data_7CKD # _entry.id 7CKD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.370 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7CKD pdb_00007ckd 10.2210/pdb7ckd/pdb WWPDB D_1300017759 ? ? BMRB 36362 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of NCR169 oxidized form 1 from Medicago truncatula' _pdbx_database_related.db_id 36362 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7CKD _pdbx_database_status.recvd_initial_deposition_date 2020-07-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Isozumi, N.' 1 ? 'Masubuchi, Y.' 2 ? 'Ohki, S.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 9923 _citation.page_last 9923 _citation.title 'Structure and antimicrobial activity of NCR169, a nodule-specific cysteine-rich peptide of Medicago truncatula.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-021-89485-w _citation.pdbx_database_id_PubMed 33972675 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Isozumi, N.' 1 ? primary 'Masubuchi, Y.' 2 ? primary 'Imamura, T.' 3 ? primary 'Mori, M.' 4 ? primary 'Koga, H.' 5 ? primary 'Ohki, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Nodule Cysteine-Rich (NCR) secreted peptide' _entity.formula_weight 4630.519 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Nodule-specific cysteine-rich peptide 169' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GEDIGHIKYCGIVDDCYKSKKPLFKIWKCVENVCVLWYK _entity_poly.pdbx_seq_one_letter_code_can GEDIGHIKYCGIVDDCYKSKKPLFKIWKCVENVCVLWYK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLU n 1 3 ASP n 1 4 ILE n 1 5 GLY n 1 6 HIS n 1 7 ILE n 1 8 LYS n 1 9 TYR n 1 10 CYS n 1 11 GLY n 1 12 ILE n 1 13 VAL n 1 14 ASP n 1 15 ASP n 1 16 CYS n 1 17 TYR n 1 18 LYS n 1 19 SER n 1 20 LYS n 1 21 LYS n 1 22 PRO n 1 23 LEU n 1 24 PHE n 1 25 LYS n 1 26 ILE n 1 27 TRP n 1 28 LYS n 1 29 CYS n 1 30 VAL n 1 31 GLU n 1 32 ASN n 1 33 VAL n 1 34 CYS n 1 35 VAL n 1 36 LEU n 1 37 TRP n 1 38 TYR n 1 39 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 39 _entity_src_gen.gene_src_common_name 'Barrel medic' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MTR_7g029760 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Medicago truncatula' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3880 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A7KHA7_MEDTR _struct_ref.pdbx_db_accession A7KHA7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EDIGHIKYCGIVDDCYKSKKPLFKIWKCVENVCVLWYK _struct_ref.pdbx_align_begin 24 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7CKD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 39 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A7KHA7 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 61 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 39 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7CKD _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code A7KHA7 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 2 '2D 1H-15N HSQC' 1 isotropic 4 1 2 '3D 1H-15N TOCSY' 1 isotropic 5 1 2 '3D 1H-15N NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 2.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.7 mM peptide, 90% H2O/10% D2O' '90% H2O/10% D2O' label-free solution ? 2 '0.4 mM [U-99% 15N] peptide, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_sample solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 7CKD _pdbx_nmr_refine.method na _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 7CKD _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7CKD _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # _pdbx_nmr_software.ordinal 1 _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name CYANA _pdbx_nmr_software.version ? _pdbx_nmr_software.authors 'Guntert P.' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7CKD _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7CKD _struct.title 'Solution structure of NCR169 oxidized form 1 from Medicago truncatula' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7CKD _struct_keywords.text 'Medicago truncatula, nodule-specific cysteine-rich peptide, antimicrobial peptide, disulfide bond, PLANT PROTEIN' _struct_keywords.pdbx_keywords 'PLANT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 16 SG ? ? A CYS 10 A CYS 16 1_555 ? ? ? ? ? ? ? 2.041 ? ? disulf2 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 29 A CYS 34 1_555 ? ? ? ? ? ? ? 2.101 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 28 ? CYS A 29 ? LYS A 28 CYS A 29 AA1 2 CYS A 34 ? VAL A 35 ? CYS A 34 VAL A 35 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 28 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 28 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 35 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 35 # _atom_sites.entry_id 7CKD _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 LYS 39 39 39 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4270 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-05-26 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 peptide 0.7 ? mM 'natural abundance' 2 peptide 0.4 ? mM '[U-99% 15N]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 2 ? ? 62.19 166.84 2 1 LYS A 8 ? ? -92.48 59.47 3 1 VAL A 13 ? ? 52.40 88.75 4 1 SER A 19 ? ? -58.32 -178.65 5 1 LYS A 21 ? ? 62.08 73.60 6 1 PHE A 24 ? ? -109.69 -74.37 7 1 ILE A 26 ? ? 64.66 104.17 8 1 TRP A 37 ? ? -146.37 -42.21 9 2 TYR A 9 ? ? 53.07 90.00 10 2 ASP A 14 ? ? -167.55 29.10 11 2 ASP A 15 ? ? 52.02 88.51 12 2 CYS A 16 ? ? -104.56 40.63 13 2 LYS A 20 ? ? -150.18 22.23 14 2 LYS A 21 ? ? 61.69 71.29 15 2 PRO A 22 ? ? -69.77 73.18 16 2 PHE A 24 ? ? -152.71 46.58 17 2 LYS A 25 ? ? -136.23 -47.92 18 2 ILE A 26 ? ? 64.16 108.11 19 3 ILE A 4 ? ? 65.31 151.70 20 3 LYS A 8 ? ? -141.12 38.63 21 3 ILE A 12 ? ? -80.89 -72.26 22 3 ASP A 15 ? ? 60.18 68.06 23 3 LYS A 18 ? ? -149.01 27.23 24 3 SER A 19 ? ? -55.54 176.01 25 3 LYS A 21 ? ? -112.00 78.07 26 3 LEU A 23 ? ? -147.94 -52.51 27 3 PHE A 24 ? ? 178.39 -55.48 28 3 LYS A 25 ? ? -147.77 -42.29 29 3 ILE A 26 ? ? 63.92 104.95 30 3 TRP A 37 ? ? -134.81 -40.97 31 3 TYR A 38 ? ? -51.91 -73.53 32 4 CYS A 10 ? ? -179.01 -175.08 33 4 VAL A 13 ? ? 71.58 -69.49 34 4 SER A 19 ? ? 59.70 97.86 35 4 LYS A 21 ? ? -112.03 78.10 36 4 PHE A 24 ? ? -118.98 -70.57 37 4 ILE A 26 ? ? 64.12 108.03 38 4 TRP A 37 ? ? -156.15 -41.45 39 4 TYR A 38 ? ? -51.93 -73.57 40 5 ILE A 12 ? ? 64.26 101.04 41 5 LYS A 21 ? ? -112.03 78.09 42 5 PHE A 24 ? ? -171.88 32.87 43 5 ILE A 26 ? ? 64.63 110.13 44 5 TRP A 37 ? ? -146.97 -41.98 45 5 TYR A 38 ? ? -51.43 -75.94 46 6 CYS A 10 ? ? 63.74 159.14 47 6 LYS A 25 ? ? 69.11 -74.58 48 6 ILE A 26 ? ? 65.84 115.21 49 6 TRP A 27 ? ? -122.66 -69.00 50 7 LYS A 8 ? ? -171.39 56.60 51 7 VAL A 13 ? ? 63.93 66.93 52 7 ASP A 14 ? ? -145.61 29.70 53 7 ASP A 15 ? ? 63.63 83.49 54 7 CYS A 16 ? ? -68.78 86.21 55 7 TYR A 17 ? ? -90.62 48.35 56 7 LYS A 18 ? ? -160.08 26.61 57 7 PRO A 22 ? ? -69.73 73.22 58 7 PHE A 24 ? ? -114.78 -73.32 59 7 ILE A 26 ? ? 64.03 106.65 60 7 TRP A 37 ? ? -163.51 -39.47 61 8 ASP A 3 ? ? -140.07 59.63 62 8 LYS A 8 ? ? -107.52 42.63 63 8 VAL A 13 ? ? -177.40 125.93 64 8 ASP A 15 ? ? 63.29 161.10 65 8 TYR A 17 ? ? -152.90 81.18 66 8 SER A 19 ? ? 58.01 95.82 67 8 LYS A 21 ? ? -111.99 78.12 68 8 LEU A 23 ? ? 57.91 178.95 69 8 LYS A 25 ? ? 69.51 -73.32 70 8 ILE A 26 ? ? 65.96 115.40 71 8 TRP A 27 ? ? -122.50 -69.31 72 9 HIS A 6 ? ? 63.31 103.50 73 9 ILE A 12 ? ? -134.04 -67.50 74 9 VAL A 13 ? ? -152.02 -41.59 75 9 ASP A 14 ? ? -142.18 26.52 76 9 LYS A 18 ? ? -145.64 26.64 77 9 SER A 19 ? ? 61.46 168.38 78 9 LYS A 21 ? ? -111.98 78.20 79 9 LEU A 23 ? ? -74.72 -72.76 80 9 PHE A 24 ? ? 63.09 163.26 81 9 LYS A 25 ? ? 70.00 -72.95 82 9 ILE A 26 ? ? 66.03 115.99 83 9 TRP A 27 ? ? -124.78 -68.94 84 9 TRP A 37 ? ? -136.61 -41.52 85 10 LYS A 8 ? ? 64.92 74.65 86 10 ASP A 14 ? ? -156.81 -68.55 87 10 TYR A 17 ? ? -68.53 -176.50 88 10 LYS A 21 ? ? -111.94 78.18 89 10 PHE A 24 ? ? 178.40 -65.78 90 10 ILE A 26 ? ? 64.57 104.47 91 10 TRP A 37 ? ? -153.52 -41.82 92 11 GLU A 2 ? ? -165.66 78.78 93 11 ASP A 15 ? ? -52.00 -74.78 94 11 SER A 19 ? ? 62.42 164.66 95 11 LYS A 21 ? ? -112.02 78.12 96 11 PRO A 22 ? ? -69.80 73.36 97 11 PHE A 24 ? ? -161.43 26.10 98 11 LYS A 25 ? ? -142.00 -43.10 99 11 ILE A 26 ? ? 62.76 104.62 100 12 HIS A 6 ? ? -99.72 56.06 101 12 ILE A 12 ? ? -130.29 -44.83 102 12 VAL A 13 ? ? -150.37 21.08 103 12 CYS A 16 ? ? -117.77 76.76 104 12 LYS A 18 ? ? -173.40 32.14 105 12 SER A 19 ? ? -166.17 43.83 106 12 LYS A 21 ? ? -111.99 78.09 107 12 PRO A 22 ? ? -69.74 -171.04 108 12 LEU A 23 ? ? 60.03 -170.13 109 12 PHE A 24 ? ? -167.11 32.10 110 12 LYS A 25 ? ? -148.83 -48.26 111 12 ILE A 26 ? ? 63.85 107.15 112 13 LYS A 18 ? ? 62.85 103.00 113 13 SER A 19 ? ? 60.52 -176.18 114 13 PHE A 24 ? ? -162.54 -41.12 115 13 ILE A 26 ? ? 62.86 104.53 116 13 TRP A 37 ? ? -144.58 -42.33 117 14 GLU A 2 ? ? 61.37 -179.63 118 14 ASP A 3 ? ? -118.42 64.01 119 14 TYR A 9 ? ? 57.74 95.38 120 14 CYS A 10 ? ? -178.91 148.95 121 14 ILE A 12 ? ? -122.02 -69.23 122 14 VAL A 13 ? ? -135.65 -41.14 123 14 PRO A 22 ? ? -69.77 -179.93 124 14 LEU A 23 ? ? 58.41 179.42 125 14 PHE A 24 ? ? -171.44 -44.22 126 14 ILE A 26 ? ? 63.81 105.73 127 15 ILE A 4 ? ? -64.46 98.06 128 15 TYR A 9 ? ? 51.85 88.77 129 15 ASP A 14 ? ? 66.38 118.40 130 15 PRO A 22 ? ? -69.76 73.22 131 15 LEU A 23 ? ? -57.66 178.87 132 15 PHE A 24 ? ? -66.73 -70.90 133 15 ILE A 26 ? ? 64.90 104.52 134 15 TRP A 37 ? ? -146.77 -42.31 135 16 HIS A 6 ? ? -96.44 52.32 136 16 TYR A 9 ? ? -99.49 -60.32 137 16 ILE A 12 ? ? -51.02 -77.71 138 16 VAL A 13 ? ? 69.24 -70.75 139 16 ASP A 14 ? ? -147.97 -40.94 140 16 ASP A 15 ? ? -139.54 -44.51 141 16 CYS A 16 ? ? -178.16 -35.21 142 16 TYR A 17 ? ? 60.74 177.81 143 16 LYS A 18 ? ? -140.13 49.43 144 16 SER A 19 ? ? -160.67 97.42 145 16 LYS A 20 ? ? -145.11 21.77 146 16 ILE A 26 ? ? 62.87 104.80 147 16 TRP A 37 ? ? -145.54 -42.33 148 17 CYS A 10 ? ? -158.32 -67.05 149 17 VAL A 13 ? ? -175.98 122.99 150 17 ASP A 14 ? ? 72.23 -69.37 151 17 ASP A 15 ? ? -177.10 -74.75 152 17 CYS A 16 ? ? 62.37 103.33 153 17 LYS A 18 ? ? 63.34 94.42 154 17 LYS A 20 ? ? -156.98 23.41 155 17 LYS A 21 ? ? 60.58 70.64 156 17 LEU A 23 ? ? -69.82 -75.56 157 17 LYS A 25 ? ? -173.49 -60.81 158 17 ILE A 26 ? ? 66.78 132.53 159 17 TRP A 27 ? ? -143.27 -69.48 160 17 ASN A 32 ? ? 59.53 19.37 161 18 HIS A 6 ? ? 62.60 166.46 162 18 CYS A 10 ? ? -171.59 -41.19 163 18 ASP A 14 ? ? -137.02 -66.89 164 18 LYS A 21 ? ? 61.51 75.10 165 18 LEU A 23 ? ? -79.40 -74.76 166 18 LYS A 25 ? ? -174.12 -44.78 167 18 ILE A 26 ? ? 63.06 105.46 168 18 TRP A 37 ? ? -144.92 -42.16 169 19 ASP A 3 ? ? -60.58 -169.14 170 19 ILE A 4 ? ? 61.80 109.17 171 19 CYS A 10 ? ? 66.52 138.78 172 19 ILE A 12 ? ? -118.73 -70.54 173 19 VAL A 13 ? ? -152.10 -41.67 174 19 TYR A 17 ? ? 63.28 179.36 175 19 SER A 19 ? ? -179.30 125.85 176 19 LYS A 21 ? ? 61.24 71.04 177 19 PHE A 24 ? ? -152.31 26.08 178 19 LYS A 25 ? ? -147.21 -46.05 179 19 ILE A 26 ? ? 64.07 107.69 180 20 HIS A 6 ? ? -105.03 42.62 181 20 ASP A 15 ? ? 61.31 178.48 182 20 CYS A 16 ? ? -155.36 -74.80 183 20 TYR A 17 ? ? 176.35 177.58 184 20 LYS A 18 ? ? -99.04 30.03 185 20 SER A 19 ? ? -174.61 145.21 186 20 LYS A 25 ? ? 70.73 -71.04 187 20 ILE A 26 ? ? 65.71 113.86 188 20 TRP A 27 ? ? -120.57 -68.83 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #