34 SER SER A . n A 1 55 ASP 55 35 35 ASP ASP A . n A 1 56 LEU 56 36 36 LEU LEU A . n A 1 57 GLY 57 37 37 GLY GLY A . n A 1 58 CYS 58 38 38 CYS CYS A . n A 1 59 ILE 59 39 39 ILE ILE A . n A 1 60 LYS 60 40 40 LYS LYS A . n A 1 61 ASN 61 41 41 ASN ASN A . n A 1 62 GLU 62 42 42 GLU GLU A . n A 1 63 TRP 63 43 43 TRP TRP A . n A 1 64 GLY 64 44 44 GLY GLY A . n A 1 65 TRP 65 45 45 TRP TRP A . n A 1 66 CYS 66 46 46 CYS CYS A . n A 1 67 SER 67 47 47 SER SER A . n A 1 68 TYR 68 48 48 TYR TYR A . n A 1 69 PRO 69 49 49 PRO PRO A . n A 1 70 LEU 70 50 50 LEU LEU A . n A 1 71 VAL 71 51 51 VAL VAL A . n A 1 72 PRO 72 52 52 PRO PRO A . n A 1 73 GLY 73 53 53 GLY GLY A . n A 1 74 HIS 74 54 54 HIS HIS A . n A 1 75 GLU 75 55 55 GLU GLU A . n A 1 76 ILE 76 56 56 ILE ILE A . n A 1 77 VAL 77 57 57 VAL VAL A . n A 1 78 GLY 78 58 58 GLY GLY A . n A 1 79 ILE 79 59 59 ILE ILE A . n A 1 80 ALA 80 60 60 ALA ALA A . n A 1 81 THR 81 61 61 THR THR A . n A 1 82 GLU 82 62 62 GLU GLU A . n A 1 83 VAL 83 63 63 VAL VAL A . n A 1 84 GLY 84 64 64 GLY GLY A . n A 1 85 SER 85 65 65 SER SER A . n A 1 86 LYS 86 66 66 LYS LYS A . n A 1 87 VAL 87 67 67 VAL VAL A . n A 1 88 THR 88 68 68 THR THR A . n A 1 89 LYS 89 69 69 LYS LYS A . n A 1 90 PHE 90 70 70 PHE PHE A . n A 1 91 LYS 91 71 71 LYS LYS A . n A 1 92 VAL 92 72 72 VAL VAL A . n A 1 93 GLY 93 73 73 GLY GLY A . n A 1 94 ASP 94 74 74 ASP ASP A . n A 1 95 ARG 95 75 75 ARG ARG A . n A 1 96 VAL 96 76 76 VAL VAL A . n A 1 97 GLY 97 77 77 GLY GLY A . n A 1 98 VAL 98 78 78 VAL VAL A . n A 1 99 GLY 99 79 79 GLY GLY A . n A 1 100 CYS 100 80 80 CYS CYS A . n A 1 101 MET 101 81 81 MET MET A . n A 1 102 VAL 102 82 82 VAL VAL A . n A 1 103 GLY 103 83 83 GLY GLY A . n A 1 104 SER 104 84 84 SER SER A . n A 1 105 CYS 105 85 85 CYS CYS A . n A 1 106 GLY 106 86 86 GLY GLY A . n A 1 107 THR 107 87 87 THR THR A . n A 1 108 CYS 108 88 88 CYS CYS A . n A 1 109 GLN 109 89 89 GLN GLN A . n A 1 110 ASN 110 90 90 ASN ASN A . n A 1 111 CYS 111 91 91 CYS CYS A . n A 1 112 THR 112 92 92 THR THR A . n A 1 113 GLN 113 93 93 GLN GLN A . n A 1 114 ASN 114 94 94 ASN ASN A . n A 1 115 GLN 115 95 95 GLN GLN A . n A 1 116 GLU 116 96 96 GLU GLU A . n A 1 117 SER 117 97 97 SER SER A . n A 1 118 TYR 118 98 98 TYR TYR A . n A 1 119 CYS 119 99 99 CYS CYS A . n A 1 120 PRO 120 100 100 PRO PRO A . n A 1 121 GLU 121 101 101 GLU GLU A . n A 1 122 VAL 122 102 102 VAL VAL A . n A 1 123 ILE 123 103 103 ILE ILE A . n A 1 124 MET 124 104 104 MET MET A . n A 1 125 THR 125 105 105 THR THR A . n A 1 126 CYS 126 106 106 CYS CYS A . n A 1 127 ALA 127 107 107 ALA ALA A . n A 1 128 SER 128 108 108 SER SER A . n A 1 129 ALA 129 109 109 ALA ALA A . n A 1 130 TYR 130 110 110 TYR TYR A . n A 1 131 PRO 131 111 111 PRO PRO A . n A 1 132 ASP 132 112 112 ASP ASP A . n A 1 133 GLY 133 113 113 GLY GLY A . n A 1 134 THR 134 114 114 THR THR A . n A 1 135 PRO 135 115 115 PRO PRO A . n A 1 136 THR 136 116 116 THR THR A . n A 1 137 TYR 137 117 117 TYR TYR A . n A 1 138 GLY 138 118 118 GLY GLY A . n A 1 139 GLY 139 119 119 GLY GLY A . n A 1 140 PHE 140 120 120 PHE PHE A . n A 1 141 SER 141 121 121 SER SER A . n A 1 142 ASN 142 122 122 ASN ASN A . n A 1 143 GLN 143 123 123 GLN GLN A . n A 1 144 MET 144 124 124 MET MET A . n A 1 145 VAL 145 125 125 VAL VAL A . n A 1 146 ALA 146 126 126 ALA ALA A . n A 1 147 ASN 147 127 127 ASN ASN A . n A 1 148 GLU 148 128 128 GLU GLU A . n A 1 149 LYS 149 129 129 LYS LYS A . n A 1 150 PHE 150 130 130 PHE PHE A . n A 1 151 VAL 151 131 131 VAL VAL A . n A 1 152 ILE 152 132 132 ILE ILE A . n A 1 153 ARG 153 133 133 ARG ARG A . n A 1 154 ILE 154 134 134 ILE ILE A . n A 1 155 PRO 155 135 135 PRO PRO A . n A 1 156 ASN 156 136 136 ASN ASN A . n A 1 157 SER 157 137 137 SER SER A . n A 1 158 LEU 158 138 138 LEU LEU A . n A 1 159 PRO 159 139 139 PRO PRO A . n A 1 160 LEU 160 140 140 LEU LEU A . n A 1 161 ASP 161 141 141 ASP ASP A . n A 1 162 ALA 162 142 142 ALA ALA A . n A 1 163 ALA 163 143 143 ALA ALA A . n A 1 164 ALA 164 144 144 ALA ALA A . n A 1 165 PRO 165 145 145 PRO PRO A . n A 1 166 LEU 166 146 146 LEU LEU A . n A 1 167 LEU 167 147 147 LEU LEU A . n A 1 168 CYS 168 148 148 CYS CYS A . n A 1 169 ALA 169 149 149 ALA ALA A . n A 1 170 GLY 170 150 150 GLY GLY A . n A 1 171 SER 171 151 151 SER SER A . n A 1 172 THR 172 152 152 THR THR A . n A 1 173 VAL 173 153 153 VAL VAL A . n A 1 174 TYR 174 154 154 TYR TYR A . n A 1 175 SER 175 155 155 SER SER A . n A 1 176 ALA 176 156 156 ALA ALA A . n A 1 177 MET 177 157 157 MET MET A . n A 1 178 LYS 178 158 158 LYS LYS A . n A 1 179 PHE 179 159 159 PHE PHE A . n A 1 180 TYR 180 160 160 TYR TYR A . n A 1 181 GLY 181 161 161 GLY GLY A . n A 1 182 LEU 182 162 162 LEU LEU A . n A 1 183 CYS 183 163 163 CYS CYS A . n A 1 184 SER 184 164 164 SER SER A . n A 1 185 GLN 185 165 165 GLN GLN A . n A 1 186 GLY 186 166 166 GLY GLY A . n A 1 187 LEU 187 167 167 LEU LEU A . n A 1 188 HIS 188 168 168 HIS HIS A . n A 1 189 LEU 189 169 169 LEU LEU A . n A 1 190 GLY 190 170 170 GLY GLY A . n A 1 191 VAL 191 171 171 VAL VAL A . n A 1 192 VAL 192 172 172 VAL VAL A . n A 1 193 GLY 193 173 173 GLY GLY A . n A 1 194 LEU 194 174 174 LEU LEU A . n A 1 195 GLY 195 175 175 GLY GLY A . n A 1 196 GLY 196 176 176 GLY GLY A . n A 1 197 LEU 197 177 177 LEU LEU A . n A 1 198 GLY 198 178 178 GLY GLY A . n A 1 199 HIS 199 179 179 HIS HIS A . n A 1 200 VAL 200 180 180 VAL VAL A . n A 1 201 ALA 201 181 181 ALA ALA A . n A 1 202 VAL 202 182 182 VAL VAL A . n A 1 203 LYS 203 183 183 LYS LYS A . n A 1 204 PHE 204 184 184 PHE PHE A . n A 1 205 ALA 205 185 185 ALA ALA A . n A 1 206 LYS 206 186 186 LYS LYS A . n A 1 207 ALA 207 187 187 ALA ALA A . n A 1 208 PHE 208 188 188 PHE PHE A . n A 1 209 GLY 209 189 189 GLY GLY A . n A 1 210 MET 210 190 190 MET MET A . n A 1 211 LYS 211 191 191 LYS LYS A . n A 1 212 VAL 212 192 192 VAL VAL A . n A 1 213 THR 213 193 193 THR THR A . n A 1 214 VAL 214 194 194 VAL VAL A . n A 1 215 ILE 215 195 195 ILE ILE A . n A 1 216 SER 216 196 196 SER SER A . n A 1 217 THR 217 197 197 THR THR A . n A 1 218 SER 218 198 198 SER SER A . n A 1 219 LEU 219 199 199 LEU LEU A . n A 1 220 GLY 220 200 200 GLY GLY A . n A 1 221 LYS 221 201 201 LYS LYS A . n A 1 222 LYS 222 202 202 LYS LYS A . n A 1 223 GLU 223 203 203 GLU GLU A . n A 1 224 GLU 224 204 204 GLU GLU A . n A 1 225 ALA 225 205 205 ALA ALA A . n A 1 226 ILE 226 206 206 ILE ILE A . n A 1 227 ASN 227 207 207 ASN ASN A . n A 1 228 GLN 228 208 208 GLN GLN A . n A 1 229 LEU 229 209 209 LEU LEU A . n A 1 230 GLY 230 210 210 GLY GLY A . n A 1 231 ALA 231 211 211 ALA ALA A . n A 1 232 ASP 232 212 212 ASP ASP A . n A 1 233 SER 233 213 213 SER SER A . n A 1 234 PHE 234 214 214 PHE PHE A . n A 1 235 LEU 235 215 215 LEU LEU A . n A 1 236 ILE 236 216 216 ILE ILE A . n A 1 237 ASN 237 217 217 ASN ASN A . n A 1 238 THR 238 218 218 THR THR A . n A 1 239 ASP 239 219 219 ASP ASP A . n A 1 240 THR 240 220 220 THR THR A . n A 1 241 GLU 241 221 221 GLU GLU A . n A 1 242 GLN 242 222 222 GLN GLN A . n A 1 243 MET 243 223 223 MET MET A . n A 1 244 GLN 244 224 224 GLN GLN A . n A 1 245 GLY 245 225 225 GLY GLY A . n A 1 246 ALA 246 226 226 ALA ALA A . n A 1 247 MET 247 227 227 MET MET A . n A 1 248 GLU 248 228 228 GLU GLU A . n A 1 249 VAL 249 229 229 VAL VAL A . n A 1 250 MET 250 230 230 MET MET A . n A 1 251 ASP 251 231 231 ASP ASP A . n A 1 252 GLY 252 232 232 GLY GLY A . n A 1 253 ILE 253 233 233 ILE ILE A . n A 1 254 ILE 254 234 234 ILE ILE A . n A 1 255 ASP 255 235 235 ASP ASP A . n A 1 256 THR 256 236 236 THR THR A . n A 1 257 VAL 257 237 237 VAL VAL A . n A 1 258 SER 258 238 238 SER SER A . n A 1 259 ALA 259 239 239 ALA ALA A . n A 1 260 LEU 260 240 240 LEU LEU A . n A 1 261 HIS 261 241 241 HIS HIS A . n A 1 262 PRO 262 242 242 PRO PRO A . n A 1 263 ILE 263 243 243 ILE ILE A . n A 1 264 GLU 264 244 244 GLU GLU A . n A 1 265 PRO 265 245 245 PRO PRO A . n A 1 266 LEU 266 246 246 LEU LEU A . n A 1 267 LEU 267 247 247 LEU LEU A . n A 1 268 GLY 268 248 248 GLY GLY A . n A 1 269 LEU 269 249 249 LEU LEU A . n A 1 270 LEU 270 250 250 LEU LEU A . n A 1 271 LYS 271 251 251 LYS LYS A . n A 1 272 SER 272 252 252 SER SER A . n A 1 273 HIS 273 253 253 HIS HIS A . n A 1 274 GLN 274 254 254 GLN GLN A . n A 1 275 GLY 275 255 255 GLY GLY A . n A 1 276 LYS 276 256 256 LYS LYS A . n A 1 277 LEU 277 257 257 LEU LEU A . n A 1 278 ILE 278 258 258 ILE ILE A . n A 1 279 ILE 279 259 259 ILE ILE A . n A 1 280 VAL 280 260 260 VAL VAL A . n A 1 281 GLY 281 261 261 GLY GLY A . n A 1 282 LEU 282 262 262 LEU LEU A . n A 1 283 PRO 283 263 263 PRO PRO A . n A 1 284 ASN 284 264 264 ASN ASN A . n A 1 285 LYS 285 265 265 LYS LYS A . n A 1 286 GLN 286 266 266 GLN GLN A . n A 1 287 PRO 287 267 267 PRO PRO A . n A 1 288 GLU 288 268 268 GLU GLU A . n A 1 289 LEU 289 269 269 LEU LEU A . n A 1 290 PRO 290 270 270 PRO PRO A . n A 1 291 VAL 291 271 271 VAL VAL A . n A 1 292 PHE 292 272 272 PHE PHE A . n A 1 293 SER 293 273 273 SER SER A . n A 1 294 LEU 294 274 274 LEU LEU A . n A 1 295 ILE 295 275 275 ILE ILE A . n A 1 296 ASN 296 276 276 ASN ASN A . n A 1 297 GLY 297 277 277 GLY GLY A . n A 1 298 ARG 298 278 278 ARG ARG A . n A 1 299 LYS 299 279 279 LYS LYS A . n A 1 300 MET 300 280 280 MET MET A . n A 1 301 ILE 301 281 281 ILE ILE A . n A 1 302 GLY 302 282 282 GLY GLY A . n A 1 303 GLY 303 283 283 GLY GLY A . n A 1 304 SER 304 284 284 SER SER A . n A 1 305 ALA 305 285 285 ALA ALA A . n A 1 306 VAL 306 286 286 VAL VAL A . n A 1 307 GLY 307 287 287 GLY GLY A . n A 1 308 GLY 308 288 288 GLY GLY A . n A 1 309 VAL 309 289 289 VAL VAL A . n A 1 310 LYS 310 290 290 LYS LYS A . n A 1 311 GLU 311 291 291 GLU GLU A . n A 1 312 THR 312 292 292 THR THR A . n A 1 313 GLN 313 293 293 GLN GLN A . n A 1 314 GLU 314 294 294 GLU GLU A . n A 1 315 MET 315 295 295 MET MET A . n A 1 316 ILE 316 296 296 ILE ILE A . n A 1 317 ASP 317 297 297 ASP ASP A . n A 1 318 PHE 318 298 298 PHE PHE A . n A 1 319 ALA 319 299 299 ALA ALA A . n A 1 320 ALA 320 300 300 ALA ALA A . n A 1 321 GLU 321 301 301 GLU GLU A . n A 1 322 HIS 322 302 302 HIS HIS A . n A 1 323 ASN 323 303 303 ASN ASN A . n A 1 324 ILE 324 304 304 ILE ILE A . n A 1 325 THR 325 305 305 THR THR A . n A 1 326 ALA 326 306 306 ALA ALA A . n A 1 327 ASP 327 307 307 ASP ASP A . n A 1 328 ILE 328 308 308 ILE ILE A . n A 1 329 GLU 329 309 309 GLU GLU A . n A 1 330 ILE 330 310 310 ILE ILE A . n A 1 331 VAL 331 311 311 VAL VAL A . n A 1 332 PRO 332 312 312 PRO PRO A . n A 1 333 MET 333 313 313 MET MET A . n A 1 334 ASP 334 314 314 ASP ASP A . n A 1 335 TYR 335 315 315 TYR TYR A . n A 1 336 VAL 336 316 316 VAL VAL A . n A 1 337 ASN 337 317 317 ASN ASN A . n A 1 338 THR 338 318 318 THR THR A . n A 1 339 ALA 339 319 319 ALA ALA A . n A 1 340 MET 340 320 320 MET MET A . n A 1 341 GLU 341 321 321 GLU GLU A . n A 1 342 ARG 342 322 322 ARG ARG A . n A 1 343 LEU 343 323 323 LEU LEU A . n A 1 344 GLU 344 324 324 GLU GLU A . n A 1 345 LYS 345 325 325 LYS LYS A . n A 1 346 GLY 346 326 326 GLY GLY A . n A 1 347 ASP 347 327 327 ASP ASP A . n A 1 348 VAL 348 328 328 VAL VAL A . n A 1 349 LYS 349 329 329 LYS LYS A . n A 1 350 PHE 350 330 330 PHE PHE A . n A 1 351 ARG 351 331 331 ARG ARG A . n A 1 352 PHE 352 332 332 PHE PHE A . n A 1 353 VAL 353 333 333 VAL VAL A . n A 1 354 ILE 354 334 334 ILE ILE A . n A 1 355 ASP 355 335 335 ASP ASP A . n A 1 356 VAL 356 336 336 VAL VAL A . n A 1 357 GLU 357 337 337 GLU GLU A . n A 1 358 ASN 358 338 338 ASN ASN A . n A 1 359 THR 359 339 339 THR THR A . n A 1 360 LEU 360 340 340 LEU LEU A . n A 1 361 VAL 361 341 341 VAL VAL A . n A 1 362 ALA 362 342 342 ALA ALA A . n A 1 363 ALA 363 343 343 ALA ALA A . n A 1 364 GLN 364 344 ? ? ? A . n A 1 365 THR 365 345 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 401 1 ZN ZN A . C 3 SO4 1 402 1 SO4 SO4 A . D 3 SO4 1 403 2 SO4 SO4 A . E 4 HOH 1 501 28 HOH HOH A . E 4 HOH 2 502 9 HOH HOH A . E 4 HOH 3 503 11 HOH HOH A . E 4 HOH 4 504 23 HOH HOH A . E 4 HOH 5 505 1 HOH HOH A . E 4 HOH 6 506 7 HOH HOH A . E 4 HOH 7 507 21 HOH HOH A . E 4 HOH 8 508 2 HOH HOH A . E 4 HOH 9 509 5 HOH HOH A . E 4 HOH 10 510 29 HOH HOH A . E 4 HOH 11 511 20 HOH HOH A . E 4 HOH 12 512 6 HOH HOH A . E 4 HOH 13 513 19 HOH HOH A . E 4 HOH 14 514 26 HOH HOH A . E 4 HOH 15 515 10 HOH HOH A . E 4 HOH 16 516 27 HOH HOH A . E 4 HOH 17 517 31 HOH HOH A . E 4 HOH 18 518 22 HOH HOH A . E 4 HOH 19 519 13 HOH HOH A . E 4 HOH 20 520 37 HOH HOH A . E 4 HOH 21 521 39 HOH HOH A . E 4 HOH 22 522 3 HOH HOH A . E 4 HOH 23 523 17 HOH HOH A . E 4 HOH 24 524 32 HOH HOH A . E 4 HOH 25 525 16 HOH HOH A . E 4 HOH 26 526 4 HOH HOH A . E 4 HOH 27 527 30 HOH HOH A . E 4 HOH 28 528 18 HOH HOH A . E 4 HOH 29 529 36 HOH HOH A . E 4 HOH 30 530 12 HOH HOH A . E 4 HOH 31 531 14 HOH HOH A . E 4 HOH 32 532 38 HOH HOH A . E 4 HOH 33 533 35 HOH HOH A . E 4 HOH 34 534 8 HOH HOH A . E 4 HOH 35 535 25 HOH HOH A . E 4 HOH 36 536 34 HOH HOH A . E 4 HOH 37 537 15 HOH HOH A . E 4 HOH 38 538 33 HOH HOH A . E 4 HOH 39 539 24 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A PRO 111 ? CG ? A PRO 131 CG 2 1 Y 1 A PRO 111 ? CD ? A PRO 131 CD # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.1_3865 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7CGU _cell.details ? _cell.formula_units_Z ? _cell.length_a 68.023 _cell.length_a_esd ? _cell.length_b 82.999 _cell.length_b_esd ? _cell.length_c 131.148 _cell.length_c_esd ? _cell.volume 740440.752 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7CGU _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall 'C 2c 2' _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7CGU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.37 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.04 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG 3350, O.2M ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-05-01 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9781 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9781 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 41.37 _reflns.entry_id 7CGU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.40 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14870 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.5 _reflns.pdbx_Rmerge_I_obs 0.115 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.037 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.40 _reflns_shell.d_res_low 2.44 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.89 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 766 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.680 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.267 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 47.51 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7CGU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.40 _refine.ls_d_res_low 34.01 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14829 _refine.ls_number_reflns_R_free 755 _refine.ls_number_reflns_R_work 14074 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.83 _refine.ls_percent_reflns_R_free 5.09 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1966 _refine.ls_R_factor_R_free 0.2417 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1942 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1YQD _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.9349 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2881 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 34.01 _refine_hist.number_atoms_solvent 39 _refine_hist.number_atoms_total 2673 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2623 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0109 ? 2679 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.3878 ? 3628 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0705 ? 416 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0084 ? 467 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 7.3442 ? 367 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.40 2.59 . . 150 2775 99.49 . . . 0.3056 . 0.2435 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.59 2.85 . . 145 2787 100.00 . . . 0.2885 . 0.2339 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.85 3.26 . . 165 2758 100.00 . . . 0.2692 . 0.2124 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.26 4.11 . . 146 2829 100.00 . . . 0.2497 . 0.1894 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.11 34.01 . . 149 2925 99.68 . . . 0.1968 . 0.1687 . . . . . . . . . . . # _struct.entry_id 7CGU _struct.title 'Crystal Structure of AbHAR' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7CGU _struct_keywords.text 'HART, BIOSYNTHETIC PROTEIN' _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7CGU _struct_ref.pdbx_db_accession 7CGU _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7CGU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 365 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7CGU _struct_ref_seq.db_align_beg -19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 345 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -19 _struct_ref_seq.pdbx_auth_seq_align_end 345 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 260 ? 1 MORE -19 ? 1 'SSA (A^2)' 15160 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 CYS A 52 ? LYS A 60 ? CYS A 32 LYS A 40 1 ? 9 HELX_P HELX_P2 AA2 ASN A 110 ? ASN A 114 ? ASN A 90 ASN A 94 5 ? 5 HELX_P HELX_P3 AA3 GLN A 115 ? CYS A 119 ? GLN A 95 CYS A 99 5 ? 5 HELX_P HELX_P4 AA4 PRO A 159 ? ALA A 164 ? PRO A 139 ALA A 144 1 ? 6 HELX_P HELX_P5 AA5 PRO A 165 ? LEU A 167 ? PRO A 145 LEU A 147 5 ? 3 HELX_P HELX_P6 AA6 CYS A 168 ? TYR A 180 ? CYS A 148 TYR A 160 1 ? 13 HELX_P HELX_P7 AA7 GLY A 195 ? PHE A 208 ? GLY A 175 PHE A 188 1 ? 14 HELX_P HELX_P8 AA8 SER A 218 ? GLY A 220 ? SER A 198 GLY A 200 5 ? 3 HELX_P HELX_P9 AA9 LYS A 221 ? ASN A 227 ? LYS A 201 ASN A 207 1 ? 7 HELX_P HELX_P10 AB1 GLU A 241 ? ALA A 246 ? GLU A 221 ALA A 226 1 ? 6 HELX_P HELX_P11 AB2 ILE A 263 ? LEU A 269 ? ILE A 243 LEU A 249 1 ? 7 HELX_P HELX_P12 AB3 PRO A 290 ? ARG A 298 ? PRO A 270 ARG A 278 1 ? 9 HELX_P HELX_P13 AB4 GLY A 308 ? HIS A 322 ? GLY A 288 HIS A 302 1 ? 15 HELX_P HELX_P14 AB5 PRO A 332 ? ASP A 334 ? PRO A 312 ASP A 314 5 ? 3 HELX_P HELX_P15 AB6 TYR A 335 ? LYS A 345 ? TYR A 315 LYS A 325 1 ? 11 HELX_P HELX_P16 AB7 VAL A 356 ? LEU A 360 ? VAL A 336 LEU A 340 1 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 105 SG ? ? ? 1_555 A CYS 108 SG ? ? A CYS 85 A CYS 88 1_555 ? ? ? ? ? ? ? 2.024 ? ? disulf2 disulf ? ? A CYS 105 SG ? ? ? 1_555 A CYS 111 SG ? ? A CYS 85 A CYS 91 1_555 ? ? ? ? ? ? ? 2.050 ? ? disulf3 disulf ? ? A CYS 105 SG ? ? ? 1_555 A CYS 119 SG ? ? A CYS 85 A CYS 99 1_555 ? ? ? ? ? ? ? 2.052 ? ? disulf4 disulf ? ? A CYS 108 SG ? ? ? 1_555 A CYS 119 SG ? ? A CYS 88 A CYS 99 1_555 ? ? ? ? ? ? ? 2.038 ? ? disulf5 disulf ? ? A CYS 111 SG ? ? ? 1_555 A CYS 119 SG ? ? A CYS 91 A CYS 99 1_555 ? ? ? ? ? ? ? 2.036 ? ? metalc1 metalc ? ? A CYS 52 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 32 A ZN 401 1_555 ? ? ? ? ? ? ? 2.290 ? ? metalc2 metalc ? ? A HIS 74 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 54 A ZN 401 1_555 ? ? ? ? ? ? ? 2.267 ? ? metalc3 metalc ? ? A GLU 75 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 55 A ZN 401 1_555 ? ? ? ? ? ? ? 2.193 ? ? metalc4 metalc ? ? A CYS 168 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 148 A ZN 401 1_555 ? ? ? ? ? ? ? 2.359 ? ? metalc5 metalc ? ? B ZN . ZN ? ? ? 1_555 E HOH . O ? ? A ZN 401 A HOH 522 1_555 ? ? ? ? ? ? ? 2.407 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 52 ? A CYS 32 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 74 ? A HIS 54 ? 1_555 106.8 ? 2 SG ? A CYS 52 ? A CYS 32 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 OE1 ? A GLU 75 ? A GLU 55 ? 1_555 109.5 ? 3 NE2 ? A HIS 74 ? A HIS 54 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 OE1 ? A GLU 75 ? A GLU 55 ? 1_555 109.2 ? 4 SG ? A CYS 52 ? A CYS 32 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 168 ? A CYS 148 ? 1_555 121.1 ? 5 NE2 ? A HIS 74 ? A HIS 54 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 168 ? A CYS 148 ? 1_555 100.8 ? 6 OE1 ? A GLU 75 ? A GLU 55 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 168 ? A CYS 148 ? 1_555 108.7 ? 7 SG ? A CYS 52 ? A CYS 32 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 O ? E HOH . ? A HOH 522 ? 1_555 80.3 ? 8 NE2 ? A HIS 74 ? A HIS 54 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 O ? E HOH . ? A HOH 522 ? 1_555 71.3 ? 9 OE1 ? A GLU 75 ? A GLU 55 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 O ? E HOH . ? A HOH 522 ? 1_555 169.0 ? 10 SG ? A CYS 168 ? A CYS 148 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 O ? E HOH . ? A HOH 522 ? 1_555 61.0 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 105 ? CYS A 108 ? CYS A 85 ? 1_555 CYS A 88 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 105 ? CYS A 111 ? CYS A 85 ? 1_555 CYS A 91 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 105 ? CYS A 119 ? CYS A 85 ? 1_555 CYS A 99 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 108 ? CYS A 119 ? CYS A 88 ? 1_555 CYS A 99 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 111 ? CYS A 119 ? CYS A 91 ? 1_555 CYS A 99 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 68 A . ? TYR 48 A PRO 69 A ? PRO 49 A 1 -7.70 2 LYS 349 A . ? LYS 329 A PHE 350 A ? PHE 330 A 1 -1.23 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 5 ? AA3 ? 4 ? AA4 ? 2 ? AA5 ? 2 ? AA6 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel AA6 1 2 ? parallel AA6 2 3 ? parallel AA6 3 4 ? parallel AA6 4 5 ? parallel AA6 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 15 ? ALA A 20 ? THR A -5 ALA A 0 AA1 2 LEU A 27 ? PHE A 32 ? LEU A 7 PHE A 12 AA2 1 GLN A 143 ? ASN A 147 ? GLN A 123 ASN A 127 AA2 2 ASP A 41 ? GLY A 50 ? ASP A 21 GLY A 30 AA2 3 GLU A 75 ? VAL A 83 ? GLU A 55 VAL A 63 AA2 4 ARG A 95 ? VAL A 98 ? ARG A 75 VAL A 78 AA2 5 VAL A 151 ? ARG A 153 ? VAL A 131 ARG A 133 AA3 1 GLN A 143 ? ASN A 147 ? GLN A 123 ASN A 127 AA3 2 ASP A 41 ? GLY A 50 ? ASP A 21 GLY A 30 AA3 3 ARG A 351 ? ASP A 355 ? ARG A 331 ASP A 335 AA3 4 ILE A 328 ? VAL A 331 ? ILE A 308 VAL A 311 AA4 1 MET A 101 ? GLY A 103 ? MET A 81 GLY A 83 AA4 2 ILE A 123 ? MET A 124 ? ILE A 103 MET A 104 AA5 1 SER A 128 ? ALA A 129 ? SER A 108 ALA A 109 AA5 2 PRO A 135 ? THR A 136 ? PRO A 115 THR A 116 AA6 1 SER A 233 ? ILE A 236 ? SER A 213 ILE A 216 AA6 2 LYS A 211 ? SER A 216 ? LYS A 191 SER A 196 AA6 3 HIS A 188 ? VAL A 192 ? HIS A 168 VAL A 172 AA6 4 GLY A 252 ? ASP A 255 ? GLY A 232 ASP A 235 AA6 5 LYS A 276 ? ILE A 279 ? LYS A 256 ILE A 259 AA6 6 MET A 300 ? GLY A 303 ? MET A 280 GLY A 283 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 15 ? N THR A -5 O PHE A 32 ? O PHE A 12 AA2 1 2 O ALA A 146 ? O ALA A 126 N VAL A 42 ? N VAL A 22 AA2 2 3 N ARG A 43 ? N ARG A 23 O GLU A 82 ? O GLU A 62 AA2 3 4 N GLY A 78 ? N GLY A 58 O VAL A 96 ? O VAL A 76 AA2 4 5 N GLY A 97 ? N GLY A 77 O ILE A 152 ? O ILE A 132 AA3 1 2 O ALA A 146 ? O ALA A 126 N VAL A 42 ? N VAL A 22 AA3 2 3 N CYS A 49 ? N CYS A 29 O ILE A 354 ? O ILE A 334 AA3 3 4 O VAL A 353 ? O VAL A 333 N GLU A 329 ? N GLU A 309 AA4 1 2 N VAL A 102 ? N VAL A 82 O ILE A 123 ? O ILE A 103 AA5 1 2 N SER A 128 ? N SER A 108 O THR A 136 ? O THR A 116 AA6 1 2 O LEU A 235 ? O LEU A 215 N SER A 216 ? N SER A 196 AA6 2 3 O ILE A 215 ? O ILE A 195 N VAL A 191 ? N VAL A 171 AA6 3 4 N GLY A 190 ? N GLY A 170 O ILE A 254 ? O ILE A 234 AA6 4 5 N ILE A 253 ? N ILE A 233 O ILE A 278 ? O ILE A 258 AA6 5 6 N LEU A 277 ? N LEU A 257 O MET A 300 ? O MET A 280 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 401 ? 5 'binding site for residue ZN A 401' AC2 Software A SO4 402 ? 4 'binding site for residue SO4 A 402' AC3 Software A SO4 403 ? 5 'binding site for residue SO4 A 403' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 52 ? CYS A 32 . ? 1_555 ? 2 AC1 5 HIS A 74 ? HIS A 54 . ? 1_555 ? 3 AC1 5 GLU A 75 ? GLU A 55 . ? 1_555 ? 4 AC1 5 CYS A 168 ? CYS A 148 . ? 1_555 ? 5 AC1 5 HOH E . ? HOH A 522 . ? 1_555 ? 6 AC2 4 HIS A 53 ? HIS A 33 . ? 1_555 ? 7 AC2 4 GLY A 195 ? GLY A 175 . ? 1_555 ? 8 AC2 4 GLY A 196 ? GLY A 176 . ? 1_555 ? 9 AC2 4 ARG A 351 ? ARG A 331 . ? 1_555 ? 10 AC3 5 GLY A 193 ? GLY A 173 . ? 1_555 ? 11 AC3 5 LEU A 194 ? LEU A 174 . ? 1_555 ? 12 AC3 5 SER A 216 ? SER A 196 . ? 1_555 ? 13 AC3 5 THR A 217 ? THR A 197 . ? 1_555 ? 14 AC3 5 SER A 218 ? SER A 198 . ? 1_555 ? # _pdbx_entry_details.entry_id 7CGU _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 504 ? ? O A HOH 536 ? ? 2.07 2 1 NE2 A GLN 95 ? ? O A HOH 501 ? ? 2.16 3 1 OE1 A GLN 293 ? ? O A HOH 502 ? ? 2.18 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 96 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CG _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 96 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.675 _pdbx_validate_rmsd_bond.bond_target_value 1.517 _pdbx_validate_rmsd_bond.bond_deviation 0.158 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.019 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A CYS 88 ? ? CB A CYS 88 ? ? SG A CYS 88 ? ? 121.09 114.20 6.89 1.10 N 2 1 OE1 A GLU 96 ? ? CD A GLU 96 ? ? OE2 A GLU 96 ? ? 115.42 123.30 -7.88 1.20 N 3 1 C A GLU 96 ? ? N A SER 97 ? ? CA A SER 97 ? ? 137.25 121.70 15.55 2.50 Y 4 1 CB A LEU 177 ? ? CG A LEU 177 ? ? CD2 A LEU 177 ? ? 100.57 111.00 -10.43 1.70 N 5 1 CG A ARG 278 ? ? CD A ARG 278 ? ? NE A ARG 278 ? ? 126.73 111.80 14.93 2.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A -7 ? ? -153.55 -58.91 2 1 HIS A 54 ? ? -146.06 16.05 3 1 GLU A 55 ? ? -116.46 65.85 4 1 CYS A 88 ? ? -62.81 -170.67 5 1 GLN A 93 ? ? -108.88 45.14 6 1 GLN A 95 ? ? -113.86 64.31 7 1 SER A 97 ? ? -56.76 6.01 8 1 CYS A 148 ? ? -122.01 -62.48 9 1 CYS A 163 ? ? -144.67 40.17 10 1 LEU A 174 ? ? -119.48 57.36 11 1 LYS A 202 ? ? -37.46 -33.79 12 1 ASN A 217 ? ? -27.61 -59.02 13 1 GLN A 254 ? ? -174.67 -51.06 14 1 ALA A 285 ? ? -121.86 -160.95 15 1 ASN A 303 ? ? 35.36 58.41 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 GLN _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 95 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 GLU _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 96 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -145.61 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z+1/2 4 -x,-y,z+1/2 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A ALA -18 ? A ALA 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A GLU -16 ? A GLU 4 5 1 Y 1 A LYS -15 ? A LYS 5 6 1 Y 1 A SER -14 ? A SER 6 7 1 Y 1 A LEU -13 ? A LEU 7 8 1 Y 1 A GLU -12 ? A GLU 8 9 1 Y 1 A GLU -11 ? A GLU 9 10 1 Y 1 A LYS -10 ? A LYS 10 11 1 Y 1 A GLN -9 ? A GLN 11 12 1 Y 1 A GLN 344 ? A GLN 364 13 1 Y 1 A THR 345 ? A THR 365 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 SO4 S S N N 304 SO4 O1 O N N 305 SO4 O2 O N N 306 SO4 O3 O N N 307 SO4 O4 O N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 ZN ZN ZN N N 396 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1YQD _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'C 2 2 21' _space_group.name_Hall 'C 2c 2' _space_group.IT_number 20 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 7CGU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014701 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012048 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007625 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? ZN ? ? 24.64596 5.25405 ? ? 2.14387 29.76375 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #