data_7CHV
# 
_entry.id   7CHV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.380 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   7CHV         pdb_00007chv 10.2210/pdb7chv/pdb 
WWPDB D_1300017659 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7CHV 
_pdbx_database_status.recvd_initial_deposition_date   2020-07-06 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Yan, Y.-H.' 1 0000-0002-1331-1241 
'Li, G.-B.'  2 0000-0002-4915-6677 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   NE 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Acta Pharm Sin B' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2211-3835 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            11 
_citation.language                  ? 
_citation.page_first                1931 
_citation.page_last                 1946 
_citation.title                     
;AncPhore: A versatile tool for anchor pharmacophore steered drug discovery with applications in discovery of new inhibitors targeting metallo-beta-lactamases and indoleamine/tryptophan 2,3-dioxygenases.
;
_citation.year                      2021 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.apsb.2021.01.018 
_citation.pdbx_database_id_PubMed   34386329 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Dai, Q.'  1 ? 
primary 'Yan, Y.'  2 ? 
primary 'Ning, X.' 3 ? 
primary 'Li, G.'   4 ? 
primary 'Yu, J.'   5 ? 
primary 'Deng, J.' 6 ? 
primary 'Yang, L.' 7 ? 
primary 'Li, G.B.' 8 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7CHV 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     68.655 
_cell.length_a_esd                 ? 
_cell.length_b                     78.891 
_cell.length_b_esd                 ? 
_cell.length_c                     79.808 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7CHV 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Beta-lactamase class B VIM-2'                24679.439 1  ? ? ? ? 
2 non-polymer syn 'ZINC ION'                                    65.409    3  ? ? ? ? 
3 non-polymer syn '1-(phenylmethyl)imidazole-2-carboxylic acid' 202.209   1  ? ? ? ? 
4 non-polymer syn 'FORMIC ACID'                                 46.025    2  ? ? ? ? 
5 water       nat water                                         18.015    31 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;BlaVIM-2,Metallo beta lactamase VIM-2,Metallo beta-lactamase,Metallo-beta lactamase protein,Metallo-beta-lactamase VIM-2,VIM-2 class B beta-lactamase,VIM-2 class B metallo b-lactamase,VIM-2 metallo beta-lactamase,VIM-2 type metallo-beta-lactamase
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAV
STHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSA
SVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAV
STHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSA
SVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   TYR n 
1 3   PRO n 
1 4   THR n 
1 5   VAL n 
1 6   SER n 
1 7   GLU n 
1 8   ILE n 
1 9   PRO n 
1 10  VAL n 
1 11  GLY n 
1 12  GLU n 
1 13  VAL n 
1 14  ARG n 
1 15  LEU n 
1 16  TYR n 
1 17  GLN n 
1 18  ILE n 
1 19  ALA n 
1 20  ASP n 
1 21  GLY n 
1 22  VAL n 
1 23  TRP n 
1 24  SER n 
1 25  HIS n 
1 26  ILE n 
1 27  ALA n 
1 28  THR n 
1 29  GLN n 
1 30  SER n 
1 31  PHE n 
1 32  ASP n 
1 33  GLY n 
1 34  ALA n 
1 35  VAL n 
1 36  TYR n 
1 37  PRO n 
1 38  SER n 
1 39  ASN n 
1 40  GLY n 
1 41  LEU n 
1 42  ILE n 
1 43  VAL n 
1 44  ARG n 
1 45  ASP n 
1 46  GLY n 
1 47  ASP n 
1 48  GLU n 
1 49  LEU n 
1 50  LEU n 
1 51  LEU n 
1 52  ILE n 
1 53  ASP n 
1 54  THR n 
1 55  ALA n 
1 56  TRP n 
1 57  GLY n 
1 58  ALA n 
1 59  LYS n 
1 60  ASN n 
1 61  THR n 
1 62  ALA n 
1 63  ALA n 
1 64  LEU n 
1 65  LEU n 
1 66  ALA n 
1 67  GLU n 
1 68  ILE n 
1 69  GLU n 
1 70  LYS n 
1 71  GLN n 
1 72  ILE n 
1 73  GLY n 
1 74  LEU n 
1 75  PRO n 
1 76  VAL n 
1 77  THR n 
1 78  ARG n 
1 79  ALA n 
1 80  VAL n 
1 81  SER n 
1 82  THR n 
1 83  HIS n 
1 84  PHE n 
1 85  HIS n 
1 86  ASP n 
1 87  ASP n 
1 88  ARG n 
1 89  VAL n 
1 90  GLY n 
1 91  GLY n 
1 92  VAL n 
1 93  ASP n 
1 94  VAL n 
1 95  LEU n 
1 96  ARG n 
1 97  ALA n 
1 98  ALA n 
1 99  GLY n 
1 100 VAL n 
1 101 ALA n 
1 102 THR n 
1 103 TYR n 
1 104 ALA n 
1 105 SER n 
1 106 PRO n 
1 107 SER n 
1 108 THR n 
1 109 ARG n 
1 110 ARG n 
1 111 LEU n 
1 112 ALA n 
1 113 GLU n 
1 114 VAL n 
1 115 GLU n 
1 116 GLY n 
1 117 ASN n 
1 118 GLU n 
1 119 ILE n 
1 120 PRO n 
1 121 THR n 
1 122 HIS n 
1 123 SER n 
1 124 LEU n 
1 125 GLU n 
1 126 GLY n 
1 127 LEU n 
1 128 SER n 
1 129 SER n 
1 130 SER n 
1 131 GLY n 
1 132 ASP n 
1 133 ALA n 
1 134 VAL n 
1 135 ARG n 
1 136 PHE n 
1 137 GLY n 
1 138 PRO n 
1 139 VAL n 
1 140 GLU n 
1 141 LEU n 
1 142 PHE n 
1 143 TYR n 
1 144 PRO n 
1 145 GLY n 
1 146 ALA n 
1 147 ALA n 
1 148 HIS n 
1 149 SER n 
1 150 THR n 
1 151 ASP n 
1 152 ASN n 
1 153 LEU n 
1 154 VAL n 
1 155 VAL n 
1 156 TYR n 
1 157 VAL n 
1 158 PRO n 
1 159 SER n 
1 160 ALA n 
1 161 SER n 
1 162 VAL n 
1 163 LEU n 
1 164 TYR n 
1 165 GLY n 
1 166 GLY n 
1 167 CYS n 
1 168 ALA n 
1 169 ILE n 
1 170 TYR n 
1 171 GLU n 
1 172 LEU n 
1 173 SER n 
1 174 ARG n 
1 175 THR n 
1 176 SER n 
1 177 ALA n 
1 178 GLY n 
1 179 ASN n 
1 180 VAL n 
1 181 ALA n 
1 182 ASP n 
1 183 ALA n 
1 184 ASP n 
1 185 LEU n 
1 186 ALA n 
1 187 GLU n 
1 188 TRP n 
1 189 PRO n 
1 190 THR n 
1 191 SER n 
1 192 ILE n 
1 193 GLU n 
1 194 ARG n 
1 195 ILE n 
1 196 GLN n 
1 197 GLN n 
1 198 HIS n 
1 199 TYR n 
1 200 PRO n 
1 201 GLU n 
1 202 ALA n 
1 203 GLN n 
1 204 PHE n 
1 205 VAL n 
1 206 ILE n 
1 207 PRO n 
1 208 GLY n 
1 209 HIS n 
1 210 GLY n 
1 211 LEU n 
1 212 PRO n 
1 213 GLY n 
1 214 GLY n 
1 215 LEU n 
1 216 ASP n 
1 217 LEU n 
1 218 LEU n 
1 219 LYS n 
1 220 HIS n 
1 221 THR n 
1 222 THR n 
1 223 ASN n 
1 224 VAL n 
1 225 VAL n 
1 226 LYS n 
1 227 ALA n 
1 228 HIS n 
1 229 THR n 
1 230 ASN n 
1 231 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   231 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 
'blaVIM-2, bla vim-2, bla-VIM-2, blasVIM-2, blaVIM2, blm, VIM-2, vim-2, PAERUG_P32_London_17_VIM_2_10_11_06255' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pseudomonas aeruginosa' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     287 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q9K2N0_PSEAI 
_struct_ref.pdbx_db_accession          Q9K2N0 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAV
STHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSA
SVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNR
;
_struct_ref.pdbx_align_begin           32 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              7CHV 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 231 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9K2N0 
_struct_ref_seq.db_align_beg                  32 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  262 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       32 
_struct_ref_seq.pdbx_auth_seq_align_end       262 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'   121.158 
FMT non-polymer         . 'FORMIC ACID'                                 ? 'C H2 O2'        46.025  
FZX non-polymer         . '1-(phenylmethyl)imidazole-2-carboxylic acid' ? 'C11 H10 N2 O2'  202.209 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                         ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'                                    ? 'Zn 2'           65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7CHV 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.19 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         43.82 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '28%-35%PEG3350, 0.1M Mg(COOH)2' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     195 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 X CdTe 1M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2019-05-09 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL19U1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL19U1 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            41.040 
_reflns.entry_id                         7CHV 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.17 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       11610 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  10.000 
_reflns.pdbx_Rmerge_I_obs                0.226 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            3.700 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 2.163 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.240 
_reflns.pdbx_Rpim_I_all                  0.078 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_CC_star 
_reflns_shell.pdbx_R_split 
2.200 2.240  ? ? ? ? ? ? 569 99.800  ? ? ? ? 1.001 ? ? ? ? ? ? ? ? 8.200  ? 0.863 ? ? 1.067 0.364 ? 1  1 0.564 ? ? 
2.240 2.280  ? ? ? ? ? ? 572 100.000 ? ? ? ? 1.004 ? ? ? ? ? ? ? ? 9.700  ? 0.783 ? ? 1.061 0.338 ? 2  1 0.692 ? ? 
2.280 2.320  ? ? ? ? ? ? 562 100.000 ? ? ? ? 0.929 ? ? ? ? ? ? ? ? 10.100 ? 0.843 ? ? 0.979 0.305 ? 3  1 0.721 ? ? 
2.320 2.370  ? ? ? ? ? ? 589 100.000 ? ? ? ? 0.796 ? ? ? ? ? ? ? ? 10.200 ? 0.948 ? ? 0.838 0.259 ? 4  1 0.795 ? ? 
2.370 2.420  ? ? ? ? ? ? 554 100.000 ? ? ? ? 0.711 ? ? ? ? ? ? ? ? 10.500 ? 1.155 ? ? 0.748 0.230 ? 5  1 0.775 ? ? 
2.420 2.480  ? ? ? ? ? ? 575 100.000 ? ? ? ? 0.672 ? ? ? ? ? ? ? ? 10.400 ? 1.219 ? ? 0.707 0.218 ? 6  1 0.810 ? ? 
2.480 2.540  ? ? ? ? ? ? 570 100.000 ? ? ? ? 0.606 ? ? ? ? ? ? ? ? 10.400 ? 1.414 ? ? 0.638 0.196 ? 7  1 0.813 ? ? 
2.540 2.610  ? ? ? ? ? ? 562 100.000 ? ? ? ? 0.554 ? ? ? ? ? ? ? ? 10.600 ? 1.453 ? ? 0.582 0.179 ? 8  1 0.846 ? ? 
2.610 2.690  ? ? ? ? ? ? 591 100.000 ? ? ? ? 0.498 ? ? ? ? ? ? ? ? 10.300 ? 1.767 ? ? 0.525 0.163 ? 9  1 0.881 ? ? 
2.690 2.770  ? ? ? ? ? ? 581 99.700  ? ? ? ? 0.460 ? ? ? ? ? ? ? ? 10.100 ? 2.049 ? ? 0.485 0.151 ? 10 1 0.905 ? ? 
2.770 2.870  ? ? ? ? ? ? 571 99.800  ? ? ? ? 0.385 ? ? ? ? ? ? ? ? 9.000  ? 2.239 ? ? 0.409 0.135 ? 11 1 0.932 ? ? 
2.870 2.990  ? ? ? ? ? ? 573 100.000 ? ? ? ? 0.348 ? ? ? ? ? ? ? ? 10.400 ? 2.252 ? ? 0.367 0.114 ? 12 1 0.948 ? ? 
2.990 3.120  ? ? ? ? ? ? 572 100.000 ? ? ? ? 0.313 ? ? ? ? ? ? ? ? 10.800 ? 2.472 ? ? 0.329 0.101 ? 13 1 0.963 ? ? 
3.120 3.290  ? ? ? ? ? ? 586 100.000 ? ? ? ? 0.265 ? ? ? ? ? ? ? ? 10.700 ? 2.816 ? ? 0.279 0.087 ? 14 1 0.954 ? ? 
3.290 3.490  ? ? ? ? ? ? 583 100.000 ? ? ? ? 0.238 ? ? ? ? ? ? ? ? 10.300 ? 3.381 ? ? 0.251 0.080 ? 15 1 0.963 ? ? 
3.490 3.760  ? ? ? ? ? ? 580 100.000 ? ? ? ? 0.200 ? ? ? ? ? ? ? ? 10.000 ? 3.366 ? ? 0.211 0.068 ? 16 1 0.966 ? ? 
3.760 4.140  ? ? ? ? ? ? 588 99.700  ? ? ? ? 0.179 ? ? ? ? ? ? ? ? 9.100  ? 3.494 ? ? 0.191 0.065 ? 17 1 0.977 ? ? 
4.140 4.740  ? ? ? ? ? ? 598 99.800  ? ? ? ? 0.159 ? ? ? ? ? ? ? ? 9.800  ? 3.598 ? ? 0.169 0.056 ? 18 1 0.973 ? ? 
4.740 5.970  ? ? ? ? ? ? 596 99.700  ? ? ? ? 0.152 ? ? ? ? ? ? ? ? 10.200 ? 3.117 ? ? 0.161 0.051 ? 19 1 0.987 ? ? 
5.970 50.000 ? ? ? ? ? ? 638 99.400  ? ? ? ? 0.146 ? ? ? ? ? ? ? ? 9.100  ? 3.780 ? ? 0.157 0.056 ? 20 1 0.895 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                92.530 
_refine.B_iso_mean                               44.1638 
_refine.B_iso_min                                16.330 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7CHV 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.1740 
_refine.ls_d_res_low                             34.3270 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     11602 
_refine.ls_number_reflns_R_free                  1160 
_refine.ls_number_reflns_R_work                  10442 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.8700 
_refine.ls_percent_reflns_R_free                 10.0000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2566 
_refine.ls_R_factor_R_free                       0.3635 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2453 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6JN6 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 38.7800 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4700 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.1740 
_refine_hist.d_res_low                        34.3270 
_refine_hist.number_atoms_solvent             31 
_refine_hist.number_atoms_total               1775 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       231 
_refine_hist.pdbx_B_iso_mean_ligand           43.34 
_refine_hist.pdbx_B_iso_mean_solvent          37.91 
_refine_hist.pdbx_number_atoms_protein        1720 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         24 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.021  ? 1793 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.276  ? 2435 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.060  ? 279  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.008  ? 319  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 15.629 ? 1030 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.1740 2.2727  . . 134 1194 92.0000  . . . 0.4222 0.0000 0.3286 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2727 2.3925  . . 141 1293 100.0000 . . . 0.4132 0.0000 0.3314 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3925 2.5423  . . 145 1310 100.0000 . . . 0.4051 0.0000 0.3112 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5423 2.7385  . . 146 1296 100.0000 . . . 0.3844 0.0000 0.2948 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7385 3.0140  . . 145 1309 100.0000 . . . 0.4203 0.0000 0.2806 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0140 3.4498  . . 149 1320 100.0000 . . . 0.4242 0.0000 0.2713 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4498 4.3450  . . 147 1333 100.0000 . . . 0.3518 0.0000 0.2198 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3450 34.3270 . . 153 1387 99.0000  . . . 0.2899 0.0000 0.1914 . . . . . . . . . . . 
# 
_struct.entry_id                     7CHV 
_struct.title                        'Metallo-Beta-Lactamase VIM-2 in complex with 1-benzyl-1H-imidazole-2-carboxylic acid' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7CHV 
_struct_keywords.text            'Metallo-beta-lactamase VIM-2, VIM-2, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 THR A 4   ? ILE A 8   ? THR A 35  ILE A 39  5 ? 5  
HELX_P HELX_P2 AA2 GLY A 57  ? ILE A 72  ? GLY A 88  ILE A 103 1 ? 16 
HELX_P HELX_P3 AA3 HIS A 85  ? GLY A 90  ? HIS A 116 GLY A 121 1 ? 6  
HELX_P HELX_P4 AA4 GLY A 91  ? ALA A 98  ? GLY A 122 ALA A 129 1 ? 8  
HELX_P HELX_P5 AA5 SER A 105 ? GLY A 116 ? SER A 136 GLY A 147 1 ? 12 
HELX_P HELX_P6 AA6 PRO A 158 ? ALA A 160 ? PRO A 189 ALA A 191 5 ? 3  
HELX_P HELX_P7 AA7 CYS A 167 ? ILE A 169 ? CYS A 198 ILE A 200 5 ? 3  
HELX_P HELX_P8 AA8 GLU A 187 ? TYR A 199 ? GLU A 218 TYR A 230 1 ? 13 
HELX_P HELX_P9 AA9 LEU A 215 ? ASN A 230 ? LEU A 246 ASN A 261 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A HIS 83  NE2 ? ? ? 1_555 B ZN  . ZN  ? ? A HIS 114 A ZN  301 1_555 ? ? ? ? ? ? ? 2.058 ? ? 
metalc2  metalc ? ? A HIS 85  ND1 ? ? ? 1_555 B ZN  . ZN  ? ? A HIS 116 A ZN  301 1_555 ? ? ? ? ? ? ? 1.902 ? ? 
metalc3  metalc ? ? A ASP 87  OD2 ? ? ? 1_555 C ZN  . ZN  ? ? A ASP 118 A ZN  302 1_555 ? ? ? ? ? ? ? 2.167 ? ? 
metalc4  metalc ? ? A HIS 122 NE2 ? ? ? 1_555 D ZN  . ZN  ? ? A HIS 153 A ZN  303 6_444 ? ? ? ? ? ? ? 2.217 ? ? 
metalc5  metalc ? ? A HIS 148 NE2 ? ? ? 1_555 B ZN  . ZN  ? ? A HIS 179 A ZN  301 1_555 ? ? ? ? ? ? ? 2.007 ? ? 
metalc6  metalc ? ? A CYS 167 SG  ? ? ? 1_555 C ZN  . ZN  ? ? A CYS 198 A ZN  302 1_555 ? ? ? ? ? ? ? 2.380 ? ? 
metalc7  metalc ? ? A HIS 209 NE2 ? ? ? 1_555 C ZN  . ZN  ? ? A HIS 240 A ZN  302 1_555 ? ? ? ? ? ? ? 2.221 ? ? 
metalc8  metalc ? ? A HIS 220 ND1 ? ? ? 1_555 D ZN  . ZN  ? ? A HIS 251 A ZN  303 1_555 ? ? ? ? ? ? ? 2.120 ? ? 
metalc9  metalc ? ? B ZN  .   ZN  ? ? ? 1_555 H HOH . O   ? ? A ZN  301 A HOH 411 1_555 ? ? ? ? ? ? ? 2.040 ? ? 
metalc10 metalc ? ? C ZN  .   ZN  ? ? ? 1_555 E FZX . O08 ? ? A ZN  302 A FZX 304 1_555 ? ? ? ? ? ? ? 2.241 ? ? 
metalc11 metalc ? ? C ZN  .   ZN  ? ? ? 1_555 E FZX . N05 ? ? A ZN  302 A FZX 304 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc12 metalc ? ? C ZN  .   ZN  ? ? ? 1_555 H HOH . O   ? ? A ZN  302 A HOH 411 1_555 ? ? ? ? ? ? ? 2.432 ? ? 
metalc13 metalc ? ? D ZN  .   ZN  ? ? ? 1_555 F FMT . O1  ? ? A ZN  303 A FMT 305 1_555 ? ? ? ? ? ? ? 2.458 ? ? 
metalc14 metalc ? ? D ZN  .   ZN  ? ? ? 1_555 G FMT . O2  ? ? A ZN  303 A FMT 306 1_555 ? ? ? ? ? ? ? 1.766 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           130 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            161 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   GLY 
_struct_mon_prot_cis.pdbx_label_seq_id_2    131 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    GLY 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     162 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -12.78 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7 ? 
AA2 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 14  ? ALA A 19  ? ARG A 45  ALA A 50  
AA1 2 VAL A 22  ? PHE A 31  ? VAL A 53  PHE A 62  
AA1 3 ALA A 34  ? ASP A 45  ? ALA A 65  ASP A 76  
AA1 4 GLU A 48  ? ILE A 52  ? GLU A 79  ILE A 83  
AA1 5 VAL A 76  ? VAL A 80  ? VAL A 107 VAL A 111 
AA1 6 ALA A 101 ? ALA A 104 ? ALA A 132 ALA A 135 
AA1 7 HIS A 122 ? SER A 123 ? HIS A 153 SER A 154 
AA2 1 ASP A 132 ? PHE A 136 ? ASP A 163 PHE A 167 
AA2 2 VAL A 139 ? TYR A 143 ? VAL A 170 TYR A 174 
AA2 3 VAL A 154 ? VAL A 157 ? VAL A 185 VAL A 188 
AA2 4 VAL A 162 ? GLY A 166 ? VAL A 193 GLY A 197 
AA2 5 PHE A 204 ? PRO A 207 ? PHE A 235 PRO A 238 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A 19  ? N ALA A 50  O VAL A 22  ? O VAL A 53  
AA1 2 3 N TRP A 23  ? N TRP A 54  O ILE A 42  ? O ILE A 73  
AA1 3 4 N LEU A 41  ? N LEU A 72  O ILE A 52  ? O ILE A 83  
AA1 4 5 N LEU A 49  ? N LEU A 80  O THR A 77  ? O THR A 108 
AA1 5 6 N THR A 77  ? N THR A 108 O ALA A 101 ? O ALA A 132 
AA1 6 7 N THR A 102 ? N THR A 133 O HIS A 122 ? O HIS A 153 
AA2 1 2 N VAL A 134 ? N VAL A 165 O LEU A 141 ? O LEU A 172 
AA2 2 3 N PHE A 142 ? N PHE A 173 O VAL A 154 ? O VAL A 185 
AA2 3 4 N VAL A 157 ? N VAL A 188 O VAL A 162 ? O VAL A 193 
AA2 4 5 N GLY A 165 ? N GLY A 196 O ILE A 206 ? O ILE A 237 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  301 ? 4 'binding site for residue ZN A 301'  
AC2 Software A ZN  302 ? 5 'binding site for residue ZN A 302'  
AC3 Software A ZN  303 ? 4 'binding site for residue ZN A 303'  
AC4 Software A FZX 304 ? 9 'binding site for residue FZX A 304' 
AC5 Software A FMT 305 ? 6 'binding site for residue FMT A 305' 
AC6 Software A FMT 306 ? 6 'binding site for residue FMT A 306' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS A 83  ? HIS A 114 . ? 1_555 ? 
2  AC1 4 HIS A 85  ? HIS A 116 . ? 1_555 ? 
3  AC1 4 HIS A 148 ? HIS A 179 . ? 1_555 ? 
4  AC1 4 HOH H .   ? HOH A 411 . ? 1_555 ? 
5  AC2 5 ASP A 87  ? ASP A 118 . ? 1_555 ? 
6  AC2 5 CYS A 167 ? CYS A 198 . ? 1_555 ? 
7  AC2 5 HIS A 209 ? HIS A 240 . ? 1_555 ? 
8  AC2 5 FZX E .   ? FZX A 304 . ? 1_555 ? 
9  AC2 5 HOH H .   ? HOH A 411 . ? 1_555 ? 
10 AC3 4 HIS A 122 ? HIS A 153 . ? 6_445 ? 
11 AC3 4 HIS A 220 ? HIS A 251 . ? 1_555 ? 
12 AC3 4 FMT F .   ? FMT A 305 . ? 1_555 ? 
13 AC3 4 FMT G .   ? FMT A 306 . ? 1_555 ? 
14 AC4 9 TYR A 36  ? TYR A 67  . ? 1_555 ? 
15 AC4 9 ASP A 87  ? ASP A 118 . ? 1_555 ? 
16 AC4 9 HIS A 148 ? HIS A 179 . ? 1_555 ? 
17 AC4 9 CYS A 167 ? CYS A 198 . ? 1_555 ? 
18 AC4 9 ARG A 174 ? ARG A 205 . ? 1_555 ? 
19 AC4 9 HIS A 209 ? HIS A 240 . ? 1_555 ? 
20 AC4 9 ZN  C .   ? ZN  A 302 . ? 1_555 ? 
21 AC4 9 HOH H .   ? HOH A 409 . ? 1_555 ? 
22 AC4 9 HOH H .   ? HOH A 411 . ? 1_555 ? 
23 AC5 6 ALA A 101 ? ALA A 132 . ? 6_445 ? 
24 AC5 6 HIS A 122 ? HIS A 153 . ? 6_445 ? 
25 AC5 6 THR A 175 ? THR A 206 . ? 1_555 ? 
26 AC5 6 HIS A 220 ? HIS A 251 . ? 1_555 ? 
27 AC5 6 ZN  D .   ? ZN  A 303 . ? 1_555 ? 
28 AC5 6 FMT G .   ? FMT A 306 . ? 1_555 ? 
29 AC6 6 THR A 121 ? THR A 152 . ? 6_445 ? 
30 AC6 6 HIS A 122 ? HIS A 153 . ? 6_445 ? 
31 AC6 6 HIS A 220 ? HIS A 251 . ? 1_555 ? 
32 AC6 6 ASN A 223 ? ASN A 254 . ? 1_555 ? 
33 AC6 6 ZN  D .   ? ZN  A 303 . ? 1_555 ? 
34 AC6 6 FMT F .   ? FMT A 305 . ? 1_555 ? 
# 
_atom_sites.entry_id                    7CHV 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.014566 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012676 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012530 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   32  32  GLU GLU A . n 
A 1 2   TYR 2   33  33  TYR TYR A . n 
A 1 3   PRO 3   34  34  PRO PRO A . n 
A 1 4   THR 4   35  35  THR THR A . n 
A 1 5   VAL 5   36  36  VAL VAL A . n 
A 1 6   SER 6   37  37  SER SER A . n 
A 1 7   GLU 7   38  38  GLU GLU A . n 
A 1 8   ILE 8   39  39  ILE ILE A . n 
A 1 9   PRO 9   40  40  PRO PRO A . n 
A 1 10  VAL 10  41  41  VAL VAL A . n 
A 1 11  GLY 11  42  42  GLY GLY A . n 
A 1 12  GLU 12  43  43  GLU GLU A . n 
A 1 13  VAL 13  44  44  VAL VAL A . n 
A 1 14  ARG 14  45  45  ARG ARG A . n 
A 1 15  LEU 15  46  46  LEU LEU A . n 
A 1 16  TYR 16  47  47  TYR TYR A . n 
A 1 17  GLN 17  48  48  GLN GLN A . n 
A 1 18  ILE 18  49  49  ILE ILE A . n 
A 1 19  ALA 19  50  50  ALA ALA A . n 
A 1 20  ASP 20  51  51  ASP ASP A . n 
A 1 21  GLY 21  52  52  GLY GLY A . n 
A 1 22  VAL 22  53  53  VAL VAL A . n 
A 1 23  TRP 23  54  54  TRP TRP A . n 
A 1 24  SER 24  55  55  SER SER A . n 
A 1 25  HIS 25  56  56  HIS HIS A . n 
A 1 26  ILE 26  57  57  ILE ILE A . n 
A 1 27  ALA 27  58  58  ALA ALA A . n 
A 1 28  THR 28  59  59  THR THR A . n 
A 1 29  GLN 29  60  60  GLN GLN A . n 
A 1 30  SER 30  61  61  SER SER A . n 
A 1 31  PHE 31  62  62  PHE PHE A . n 
A 1 32  ASP 32  63  63  ASP ASP A . n 
A 1 33  GLY 33  64  64  GLY GLY A . n 
A 1 34  ALA 34  65  65  ALA ALA A . n 
A 1 35  VAL 35  66  66  VAL VAL A . n 
A 1 36  TYR 36  67  67  TYR TYR A . n 
A 1 37  PRO 37  68  68  PRO PRO A . n 
A 1 38  SER 38  69  69  SER SER A . n 
A 1 39  ASN 39  70  70  ASN ASN A . n 
A 1 40  GLY 40  71  71  GLY GLY A . n 
A 1 41  LEU 41  72  72  LEU LEU A . n 
A 1 42  ILE 42  73  73  ILE ILE A . n 
A 1 43  VAL 43  74  74  VAL VAL A . n 
A 1 44  ARG 44  75  75  ARG ARG A . n 
A 1 45  ASP 45  76  76  ASP ASP A . n 
A 1 46  GLY 46  77  77  GLY GLY A . n 
A 1 47  ASP 47  78  78  ASP ASP A . n 
A 1 48  GLU 48  79  79  GLU GLU A . n 
A 1 49  LEU 49  80  80  LEU LEU A . n 
A 1 50  LEU 50  81  81  LEU LEU A . n 
A 1 51  LEU 51  82  82  LEU LEU A . n 
A 1 52  ILE 52  83  83  ILE ILE A . n 
A 1 53  ASP 53  84  84  ASP ASP A . n 
A 1 54  THR 54  85  85  THR THR A . n 
A 1 55  ALA 55  86  86  ALA ALA A . n 
A 1 56  TRP 56  87  87  TRP TRP A . n 
A 1 57  GLY 57  88  88  GLY GLY A . n 
A 1 58  ALA 58  89  89  ALA ALA A . n 
A 1 59  LYS 59  90  90  LYS LYS A . n 
A 1 60  ASN 60  91  91  ASN ASN A . n 
A 1 61  THR 61  92  92  THR THR A . n 
A 1 62  ALA 62  93  93  ALA ALA A . n 
A 1 63  ALA 63  94  94  ALA ALA A . n 
A 1 64  LEU 64  95  95  LEU LEU A . n 
A 1 65  LEU 65  96  96  LEU LEU A . n 
A 1 66  ALA 66  97  97  ALA ALA A . n 
A 1 67  GLU 67  98  98  GLU GLU A . n 
A 1 68  ILE 68  99  99  ILE ILE A . n 
A 1 69  GLU 69  100 100 GLU GLU A . n 
A 1 70  LYS 70  101 101 LYS LYS A . n 
A 1 71  GLN 71  102 102 GLN GLN A . n 
A 1 72  ILE 72  103 103 ILE ILE A . n 
A 1 73  GLY 73  104 104 GLY GLY A . n 
A 1 74  LEU 74  105 105 LEU LEU A . n 
A 1 75  PRO 75  106 106 PRO PRO A . n 
A 1 76  VAL 76  107 107 VAL VAL A . n 
A 1 77  THR 77  108 108 THR THR A . n 
A 1 78  ARG 78  109 109 ARG ARG A . n 
A 1 79  ALA 79  110 110 ALA ALA A . n 
A 1 80  VAL 80  111 111 VAL VAL A . n 
A 1 81  SER 81  112 112 SER SER A . n 
A 1 82  THR 82  113 113 THR THR A . n 
A 1 83  HIS 83  114 114 HIS HIS A . n 
A 1 84  PHE 84  115 115 PHE PHE A . n 
A 1 85  HIS 85  116 116 HIS HIS A . n 
A 1 86  ASP 86  117 117 ASP ASP A . n 
A 1 87  ASP 87  118 118 ASP ASP A . n 
A 1 88  ARG 88  119 119 ARG ARG A . n 
A 1 89  VAL 89  120 120 VAL VAL A . n 
A 1 90  GLY 90  121 121 GLY GLY A . n 
A 1 91  GLY 91  122 122 GLY GLY A . n 
A 1 92  VAL 92  123 123 VAL VAL A . n 
A 1 93  ASP 93  124 124 ASP ASP A . n 
A 1 94  VAL 94  125 125 VAL VAL A . n 
A 1 95  LEU 95  126 126 LEU LEU A . n 
A 1 96  ARG 96  127 127 ARG ARG A . n 
A 1 97  ALA 97  128 128 ALA ALA A . n 
A 1 98  ALA 98  129 129 ALA ALA A . n 
A 1 99  GLY 99  130 130 GLY GLY A . n 
A 1 100 VAL 100 131 131 VAL VAL A . n 
A 1 101 ALA 101 132 132 ALA ALA A . n 
A 1 102 THR 102 133 133 THR THR A . n 
A 1 103 TYR 103 134 134 TYR TYR A . n 
A 1 104 ALA 104 135 135 ALA ALA A . n 
A 1 105 SER 105 136 136 SER SER A . n 
A 1 106 PRO 106 137 137 PRO PRO A . n 
A 1 107 SER 107 138 138 SER SER A . n 
A 1 108 THR 108 139 139 THR THR A . n 
A 1 109 ARG 109 140 140 ARG ARG A . n 
A 1 110 ARG 110 141 141 ARG ARG A . n 
A 1 111 LEU 111 142 142 LEU LEU A . n 
A 1 112 ALA 112 143 143 ALA ALA A . n 
A 1 113 GLU 113 144 144 GLU GLU A . n 
A 1 114 VAL 114 145 145 VAL VAL A . n 
A 1 115 GLU 115 146 146 GLU GLU A . n 
A 1 116 GLY 116 147 147 GLY GLY A . n 
A 1 117 ASN 117 148 148 ASN ASN A . n 
A 1 118 GLU 118 149 149 GLU GLU A . n 
A 1 119 ILE 119 150 150 ILE ILE A . n 
A 1 120 PRO 120 151 151 PRO PRO A . n 
A 1 121 THR 121 152 152 THR THR A . n 
A 1 122 HIS 122 153 153 HIS HIS A . n 
A 1 123 SER 123 154 154 SER SER A . n 
A 1 124 LEU 124 155 155 LEU LEU A . n 
A 1 125 GLU 125 156 156 GLU GLU A . n 
A 1 126 GLY 126 157 157 GLY GLY A . n 
A 1 127 LEU 127 158 158 LEU LEU A . n 
A 1 128 SER 128 159 159 SER SER A . n 
A 1 129 SER 129 160 160 SER SER A . n 
A 1 130 SER 130 161 161 SER SER A . n 
A 1 131 GLY 131 162 162 GLY GLY A . n 
A 1 132 ASP 132 163 163 ASP ASP A . n 
A 1 133 ALA 133 164 164 ALA ALA A . n 
A 1 134 VAL 134 165 165 VAL VAL A . n 
A 1 135 ARG 135 166 166 ARG ARG A . n 
A 1 136 PHE 136 167 167 PHE PHE A . n 
A 1 137 GLY 137 168 168 GLY GLY A . n 
A 1 138 PRO 138 169 169 PRO PRO A . n 
A 1 139 VAL 139 170 170 VAL VAL A . n 
A 1 140 GLU 140 171 171 GLU GLU A . n 
A 1 141 LEU 141 172 172 LEU LEU A . n 
A 1 142 PHE 142 173 173 PHE PHE A . n 
A 1 143 TYR 143 174 174 TYR TYR A . n 
A 1 144 PRO 144 175 175 PRO PRO A . n 
A 1 145 GLY 145 176 176 GLY GLY A . n 
A 1 146 ALA 146 177 177 ALA ALA A . n 
A 1 147 ALA 147 178 178 ALA ALA A . n 
A 1 148 HIS 148 179 179 HIS HIS A . n 
A 1 149 SER 149 180 180 SER SER A . n 
A 1 150 THR 150 181 181 THR THR A . n 
A 1 151 ASP 151 182 182 ASP ASP A . n 
A 1 152 ASN 152 183 183 ASN ASN A . n 
A 1 153 LEU 153 184 184 LEU LEU A . n 
A 1 154 VAL 154 185 185 VAL VAL A . n 
A 1 155 VAL 155 186 186 VAL VAL A . n 
A 1 156 TYR 156 187 187 TYR TYR A . n 
A 1 157 VAL 157 188 188 VAL VAL A . n 
A 1 158 PRO 158 189 189 PRO PRO A . n 
A 1 159 SER 159 190 190 SER SER A . n 
A 1 160 ALA 160 191 191 ALA ALA A . n 
A 1 161 SER 161 192 192 SER SER A . n 
A 1 162 VAL 162 193 193 VAL VAL A . n 
A 1 163 LEU 163 194 194 LEU LEU A . n 
A 1 164 TYR 164 195 195 TYR TYR A . n 
A 1 165 GLY 165 196 196 GLY GLY A . n 
A 1 166 GLY 166 197 197 GLY GLY A . n 
A 1 167 CYS 167 198 198 CYS CYS A . n 
A 1 168 ALA 168 199 199 ALA ALA A . n 
A 1 169 ILE 169 200 200 ILE ILE A . n 
A 1 170 TYR 170 201 201 TYR TYR A . n 
A 1 171 GLU 171 202 202 GLU GLU A . n 
A 1 172 LEU 172 203 203 LEU LEU A . n 
A 1 173 SER 173 204 204 SER SER A . n 
A 1 174 ARG 174 205 205 ARG ARG A . n 
A 1 175 THR 175 206 206 THR THR A . n 
A 1 176 SER 176 207 207 SER SER A . n 
A 1 177 ALA 177 208 208 ALA ALA A . n 
A 1 178 GLY 178 209 209 GLY GLY A . n 
A 1 179 ASN 179 210 210 ASN ASN A . n 
A 1 180 VAL 180 211 211 VAL VAL A . n 
A 1 181 ALA 181 212 212 ALA ALA A . n 
A 1 182 ASP 182 213 213 ASP ASP A . n 
A 1 183 ALA 183 214 214 ALA ALA A . n 
A 1 184 ASP 184 215 215 ASP ASP A . n 
A 1 185 LEU 185 216 216 LEU LEU A . n 
A 1 186 ALA 186 217 217 ALA ALA A . n 
A 1 187 GLU 187 218 218 GLU GLU A . n 
A 1 188 TRP 188 219 219 TRP TRP A . n 
A 1 189 PRO 189 220 220 PRO PRO A . n 
A 1 190 THR 190 221 221 THR THR A . n 
A 1 191 SER 191 222 222 SER SER A . n 
A 1 192 ILE 192 223 223 ILE ILE A . n 
A 1 193 GLU 193 224 224 GLU GLU A . n 
A 1 194 ARG 194 225 225 ARG ARG A . n 
A 1 195 ILE 195 226 226 ILE ILE A . n 
A 1 196 GLN 196 227 227 GLN GLN A . n 
A 1 197 GLN 197 228 228 GLN GLN A . n 
A 1 198 HIS 198 229 229 HIS HIS A . n 
A 1 199 TYR 199 230 230 TYR TYR A . n 
A 1 200 PRO 200 231 231 PRO PRO A . n 
A 1 201 GLU 201 232 232 GLU GLU A . n 
A 1 202 ALA 202 233 233 ALA ALA A . n 
A 1 203 GLN 203 234 234 GLN GLN A . n 
A 1 204 PHE 204 235 235 PHE PHE A . n 
A 1 205 VAL 205 236 236 VAL VAL A . n 
A 1 206 ILE 206 237 237 ILE ILE A . n 
A 1 207 PRO 207 238 238 PRO PRO A . n 
A 1 208 GLY 208 239 239 GLY GLY A . n 
A 1 209 HIS 209 240 240 HIS HIS A . n 
A 1 210 GLY 210 241 241 GLY GLY A . n 
A 1 211 LEU 211 242 242 LEU LEU A . n 
A 1 212 PRO 212 243 243 PRO PRO A . n 
A 1 213 GLY 213 244 244 GLY GLY A . n 
A 1 214 GLY 214 245 245 GLY GLY A . n 
A 1 215 LEU 215 246 246 LEU LEU A . n 
A 1 216 ASP 216 247 247 ASP ASP A . n 
A 1 217 LEU 217 248 248 LEU LEU A . n 
A 1 218 LEU 218 249 249 LEU LEU A . n 
A 1 219 LYS 219 250 250 LYS LYS A . n 
A 1 220 HIS 220 251 251 HIS HIS A . n 
A 1 221 THR 221 252 252 THR THR A . n 
A 1 222 THR 222 253 253 THR THR A . n 
A 1 223 ASN 223 254 254 ASN ASN A . n 
A 1 224 VAL 224 255 255 VAL VAL A . n 
A 1 225 VAL 225 256 256 VAL VAL A . n 
A 1 226 LYS 226 257 257 LYS LYS A . n 
A 1 227 ALA 227 258 258 ALA ALA A . n 
A 1 228 HIS 228 259 259 HIS HIS A . n 
A 1 229 THR 229 260 260 THR THR A . n 
A 1 230 ASN 230 261 261 ASN ASN A . n 
A 1 231 ARG 231 262 262 ARG ARG A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1  301 301 ZN  ZN  A . 
C 2 ZN  1  302 302 ZN  ZN  A . 
D 2 ZN  1  303 303 ZN  ZN  A . 
E 3 FZX 1  304 401 FZX L76 A . 
F 4 FMT 1  305 501 FMT FMT A . 
G 4 FMT 1  306 502 FMT FMT A . 
H 5 HOH 1  401 26  HOH HOH A . 
H 5 HOH 2  402 20  HOH HOH A . 
H 5 HOH 3  403 4   HOH HOH A . 
H 5 HOH 4  404 13  HOH HOH A . 
H 5 HOH 5  405 31  HOH HOH A . 
H 5 HOH 6  406 32  HOH HOH A . 
H 5 HOH 7  407 10  HOH HOH A . 
H 5 HOH 8  408 21  HOH HOH A . 
H 5 HOH 9  409 3   HOH HOH A . 
H 5 HOH 10 410 5   HOH HOH A . 
H 5 HOH 11 411 1   HOH HOH A . 
H 5 HOH 12 412 7   HOH HOH A . 
H 5 HOH 13 413 12  HOH HOH A . 
H 5 HOH 14 414 28  HOH HOH A . 
H 5 HOH 15 415 2   HOH HOH A . 
H 5 HOH 16 416 34  HOH HOH A . 
H 5 HOH 17 417 25  HOH HOH A . 
H 5 HOH 18 418 19  HOH HOH A . 
H 5 HOH 19 419 8   HOH HOH A . 
H 5 HOH 20 420 22  HOH HOH A . 
H 5 HOH 21 421 23  HOH HOH A . 
H 5 HOH 22 422 35  HOH HOH A . 
H 5 HOH 23 423 24  HOH HOH A . 
H 5 HOH 24 424 18  HOH HOH A . 
H 5 HOH 25 425 6   HOH HOH A . 
H 5 HOH 26 426 11  HOH HOH A . 
H 5 HOH 27 427 17  HOH HOH A . 
H 5 HOH 28 428 27  HOH HOH A . 
H 5 HOH 29 429 29  HOH HOH A . 
H 5 HOH 30 430 33  HOH HOH A . 
H 5 HOH 31 431 30  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 200  ? 
1 MORE         -80  ? 
1 'SSA (A^2)'  9620 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 83  ? A HIS 114 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 ND1 ? A HIS 85  ? A HIS 116 ? 1_555 90.0  ? 
2  NE2 ? A HIS 83  ? A HIS 114 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 148 ? A HIS 179 ? 1_555 111.6 ? 
3  ND1 ? A HIS 85  ? A HIS 116 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 148 ? A HIS 179 ? 1_555 109.5 ? 
4  NE2 ? A HIS 83  ? A HIS 114 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O   ? H HOH .   ? A HOH 411 ? 1_555 118.2 ? 
5  ND1 ? A HIS 85  ? A HIS 116 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O   ? H HOH .   ? A HOH 411 ? 1_555 111.8 ? 
6  NE2 ? A HIS 148 ? A HIS 179 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O   ? H HOH .   ? A HOH 411 ? 1_555 113.3 ? 
7  OD2 ? A ASP 87  ? A ASP 118 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 SG  ? A CYS 167 ? A CYS 198 ? 1_555 97.7  ? 
8  OD2 ? A ASP 87  ? A ASP 118 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 NE2 ? A HIS 209 ? A HIS 240 ? 1_555 83.9  ? 
9  SG  ? A CYS 167 ? A CYS 198 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 NE2 ? A HIS 209 ? A HIS 240 ? 1_555 87.7  ? 
10 OD2 ? A ASP 87  ? A ASP 118 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O08 ? E FZX .   ? A FZX 304 ? 1_555 169.7 ? 
11 SG  ? A CYS 167 ? A CYS 198 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O08 ? E FZX .   ? A FZX 304 ? 1_555 92.5  ? 
12 NE2 ? A HIS 209 ? A HIS 240 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O08 ? E FZX .   ? A FZX 304 ? 1_555 94.9  ? 
13 OD2 ? A ASP 87  ? A ASP 118 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 N05 ? E FZX .   ? A FZX 304 ? 1_555 92.0  ? 
14 SG  ? A CYS 167 ? A CYS 198 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 N05 ? E FZX .   ? A FZX 304 ? 1_555 170.2 ? 
15 NE2 ? A HIS 209 ? A HIS 240 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 N05 ? E FZX .   ? A FZX 304 ? 1_555 92.6  ? 
16 O08 ? E FZX .   ? A FZX 304 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 N05 ? E FZX .   ? A FZX 304 ? 1_555 77.8  ? 
17 OD2 ? A ASP 87  ? A ASP 118 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O   ? H HOH .   ? A HOH 411 ? 1_555 76.7  ? 
18 SG  ? A CYS 167 ? A CYS 198 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O   ? H HOH .   ? A HOH 411 ? 1_555 107.6 ? 
19 NE2 ? A HIS 209 ? A HIS 240 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O   ? H HOH .   ? A HOH 411 ? 1_555 156.6 ? 
20 O08 ? E FZX .   ? A FZX 304 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O   ? H HOH .   ? A HOH 411 ? 1_555 101.8 ? 
21 N05 ? E FZX .   ? A FZX 304 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O   ? H HOH .   ? A HOH 411 ? 1_555 75.3  ? 
22 NE2 ? A HIS 122 ? A HIS 153 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 6_444 ND1 ? A HIS 220 ? A HIS 251 ? 1_555 61.6  ? 
23 NE2 ? A HIS 122 ? A HIS 153 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 6_444 O1  ? F FMT .   ? A FMT 305 ? 1_555 59.9  ? 
24 ND1 ? A HIS 220 ? A HIS 251 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 6_444 O1  ? F FMT .   ? A FMT 305 ? 1_555 2.2   ? 
25 NE2 ? A HIS 122 ? A HIS 153 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 6_444 O2  ? G FMT .   ? A FMT 306 ? 1_555 59.1  ? 
26 ND1 ? A HIS 220 ? A HIS 251 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 6_444 O2  ? G FMT .   ? A FMT 306 ? 1_555 3.5   ? 
27 O1  ? F FMT .   ? A FMT 305 ? 1_555 ZN ? D ZN . ? A ZN 303 ? 6_444 O2  ? G FMT .   ? A FMT 306 ? 1_555 4.0   ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2021-07-14 
2 'Structure model' 1 1 2022-04-27 
3 'Structure model' 1 2 2023-11-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Data collection'        
3 3 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                      
2 2 'Structure model' citation_author               
3 2 'Structure model' database_2                    
4 3 'Structure model' chem_comp_atom                
5 3 'Structure model' chem_comp_bond                
6 3 'Structure model' pdbx_initial_refinement_model 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                   
2  2 'Structure model' '_citation.journal_abbrev'            
3  2 'Structure model' '_citation.journal_id_CSD'            
4  2 'Structure model' '_citation.journal_id_ISSN'           
5  2 'Structure model' '_citation.journal_volume'            
6  2 'Structure model' '_citation.page_first'                
7  2 'Structure model' '_citation.page_last'                 
8  2 'Structure model' '_citation.pdbx_database_id_DOI'      
9  2 'Structure model' '_citation.pdbx_database_id_PubMed'   
10 2 'Structure model' '_citation.title'                     
11 2 'Structure model' '_citation.year'                      
12 2 'Structure model' '_database_2.pdbx_DOI'                
13 2 'Structure model' '_database_2.pdbx_database_accession' 
# 
_pdbx_phasing_MR.entry_id                     7CHV 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          5.980 
_pdbx_phasing_MR.d_res_low_rotation           39.450 
_pdbx_phasing_MR.d_res_high_translation       5.980 
_pdbx_phasing_MR.d_res_low_translation        39.450 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .           1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .           2 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? 2.6.0       3 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.10.1-2155 4 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25        5 
# 
_pdbx_entry_details.entry_id                 7CHV 
_pdbx_entry_details.has_ligand_of_interest   Y 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OH 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   TYR 
_pdbx_validate_close_contact.auth_seq_id_1    33 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OD1 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ASN 
_pdbx_validate_close_contact.auth_seq_id_2    70 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.14 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 37  ? ? -69.91  4.85    
2  1 ASP A 63  ? ? 16.45   72.47   
3  1 ASP A 84  ? ? 67.39   146.45  
4  1 TRP A 87  ? ? 66.52   69.77   
5  1 ALA A 135 ? ? -171.87 149.37  
6  1 SER A 136 ? ? -49.60  150.60  
7  1 ALA A 178 ? ? -157.52 -100.79 
8  1 SER A 190 ? ? -35.11  -34.07  
9  1 ASN A 210 ? ? -63.76  92.91   
10 1 VAL A 211 ? ? -97.33  38.01   
11 1 TYR A 230 ? ? -144.15 51.23   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 32  ? CG  ? A GLU 1   CG  
2  1 Y 1 A GLU 32  ? CD  ? A GLU 1   CD  
3  1 Y 1 A GLU 32  ? OE1 ? A GLU 1   OE1 
4  1 Y 1 A GLU 32  ? OE2 ? A GLU 1   OE2 
5  1 Y 1 A SER 37  ? CB  ? A SER 6   CB  
6  1 Y 1 A SER 37  ? OG  ? A SER 6   OG  
7  1 Y 1 A ARG 45  ? CG  ? A ARG 14  CG  
8  1 Y 1 A ARG 45  ? CD  ? A ARG 14  CD  
9  1 Y 1 A ARG 45  ? NE  ? A ARG 14  NE  
10 1 Y 1 A ARG 45  ? CZ  ? A ARG 14  CZ  
11 1 Y 1 A ARG 45  ? NH1 ? A ARG 14  NH1 
12 1 Y 1 A ARG 45  ? NH2 ? A ARG 14  NH2 
13 1 Y 1 A ASP 51  ? OD1 ? A ASP 20  OD1 
14 1 Y 1 A ASP 51  ? OD2 ? A ASP 20  OD2 
15 1 Y 1 A GLU 224 ? CD  ? A GLU 193 CD  
16 1 Y 1 A GLU 224 ? OE1 ? A GLU 193 OE1 
17 1 Y 1 A GLU 224 ? OE2 ? A GLU 193 OE2 
18 1 Y 1 A ARG 262 ? CG  ? A ARG 231 CG  
19 1 Y 1 A ARG 262 ? CD  ? A ARG 231 CD  
20 1 Y 1 A ARG 262 ? NE  ? A ARG 231 NE  
21 1 Y 1 A ARG 262 ? CZ  ? A ARG 231 CZ  
22 1 Y 1 A ARG 262 ? NH1 ? A ARG 231 NH1 
23 1 Y 1 A ARG 262 ? NH2 ? A ARG 231 NH2 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CYS N    N  N N 74  
CYS CA   C  N R 75  
CYS C    C  N N 76  
CYS O    O  N N 77  
CYS CB   C  N N 78  
CYS SG   S  N N 79  
CYS OXT  O  N N 80  
CYS H    H  N N 81  
CYS H2   H  N N 82  
CYS HA   H  N N 83  
CYS HB2  H  N N 84  
CYS HB3  H  N N 85  
CYS HG   H  N N 86  
CYS HXT  H  N N 87  
FMT C    C  N N 88  
FMT O1   O  N N 89  
FMT O2   O  N N 90  
FMT H    H  N N 91  
FMT HO2  H  N N 92  
FZX C11  C  Y N 93  
FZX C10  C  Y N 94  
FZX C12  C  Y N 95  
FZX C13  C  Y N 96  
FZX C14  C  Y N 97  
FZX C15  C  Y N 98  
FZX C01  C  Y N 99  
FZX C02  C  Y N 100 
FZX N03  N  Y N 101 
FZX C04  C  Y N 102 
FZX N05  N  Y N 103 
FZX C06  C  N N 104 
FZX O07  O  N N 105 
FZX O08  O  N N 106 
FZX C09  C  N N 107 
FZX H1   H  N N 108 
FZX H2   H  N N 109 
FZX H3   H  N N 110 
FZX H4   H  N N 111 
FZX H5   H  N N 112 
FZX H6   H  N N 113 
FZX H7   H  N N 114 
FZX H8   H  N N 115 
FZX H9   H  N N 116 
FZX H10  H  N N 117 
GLN N    N  N N 118 
GLN CA   C  N S 119 
GLN C    C  N N 120 
GLN O    O  N N 121 
GLN CB   C  N N 122 
GLN CG   C  N N 123 
GLN CD   C  N N 124 
GLN OE1  O  N N 125 
GLN NE2  N  N N 126 
GLN OXT  O  N N 127 
GLN H    H  N N 128 
GLN H2   H  N N 129 
GLN HA   H  N N 130 
GLN HB2  H  N N 131 
GLN HB3  H  N N 132 
GLN HG2  H  N N 133 
GLN HG3  H  N N 134 
GLN HE21 H  N N 135 
GLN HE22 H  N N 136 
GLN HXT  H  N N 137 
GLU N    N  N N 138 
GLU CA   C  N S 139 
GLU C    C  N N 140 
GLU O    O  N N 141 
GLU CB   C  N N 142 
GLU CG   C  N N 143 
GLU CD   C  N N 144 
GLU OE1  O  N N 145 
GLU OE2  O  N N 146 
GLU OXT  O  N N 147 
GLU H    H  N N 148 
GLU H2   H  N N 149 
GLU HA   H  N N 150 
GLU HB2  H  N N 151 
GLU HB3  H  N N 152 
GLU HG2  H  N N 153 
GLU HG3  H  N N 154 
GLU HE2  H  N N 155 
GLU HXT  H  N N 156 
GLY N    N  N N 157 
GLY CA   C  N N 158 
GLY C    C  N N 159 
GLY O    O  N N 160 
GLY OXT  O  N N 161 
GLY H    H  N N 162 
GLY H2   H  N N 163 
GLY HA2  H  N N 164 
GLY HA3  H  N N 165 
GLY HXT  H  N N 166 
HIS N    N  N N 167 
HIS CA   C  N S 168 
HIS C    C  N N 169 
HIS O    O  N N 170 
HIS CB   C  N N 171 
HIS CG   C  Y N 172 
HIS ND1  N  Y N 173 
HIS CD2  C  Y N 174 
HIS CE1  C  Y N 175 
HIS NE2  N  Y N 176 
HIS OXT  O  N N 177 
HIS H    H  N N 178 
HIS H2   H  N N 179 
HIS HA   H  N N 180 
HIS HB2  H  N N 181 
HIS HB3  H  N N 182 
HIS HD1  H  N N 183 
HIS HD2  H  N N 184 
HIS HE1  H  N N 185 
HIS HE2  H  N N 186 
HIS HXT  H  N N 187 
HOH O    O  N N 188 
HOH H1   H  N N 189 
HOH H2   H  N N 190 
ILE N    N  N N 191 
ILE CA   C  N S 192 
ILE C    C  N N 193 
ILE O    O  N N 194 
ILE CB   C  N S 195 
ILE CG1  C  N N 196 
ILE CG2  C  N N 197 
ILE CD1  C  N N 198 
ILE OXT  O  N N 199 
ILE H    H  N N 200 
ILE H2   H  N N 201 
ILE HA   H  N N 202 
ILE HB   H  N N 203 
ILE HG12 H  N N 204 
ILE HG13 H  N N 205 
ILE HG21 H  N N 206 
ILE HG22 H  N N 207 
ILE HG23 H  N N 208 
ILE HD11 H  N N 209 
ILE HD12 H  N N 210 
ILE HD13 H  N N 211 
ILE HXT  H  N N 212 
LEU N    N  N N 213 
LEU CA   C  N S 214 
LEU C    C  N N 215 
LEU O    O  N N 216 
LEU CB   C  N N 217 
LEU CG   C  N N 218 
LEU CD1  C  N N 219 
LEU CD2  C  N N 220 
LEU OXT  O  N N 221 
LEU H    H  N N 222 
LEU H2   H  N N 223 
LEU HA   H  N N 224 
LEU HB2  H  N N 225 
LEU HB3  H  N N 226 
LEU HG   H  N N 227 
LEU HD11 H  N N 228 
LEU HD12 H  N N 229 
LEU HD13 H  N N 230 
LEU HD21 H  N N 231 
LEU HD22 H  N N 232 
LEU HD23 H  N N 233 
LEU HXT  H  N N 234 
LYS N    N  N N 235 
LYS CA   C  N S 236 
LYS C    C  N N 237 
LYS O    O  N N 238 
LYS CB   C  N N 239 
LYS CG   C  N N 240 
LYS CD   C  N N 241 
LYS CE   C  N N 242 
LYS NZ   N  N N 243 
LYS OXT  O  N N 244 
LYS H    H  N N 245 
LYS H2   H  N N 246 
LYS HA   H  N N 247 
LYS HB2  H  N N 248 
LYS HB3  H  N N 249 
LYS HG2  H  N N 250 
LYS HG3  H  N N 251 
LYS HD2  H  N N 252 
LYS HD3  H  N N 253 
LYS HE2  H  N N 254 
LYS HE3  H  N N 255 
LYS HZ1  H  N N 256 
LYS HZ2  H  N N 257 
LYS HZ3  H  N N 258 
LYS HXT  H  N N 259 
PHE N    N  N N 260 
PHE CA   C  N S 261 
PHE C    C  N N 262 
PHE O    O  N N 263 
PHE CB   C  N N 264 
PHE CG   C  Y N 265 
PHE CD1  C  Y N 266 
PHE CD2  C  Y N 267 
PHE CE1  C  Y N 268 
PHE CE2  C  Y N 269 
PHE CZ   C  Y N 270 
PHE OXT  O  N N 271 
PHE H    H  N N 272 
PHE H2   H  N N 273 
PHE HA   H  N N 274 
PHE HB2  H  N N 275 
PHE HB3  H  N N 276 
PHE HD1  H  N N 277 
PHE HD2  H  N N 278 
PHE HE1  H  N N 279 
PHE HE2  H  N N 280 
PHE HZ   H  N N 281 
PHE HXT  H  N N 282 
PRO N    N  N N 283 
PRO CA   C  N S 284 
PRO C    C  N N 285 
PRO O    O  N N 286 
PRO CB   C  N N 287 
PRO CG   C  N N 288 
PRO CD   C  N N 289 
PRO OXT  O  N N 290 
PRO H    H  N N 291 
PRO HA   H  N N 292 
PRO HB2  H  N N 293 
PRO HB3  H  N N 294 
PRO HG2  H  N N 295 
PRO HG3  H  N N 296 
PRO HD2  H  N N 297 
PRO HD3  H  N N 298 
PRO HXT  H  N N 299 
SER N    N  N N 300 
SER CA   C  N S 301 
SER C    C  N N 302 
SER O    O  N N 303 
SER CB   C  N N 304 
SER OG   O  N N 305 
SER OXT  O  N N 306 
SER H    H  N N 307 
SER H2   H  N N 308 
SER HA   H  N N 309 
SER HB2  H  N N 310 
SER HB3  H  N N 311 
SER HG   H  N N 312 
SER HXT  H  N N 313 
THR N    N  N N 314 
THR CA   C  N S 315 
THR C    C  N N 316 
THR O    O  N N 317 
THR CB   C  N R 318 
THR OG1  O  N N 319 
THR CG2  C  N N 320 
THR OXT  O  N N 321 
THR H    H  N N 322 
THR H2   H  N N 323 
THR HA   H  N N 324 
THR HB   H  N N 325 
THR HG1  H  N N 326 
THR HG21 H  N N 327 
THR HG22 H  N N 328 
THR HG23 H  N N 329 
THR HXT  H  N N 330 
TRP N    N  N N 331 
TRP CA   C  N S 332 
TRP C    C  N N 333 
TRP O    O  N N 334 
TRP CB   C  N N 335 
TRP CG   C  Y N 336 
TRP CD1  C  Y N 337 
TRP CD2  C  Y N 338 
TRP NE1  N  Y N 339 
TRP CE2  C  Y N 340 
TRP CE3  C  Y N 341 
TRP CZ2  C  Y N 342 
TRP CZ3  C  Y N 343 
TRP CH2  C  Y N 344 
TRP OXT  O  N N 345 
TRP H    H  N N 346 
TRP H2   H  N N 347 
TRP HA   H  N N 348 
TRP HB2  H  N N 349 
TRP HB3  H  N N 350 
TRP HD1  H  N N 351 
TRP HE1  H  N N 352 
TRP HE3  H  N N 353 
TRP HZ2  H  N N 354 
TRP HZ3  H  N N 355 
TRP HH2  H  N N 356 
TRP HXT  H  N N 357 
TYR N    N  N N 358 
TYR CA   C  N S 359 
TYR C    C  N N 360 
TYR O    O  N N 361 
TYR CB   C  N N 362 
TYR CG   C  Y N 363 
TYR CD1  C  Y N 364 
TYR CD2  C  Y N 365 
TYR CE1  C  Y N 366 
TYR CE2  C  Y N 367 
TYR CZ   C  Y N 368 
TYR OH   O  N N 369 
TYR OXT  O  N N 370 
TYR H    H  N N 371 
TYR H2   H  N N 372 
TYR HA   H  N N 373 
TYR HB2  H  N N 374 
TYR HB3  H  N N 375 
TYR HD1  H  N N 376 
TYR HD2  H  N N 377 
TYR HE1  H  N N 378 
TYR HE2  H  N N 379 
TYR HH   H  N N 380 
TYR HXT  H  N N 381 
VAL N    N  N N 382 
VAL CA   C  N S 383 
VAL C    C  N N 384 
VAL O    O  N N 385 
VAL CB   C  N N 386 
VAL CG1  C  N N 387 
VAL CG2  C  N N 388 
VAL OXT  O  N N 389 
VAL H    H  N N 390 
VAL H2   H  N N 391 
VAL HA   H  N N 392 
VAL HB   H  N N 393 
VAL HG11 H  N N 394 
VAL HG12 H  N N 395 
VAL HG13 H  N N 396 
VAL HG21 H  N N 397 
VAL HG22 H  N N 398 
VAL HG23 H  N N 399 
VAL HXT  H  N N 400 
ZN  ZN   ZN N N 401 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
FMT C   O1   doub N N 83  
FMT C   O2   sing N N 84  
FMT C   H    sing N N 85  
FMT O2  HO2  sing N N 86  
FZX C01 N05  sing Y N 87  
FZX C01 C02  doub Y N 88  
FZX N05 C04  doub Y N 89  
FZX C02 N03  sing Y N 90  
FZX O08 C06  doub N N 91  
FZX C04 C06  sing N N 92  
FZX C04 N03  sing Y N 93  
FZX C06 O07  sing N N 94  
FZX N03 C09  sing N N 95  
FZX C09 C10  sing N N 96  
FZX C11 C10  doub Y N 97  
FZX C11 C12  sing Y N 98  
FZX C10 C15  sing Y N 99  
FZX C12 C13  doub Y N 100 
FZX C15 C14  doub Y N 101 
FZX C13 C14  sing Y N 102 
FZX C11 H1   sing N N 103 
FZX C12 H2   sing N N 104 
FZX C13 H3   sing N N 105 
FZX C14 H4   sing N N 106 
FZX C15 H5   sing N N 107 
FZX C01 H6   sing N N 108 
FZX C02 H7   sing N N 109 
FZX O07 H8   sing N N 110 
FZX C09 H9   sing N N 111 
FZX C09 H10  sing N N 112 
GLN N   CA   sing N N 113 
GLN N   H    sing N N 114 
GLN N   H2   sing N N 115 
GLN CA  C    sing N N 116 
GLN CA  CB   sing N N 117 
GLN CA  HA   sing N N 118 
GLN C   O    doub N N 119 
GLN C   OXT  sing N N 120 
GLN CB  CG   sing N N 121 
GLN CB  HB2  sing N N 122 
GLN CB  HB3  sing N N 123 
GLN CG  CD   sing N N 124 
GLN CG  HG2  sing N N 125 
GLN CG  HG3  sing N N 126 
GLN CD  OE1  doub N N 127 
GLN CD  NE2  sing N N 128 
GLN NE2 HE21 sing N N 129 
GLN NE2 HE22 sing N N 130 
GLN OXT HXT  sing N N 131 
GLU N   CA   sing N N 132 
GLU N   H    sing N N 133 
GLU N   H2   sing N N 134 
GLU CA  C    sing N N 135 
GLU CA  CB   sing N N 136 
GLU CA  HA   sing N N 137 
GLU C   O    doub N N 138 
GLU C   OXT  sing N N 139 
GLU CB  CG   sing N N 140 
GLU CB  HB2  sing N N 141 
GLU CB  HB3  sing N N 142 
GLU CG  CD   sing N N 143 
GLU CG  HG2  sing N N 144 
GLU CG  HG3  sing N N 145 
GLU CD  OE1  doub N N 146 
GLU CD  OE2  sing N N 147 
GLU OE2 HE2  sing N N 148 
GLU OXT HXT  sing N N 149 
GLY N   CA   sing N N 150 
GLY N   H    sing N N 151 
GLY N   H2   sing N N 152 
GLY CA  C    sing N N 153 
GLY CA  HA2  sing N N 154 
GLY CA  HA3  sing N N 155 
GLY C   O    doub N N 156 
GLY C   OXT  sing N N 157 
GLY OXT HXT  sing N N 158 
HIS N   CA   sing N N 159 
HIS N   H    sing N N 160 
HIS N   H2   sing N N 161 
HIS CA  C    sing N N 162 
HIS CA  CB   sing N N 163 
HIS CA  HA   sing N N 164 
HIS C   O    doub N N 165 
HIS C   OXT  sing N N 166 
HIS CB  CG   sing N N 167 
HIS CB  HB2  sing N N 168 
HIS CB  HB3  sing N N 169 
HIS CG  ND1  sing Y N 170 
HIS CG  CD2  doub Y N 171 
HIS ND1 CE1  doub Y N 172 
HIS ND1 HD1  sing N N 173 
HIS CD2 NE2  sing Y N 174 
HIS CD2 HD2  sing N N 175 
HIS CE1 NE2  sing Y N 176 
HIS CE1 HE1  sing N N 177 
HIS NE2 HE2  sing N N 178 
HIS OXT HXT  sing N N 179 
HOH O   H1   sing N N 180 
HOH O   H2   sing N N 181 
ILE N   CA   sing N N 182 
ILE N   H    sing N N 183 
ILE N   H2   sing N N 184 
ILE CA  C    sing N N 185 
ILE CA  CB   sing N N 186 
ILE CA  HA   sing N N 187 
ILE C   O    doub N N 188 
ILE C   OXT  sing N N 189 
ILE CB  CG1  sing N N 190 
ILE CB  CG2  sing N N 191 
ILE CB  HB   sing N N 192 
ILE CG1 CD1  sing N N 193 
ILE CG1 HG12 sing N N 194 
ILE CG1 HG13 sing N N 195 
ILE CG2 HG21 sing N N 196 
ILE CG2 HG22 sing N N 197 
ILE CG2 HG23 sing N N 198 
ILE CD1 HD11 sing N N 199 
ILE CD1 HD12 sing N N 200 
ILE CD1 HD13 sing N N 201 
ILE OXT HXT  sing N N 202 
LEU N   CA   sing N N 203 
LEU N   H    sing N N 204 
LEU N   H2   sing N N 205 
LEU CA  C    sing N N 206 
LEU CA  CB   sing N N 207 
LEU CA  HA   sing N N 208 
LEU C   O    doub N N 209 
LEU C   OXT  sing N N 210 
LEU CB  CG   sing N N 211 
LEU CB  HB2  sing N N 212 
LEU CB  HB3  sing N N 213 
LEU CG  CD1  sing N N 214 
LEU CG  CD2  sing N N 215 
LEU CG  HG   sing N N 216 
LEU CD1 HD11 sing N N 217 
LEU CD1 HD12 sing N N 218 
LEU CD1 HD13 sing N N 219 
LEU CD2 HD21 sing N N 220 
LEU CD2 HD22 sing N N 221 
LEU CD2 HD23 sing N N 222 
LEU OXT HXT  sing N N 223 
LYS N   CA   sing N N 224 
LYS N   H    sing N N 225 
LYS N   H2   sing N N 226 
LYS CA  C    sing N N 227 
LYS CA  CB   sing N N 228 
LYS CA  HA   sing N N 229 
LYS C   O    doub N N 230 
LYS C   OXT  sing N N 231 
LYS CB  CG   sing N N 232 
LYS CB  HB2  sing N N 233 
LYS CB  HB3  sing N N 234 
LYS CG  CD   sing N N 235 
LYS CG  HG2  sing N N 236 
LYS CG  HG3  sing N N 237 
LYS CD  CE   sing N N 238 
LYS CD  HD2  sing N N 239 
LYS CD  HD3  sing N N 240 
LYS CE  NZ   sing N N 241 
LYS CE  HE2  sing N N 242 
LYS CE  HE3  sing N N 243 
LYS NZ  HZ1  sing N N 244 
LYS NZ  HZ2  sing N N 245 
LYS NZ  HZ3  sing N N 246 
LYS OXT HXT  sing N N 247 
PHE N   CA   sing N N 248 
PHE N   H    sing N N 249 
PHE N   H2   sing N N 250 
PHE CA  C    sing N N 251 
PHE CA  CB   sing N N 252 
PHE CA  HA   sing N N 253 
PHE C   O    doub N N 254 
PHE C   OXT  sing N N 255 
PHE CB  CG   sing N N 256 
PHE CB  HB2  sing N N 257 
PHE CB  HB3  sing N N 258 
PHE CG  CD1  doub Y N 259 
PHE CG  CD2  sing Y N 260 
PHE CD1 CE1  sing Y N 261 
PHE CD1 HD1  sing N N 262 
PHE CD2 CE2  doub Y N 263 
PHE CD2 HD2  sing N N 264 
PHE CE1 CZ   doub Y N 265 
PHE CE1 HE1  sing N N 266 
PHE CE2 CZ   sing Y N 267 
PHE CE2 HE2  sing N N 268 
PHE CZ  HZ   sing N N 269 
PHE OXT HXT  sing N N 270 
PRO N   CA   sing N N 271 
PRO N   CD   sing N N 272 
PRO N   H    sing N N 273 
PRO CA  C    sing N N 274 
PRO CA  CB   sing N N 275 
PRO CA  HA   sing N N 276 
PRO C   O    doub N N 277 
PRO C   OXT  sing N N 278 
PRO CB  CG   sing N N 279 
PRO CB  HB2  sing N N 280 
PRO CB  HB3  sing N N 281 
PRO CG  CD   sing N N 282 
PRO CG  HG2  sing N N 283 
PRO CG  HG3  sing N N 284 
PRO CD  HD2  sing N N 285 
PRO CD  HD3  sing N N 286 
PRO OXT HXT  sing N N 287 
SER N   CA   sing N N 288 
SER N   H    sing N N 289 
SER N   H2   sing N N 290 
SER CA  C    sing N N 291 
SER CA  CB   sing N N 292 
SER CA  HA   sing N N 293 
SER C   O    doub N N 294 
SER C   OXT  sing N N 295 
SER CB  OG   sing N N 296 
SER CB  HB2  sing N N 297 
SER CB  HB3  sing N N 298 
SER OG  HG   sing N N 299 
SER OXT HXT  sing N N 300 
THR N   CA   sing N N 301 
THR N   H    sing N N 302 
THR N   H2   sing N N 303 
THR CA  C    sing N N 304 
THR CA  CB   sing N N 305 
THR CA  HA   sing N N 306 
THR C   O    doub N N 307 
THR C   OXT  sing N N 308 
THR CB  OG1  sing N N 309 
THR CB  CG2  sing N N 310 
THR CB  HB   sing N N 311 
THR OG1 HG1  sing N N 312 
THR CG2 HG21 sing N N 313 
THR CG2 HG22 sing N N 314 
THR CG2 HG23 sing N N 315 
THR OXT HXT  sing N N 316 
TRP N   CA   sing N N 317 
TRP N   H    sing N N 318 
TRP N   H2   sing N N 319 
TRP CA  C    sing N N 320 
TRP CA  CB   sing N N 321 
TRP CA  HA   sing N N 322 
TRP C   O    doub N N 323 
TRP C   OXT  sing N N 324 
TRP CB  CG   sing N N 325 
TRP CB  HB2  sing N N 326 
TRP CB  HB3  sing N N 327 
TRP CG  CD1  doub Y N 328 
TRP CG  CD2  sing Y N 329 
TRP CD1 NE1  sing Y N 330 
TRP CD1 HD1  sing N N 331 
TRP CD2 CE2  doub Y N 332 
TRP CD2 CE3  sing Y N 333 
TRP NE1 CE2  sing Y N 334 
TRP NE1 HE1  sing N N 335 
TRP CE2 CZ2  sing Y N 336 
TRP CE3 CZ3  doub Y N 337 
TRP CE3 HE3  sing N N 338 
TRP CZ2 CH2  doub Y N 339 
TRP CZ2 HZ2  sing N N 340 
TRP CZ3 CH2  sing Y N 341 
TRP CZ3 HZ3  sing N N 342 
TRP CH2 HH2  sing N N 343 
TRP OXT HXT  sing N N 344 
TYR N   CA   sing N N 345 
TYR N   H    sing N N 346 
TYR N   H2   sing N N 347 
TYR CA  C    sing N N 348 
TYR CA  CB   sing N N 349 
TYR CA  HA   sing N N 350 
TYR C   O    doub N N 351 
TYR C   OXT  sing N N 352 
TYR CB  CG   sing N N 353 
TYR CB  HB2  sing N N 354 
TYR CB  HB3  sing N N 355 
TYR CG  CD1  doub Y N 356 
TYR CG  CD2  sing Y N 357 
TYR CD1 CE1  sing Y N 358 
TYR CD1 HD1  sing N N 359 
TYR CD2 CE2  doub Y N 360 
TYR CD2 HD2  sing N N 361 
TYR CE1 CZ   doub Y N 362 
TYR CE1 HE1  sing N N 363 
TYR CE2 CZ   sing Y N 364 
TYR CE2 HE2  sing N N 365 
TYR CZ  OH   sing N N 366 
TYR OH  HH   sing N N 367 
TYR OXT HXT  sing N N 368 
VAL N   CA   sing N N 369 
VAL N   H    sing N N 370 
VAL N   H2   sing N N 371 
VAL CA  C    sing N N 372 
VAL CA  CB   sing N N 373 
VAL CA  HA   sing N N 374 
VAL C   O    doub N N 375 
VAL C   OXT  sing N N 376 
VAL CB  CG1  sing N N 377 
VAL CB  CG2  sing N N 378 
VAL CB  HB   sing N N 379 
VAL CG1 HG11 sing N N 380 
VAL CG1 HG12 sing N N 381 
VAL CG1 HG13 sing N N 382 
VAL CG2 HG21 sing N N 383 
VAL CG2 HG22 sing N N 384 
VAL CG2 HG23 sing N N 385 
VAL OXT HXT  sing N N 386 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Science Foundation (NSF, China)' China 81874291 1 
'National Science Foundation (NSF, China)' China 81502989 2 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        FZX 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   FZX 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'                                    ZN  
3 '1-(phenylmethyl)imidazole-2-carboxylic acid' FZX 
4 'FORMIC ACID'                                 FMT 
5 water                                         HOH 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   6JN6 
_pdbx_initial_refinement_model.details          ? 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#